F454820

General Info

Members Datasets Scaffolds Average Seq Length
495 303 368 658

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019769354|8019773080
Length 654
Sequence LPYAQLDWDDQGRPRSRVFDDVYFSSDSGLDETRHVFIEQNRLGERFAALAAGQRFVIGETGFGTGLNFLCAWQLFRQQAPAGARLHFVSVEKYPLSHADLQRALALWPELADLAQPLLEQYQAIHGGFQRLVLDQGRVILTLLIGDALEQLPQLDAQVDAWFLDGFAPAKNPEMWTAELFAELARLAAPGASISTFTSAGWVRRLLNAAGFKMKRTPGIGRKWEVLRGEFLGWPEETPAPTAAKPWFARPPRQDKTALVIGGGLAGCSSAASLAARGWQVQLLERHGQLAQEASGNPQGVLYLKLSAHGTALSQMILSGFGYTRRQLEHLQRGLDWDACGVLQLAFNPKEAERQAQLAAAFPHDLLHILDREQAQARAGIGLEYGGLFFPEGGWVHPPALCQWQAGHPGIQVLTHRQVLELRRVDQQWQAWDGEQLLASAAVVILAGAAEIKQFPASAELPLKRIRGQITRLPQTARSQALATVVCAEGYVAPPRLGEHTLGASFDFHSQDLAPTTAEHAGNLEMLREISSDLLHRLEVEQLPLEDLQGRAAFRCTSPDYLPIVGPLADPAAFVDTYAALGKDARQVPDLPCPWLEGLYINSGHGSRGLITAPLSGELLAAWLENEPLPLPRSVAEACHPNRFALRRLIRGKA

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231018 Pseudomonas sp. GM60 Isolate Nodule
4 2511231019 Pseudomonas sp. GM67 Isolate Nodule
5 2511231020 Pseudomonas sp. GM74 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
8 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
9 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
10 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
11 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
12 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
13 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
14 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
15 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
16 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
17 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
18 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
19 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
20 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
21 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
22 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
23 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
24 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
25 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
26 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
27 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
28 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
29 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
30 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
31 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
32 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
33 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
34 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
35 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
36 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
37 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
38 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
39 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
40 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
41 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
42 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
43 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
44 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
45 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
46 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
47 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
48 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
49 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
50 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
51 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
52 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
53 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
54 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
55 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
56 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
57 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
58 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
59 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
60 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
61 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
62 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
63 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
64 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
65 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
66 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
67 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
68 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
69 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
70 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
71 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
72 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
73 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
74 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
75 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
76 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
77 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
78 2773857670 Pseudomonas sp. 478 Isolate Unclassified
79 2784132072 Pseudomonas sp. 460 Isolate Unclassified
80 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
81 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
82 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
83 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
84 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
85 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
86 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
87 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
88 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
89 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
90 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
91 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
92 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
93 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
94 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
95 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
96 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
97 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
98 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
99 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
100 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
101 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
102 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
103 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
104 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
105 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
106 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
107 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
108 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
109 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
110 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
111 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
112 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
113 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
114 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
115 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
116 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
117 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
118 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
119 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
120 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
121 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
122 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
123 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
124 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
125 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
126 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
127 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
128 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
129 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
130 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
131 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
132 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
135 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
136 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
189 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
196 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
197 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
198 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
199 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
200 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
201 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
202 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
293 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
294 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
295 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
296 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
297 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
298 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
299 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
300 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
301 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
302 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
303 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.34
Metatranscriptomes 0
Isolates 25.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 1.62
Rhizoplane 10.71
Rhizosphere 65.25
Stem 0
Stem Tuber 0
Unclassified 15.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000358 3300002737 Bacteria 38892
2 JGI25163J39215_1000147 3300002771 Bacteria 27769
3 JGI25163J39215_1000455 3300002771 Bacteria 12358
4 JGI25164J39214_1000266 3300002772 Bacteria 38892
5 JGI25164J39214_1000272 3300002772 Bacteria 37918
6 JGI25165J46597_1000479 3300003214 Bacteria 38892
7 JGI25165J46597_1000496 3300003214 Bacteria 37918
8 Ga0055538_1000079 3300003751 Bacteria 85355
9 Ga0055539_1000120 3300003752 Bacteria 85355
10 Ga0055533_1000128 3300003756 Bacteria 85355
11 Ga0055532_1000116 3300003758 Bacteria 85351
12 Ga0055525_1000165 3300003759 Bacteria 85355
13 Ga0055530_10000367 3300003791 Bacteria 40952
14 Ga0055541_1000080 3300003841 Bacteria 85355
15 Ga0065714_10002255 3300005288 Bacteria 42568
16 Ga0065714_10002472 3300005288 Bacteria 23443
17 Ga0065714_10003339 3300005288 Bacteria 7804
18 Ga0065714_10065296 3300005288 Bacteria 11090
19 Ga0065704_10076822 3300005289 Bacteria 4965
20 Ga0070670_100000045 3300005331 Bacteria 140180
21 Ga0070670_100002613 3300005331 Bacteria 14889
22 Ga0070661_100006754 3300005344 Bacteria 7909
23 Ga0070669_100001277 3300005353 Bacteria 18240
24 Ga0070662_100000565 3300005457 Bacteria 22546
25 Ga0068853_100046063 3300005539 Bacteria 3738
26 Ga0070664_100009176 3300005564 Bacteria 8030
27 Ga0070664_100050747 3300005564 Bacteria 3512
28 Ga0068851_10000040 3300005834 Bacteria 93172
29 Ga0075432_10000033 3300006058 Bacteria 25255
30 Ga0075432_10009359 3300006058 Bacteria 3336
31 Ga0079104_1000545 3300006946 Bacteria 39305
32 Ga0105251_10001487 3300009011 Bacteria 20109
33 Ga0105251_10002069 3300009011 Bacteria 16202
34 Ga0105251_10034214 3300009011 Bacteria 2517
35 Ga0105244_10005906 3300009036 Bacteria 8036
36 Ga0105244_10006198 3300009036 Bacteria 7800
37 Ga0105250_10000381 3300009092 Bacteria 33174
38 Ga0105243_10106130 3300009148 Bacteria 2341
39 Ga0105242_10000321 3300009176 Bacteria 38554
40 Ga0105237_10015275 3300009545 Bacteria 7997
41 Ga0105246_10000513 3300011119 Bacteria 21097
42 Ga0105246_10013707 3300011119 Bacteria 5086
43 Ga0157373_10001051 3300013100 Bacteria 21283
44 Ga0157373_10001800 3300013100 Bacteria 16308
45 Ga0157373_10011340 3300013100 Bacteria 6554
46 Ga0157371_10000402 3300013102 Bacteria 54247
47 Ga0157371_10001305 3300013102 Bacteria 26204
48 Ga0157370_10008724 3300013104 Bacteria 10907
49 Ga0157369_10008322 3300013105 Bacteria 11889
50 Ga0157369_10009567 3300013105 Bacteria 11087
51 Ga0157369_10015934 3300013105 Bacteria 8460
52 Ga0163162_10010694 3300013306 Bacteria 8926
53 Ga0163162_10026121 3300013306 Bacteria 5771
54 Ga0157375_10004911 3300013308 Bacteria 11627
55 Ga0157375_10008675 3300013308 Bacteria 8908
56 Ga0182008_10000149 3300014497 Bacteria 54523
57 Ga0182008_10001805 3300014497 Bacteria 13978
58 Ga0182006_1000561 3300015261 Bacteria 27855
59 Ga0182007_10000945 3300015262 Bacteria 15982
60 Ga0182005_1001919 3300015265 Bacteria 7875
61 Ga0163161_10002323 3300017792 Bacteria 13626
62 Ga0163161_10004427 3300017792 Bacteria 9797
63 Ga0163161_10004905 3300017792 Bacteria 9316
64 Ga0163161_10005710 3300017792 Bacteria 8626
65 Ga0163161_10007668 3300017792 Bacteria 7464
66 Ga0209760_100011 3300025207 Bacteria 197221
67 Ga0209760_100064 3300025207 Bacteria 91180
68 Ga0209784_100017 3300025224 Bacteria 472003
69 Ga0209566_100014 3300025225 Bacteria 472003
70 Ga0209674_100028 3300025226 Bacteria 472003
71 Ga0209147_100105 3300025229 Bacteria 157437
72 Ga0209563_100032 3300025230 Bacteria 472003
73 Ga0207427_100008 3300025231 Bacteria 740731
74 Ga0207427_100082 3300025231 Bacteria 142809
75 Ga0209437_100006 3300025233 Bacteria 1042724
76 Ga0209437_100014 3300025233 Bacteria 740714
77 Ga0209437_101834 3300025233 Bacteria 4537
78 Ga0209258_100194 3300025242 Bacteria 124587
79 Ga0209646_1000416 3300025246 Bacteria 24235
80 Ga0209677_100018 3300025253 Bacteria 472003
81 Ga0209233_1000008 3300025261 Bacteria 1356712
82 Ga0209233_1000105 3300025261 Bacteria 272035
83 Ga0209676_1000006 3300025292 Bacteria 1039588
84 Ga0209676_1001648 3300025292 Bacteria 19583
85 Ga0209050_1000260 3300025298 Bacteria 113066
86 Ga0209050_1001348 3300025298 Bacteria 27074
87 Ga0209051_1000163 3300025303 Bacteria 124249
88 Ga0207656_10000047 3300025321 Bacteria 46771
89 Ga0207696_1000043 3300025711 Bacteria 307112
90 Ga0207655_1000407 3300025728 Bacteria 59248
91 Ga0207655_1016478 3300025728 Bacteria 4037
92 Ga0207655_1029852 3300025728 Bacteria 2545
93 Ga0207713_1000358 3300025735 Bacteria 49769
94 Ga0207713_1001287 3300025735 Bacteria 20678
95 Ga0207713_1006902 3300025735 Bacteria 6821
96 Ga0207713_1015476 3300025735 Bacteria 3912
97 Ga0207671_10001896 3300025914 Bacteria 23245
98 Ga0207649_10000237 3300025920 Bacteria 45073
99 Ga0207681_10001026 3300025923 Bacteria 18163
100 Ga0207650_10000135 3300025925 Bacteria 90396
101 Ga0207650_10000425 3300025925 Bacteria 37178
102 Ga0207706_10000460 3300025933 Bacteria 43393
103 Ga0207679_10000005 3300025945 Bacteria 525011
104 Ga0207639_10055138 3300026041 Bacteria 3041
105 Ga0209281_1000018 3300027111 Bacteria 579091
106 Ga0307517_10074548 3300028786 Bacteria 2991
107 Ga0307509_10046554 3300031507 Bacteria 4670
108 Ga0307408_100052302 3300031548 Bacteria 2945
109 Ga0307405_10000217 3300031731 Bacteria 20679
110 Ga0307411_10001653 3300032005 Bacteria 9310
111 Ga0439438_001223 3300041405 Bacteria 11394
112 Ga0439438_001736 3300041405 Bacteria 9579
113 Ga0439438_008800 3300041405 Bacteria 3313
114 Ga0439438_008988 3300041405 Bacteria 3265
115 Ga0439447_000266 3300041407 Bacteria 18450
116 Ga0439447_000565 3300041407 Bacteria 13792
117 Ga0439447_002981 3300041407 Bacteria 6069
118 Ga0439466_0000555 3300041411 Bacteria 14088
119 Ga0439466_0013870 3300041411 Bacteria 2945
120 Ga0439466_0026309 3300041411 Bacteria 2024
121 Ga0439431_0002017 3300041997 Bacteria 4494
122 Ga0439432_000002 3300042006 Bacteria 117808
123 Ga0439432_011569 3300042006 Bacteria 3040
124 Ga0439451_001231 3300042009 Bacteria 5049
125 Ga0439452_000213 3300042010 Bacteria 40971
126 Ga0439452_000260 3300042010 Bacteria 35564
127 Ga0439452_002435 3300042010 Bacteria 6861
128 Ga0439452_004565 3300042010 Bacteria 4613
129 Ga0439463_001031 3300042016 Bacteria 7558
130 Ga0450911_002796 3300042115 Bacteria 3288
131 Ga0450911_003838 3300042115 Bacteria 2564
132 Ga0450922_000170 3300042124 Bacteria 6688
133 Ga0450923_002755 3300042125 Bacteria 2564
134 Ga0450902_002484 3300042137 Bacteria 2618
135 Ga0450902_002512 3300042137 Bacteria 2606
136 Ga0450903_003696 3300042138 Bacteria 2638
137 Ga0450905_001662 3300042142 Bacteria 2839
138 Ga0450907_002654 3300042146 Bacteria 3338
139 Ga0439434_0000779 3300042435 Bacteria 9165
140 Ga0439460_0002278 3300042461 Bacteria 4619
141 Ga0439440_0003974 3300042993 Bacteria 2885
142 Ga0495617_001605 3300046452 Bacteria 9767
143 Ga0495617_007681 3300046452 Bacteria 3732
144 Ga0495617_008169 3300046452 Bacteria 3614
145 Ga0495617_017431 3300046452 Bacteria 2426
146 Ga0495627_001093 3300046453 Bacteria 17709
147 Ga0495627_001950 3300046453 Bacteria 10695
148 Ga0495627_015758 3300046453 Bacteria 2604
149 Ga0495603_0007044 3300046455 Bacteria 6746
150 Ga0495603_0039485 3300046455 Bacteria 2827
151 Ga0495590_0005518 3300046457 Bacteria 5010
152 Ga0495591_000311 3300046458 Bacteria 44231
153 Ga0495591_001050 3300046458 Bacteria 18566
154 Ga0495591_001730 3300046458 Bacteria 13007
155 Ga0495591_004581 3300046458 Bacteria 6689
156 Ga0495591_007460 3300046458 Bacteria 4645
157 Ga0495591_012257 3300046458 Bacteria 3201
158 Ga0495591_014035 3300046458 Bacteria 2899
159 Ga0495591_014135 3300046458 Bacteria 2884
160 Ga0495629_0001982 3300046459 Bacteria 15956
161 Ga0495638_0004230 3300046460 Bacteria 10920
162 Ga0495638_0005029 3300046460 Bacteria 9922
163 Ga0495638_0006441 3300046460 Bacteria 8542
164 Ga0495638_0007507 3300046460 Bacteria 7806
165 Ga0495638_0020098 3300046460 Bacteria 4413
166 Ga0495638_0041808 3300046460 Bacteria 2898
167 Ga0495638_0060938 3300046460 Bacteria 2332
168 Ga0495653_0002215 3300046463 Bacteria 15377
169 Ga0495650_0027196 3300046471 Bacteria 2647
170 Ga0495582_0009631 3300046473 Bacteria 5319
171 Ga0495605_0002122 3300046474 Bacteria 12403
172 Ga0495605_0030409 3300046474 Bacteria 2770
173 Ga0495605_0039524 3300046474 Bacteria 2363
174 Ga0495584_0002809 3300046491 Bacteria 9715
175 Ga0495584_0003725 3300046491 Bacteria 8313
176 Ga0495584_0007605 3300046491 Bacteria 5646
177 Ga0495584_0013811 3300046491 Bacteria 4117
178 Ga0495584_0024946 3300046491 Bacteria 3031
179 Ga0495585_0000731 3300046492 Bacteria 29294
180 Ga0495585_0005061 3300046492 Bacteria 8400
181 Ga0495585_0006114 3300046492 Bacteria 7521
182 Ga0495585_0020975 3300046492 Bacteria 3752
183 Ga0495585_0025569 3300046492 Bacteria 3379
184 Ga0495594_0023147 3300046499 Bacteria 3326
185 Ga0495594_0024545 3300046499 Bacteria 3239
186 Ga0495596_0000158 3300046500 Bacteria 47438
187 Ga0495607_0004781 3300046501 Bacteria 9890
188 Ga0495607_0005219 3300046501 Bacteria 9348
189 Ga0495607_0005417 3300046501 Bacteria 9137
190 Ga0495607_0005587 3300046501 Bacteria 8969
191 Ga0495583_0001265 3300046506 Bacteria 26560
192 Ga0495583_0002227 3300046506 Bacteria 17109
193 Ga0495583_0004489 3300046506 Bacteria 9964
194 Ga0495606_0001691 3300046507 Bacteria 28476
195 Ga0495606_0004905 3300046507 Bacteria 13096
196 Ga0495606_0005869 3300046507 Bacteria 11562
197 Ga0495606_0009911 3300046507 Bacteria 7981
198 Ga0495610_0002466 3300046512 Bacteria 15539
199 Ga0495610_0003044 3300046512 Bacteria 13420
200 Ga0495610_0004175 3300046512 Bacteria 10798
201 Ga0495610_0006218 3300046512 Bacteria 8282
202 Ga0495610_0006999 3300046512 Bacteria 7626
203 Ga0495610_0013736 3300046512 Bacteria 4795
204 Ga0495616_0028420 3300046513 Bacteria 2960
205 Ga0495616_0035219 3300046513 Bacteria 2592
206 Ga0495620_0002281 3300046515 Bacteria 11095
207 Ga0495620_0003971 3300046515 Bacteria 8409
208 Ga0495620_0004477 3300046515 Bacteria 7863
209 Ga0495630_0014497 3300046517 Bacteria 5744
210 Ga0495630_0063022 3300046517 Bacteria 2785
211 Ga0495631_0000173 3300046518 Bacteria 43899
212 Ga0495632_0005262 3300046519 Bacteria 8602
213 Ga0495632_0005284 3300046519 Bacteria 8577
214 Ga0495637_0000228 3300046520 Bacteria 43608
215 Ga0495643_0024900 3300046522 Bacteria 3390
216 Ga0495644_0001472 3300046523 Bacteria 9604
217 Ga0495644_0006119 3300046523 Bacteria 4679
218 Ga0495644_0018983 3300046523 Bacteria 2624
219 Ga0495644_0020691 3300046523 Bacteria 2511
220 Ga0495648_0014037 3300046524 Bacteria 5889
221 Ga0495648_0049692 3300046524 Bacteria 2568
222 Ga0495666_0015999 3300046526 Bacteria 3735
223 Ga0495642_0000230 3300046528 Bacteria 31990
224 Ga0495642_0000364 3300046528 Bacteria 24463
225 Ga0495654_0000631 3300046530 Bacteria 27787
226 Ga0495654_0002464 3300046530 Bacteria 11912
227 Ga0495654_0004057 3300046530 Bacteria 8793
228 Ga0495654_0004875 3300046530 Bacteria 7899
229 Ga0495654_0005332 3300046530 Bacteria 7493
230 Ga0495654_0028120 3300046530 Bacteria 2876
231 Ga0495587_0029733 3300046536 Bacteria 3315
232 Ga0495609_0001166 3300046538 Bacteria 18120
233 Ga0495609_0018116 3300046538 Bacteria 3266
234 Ga0495597_0004241 3300046542 Bacteria 7929
235 Ga0495597_0004489 3300046542 Bacteria 7650
236 Ga0495597_0006443 3300046542 Bacteria 6073
237 Ga0495597_0018967 3300046542 Bacteria 3222
238 Ga0495622_0000901 3300046557 Bacteria 16162
239 Ga0495622_0044546 3300046557 Bacteria 2061
240 Ga0495656_0002248 3300046615 Bacteria 6383
241 Ga0495668_0001375 3300046616 Bacteria 23830
242 Ga0495668_0019968 3300046616 Bacteria 3853
243 Ga0495634_0001370 3300046642 Bacteria 22090
244 Ga0495634_0046305 3300046642 Bacteria 2936
245 Ga0495625_0004767 3300046660 Bacteria 12685
246 Ga0495625_0008053 3300046660 Bacteria 9037
247 Ga0495625_0017217 3300046660 Bacteria 5659
248 Ga0495625_0022084 3300046660 Bacteria 4885
249 Ga0495635_0000535 3300046663 Bacteria 24127
250 Ga0495635_0002382 3300046663 Bacteria 12802
251 Ga0495659_0001223 3300046664 Bacteria 8879
252 Ga0495661_0001241 3300046665 Bacteria 21994
253 Ga0495661_0001357 3300046665 Bacteria 20682
254 Ga0495661_0035410 3300046665 Bacteria 3132
255 Ga0495588_0016024 3300046674 Bacteria 3617
256 Ga0495623_0001785 3300046679 Bacteria 14458
257 Ga0495646_0009846 3300046680 Bacteria 6073
258 Ga0495613_0001979 3300046689 Bacteria 15554
259 Ga0495613_0015144 3300046689 Bacteria 5730
260 Ga0495613_0025120 3300046689 Bacteria 4439
261 Ga0495670_0003314 3300046691 Bacteria 7938
262 Ga0495671_0005589 3300046692 Bacteria 7336
263 Ga0495671_0008276 3300046692 Bacteria 5857
264 Ga0495671_0036999 3300046692 Bacteria 2470
265 Ga0495671_0048505 3300046692 Bacteria 2118
266 Ga0495649_0004689 3300046694 Bacteria 8877
267 Ga0495649_0005733 3300046694 Bacteria 7832
268 Ga0495649_0016102 3300046694 Bacteria 4243
269 Ga0495649_0019352 3300046694 Bacteria 3826
270 Ga0495649_0029756 3300046694 Bacteria 3018
271 Ga0495649_0049574 3300046694 Bacteria 2280
272 Ga0495589_0009415 3300046794 Bacteria 5081
273 Ga0495589_0021395 3300046794 Bacteria 3305
274 Ga0495600_0051758 3300046809 Bacteria 2680
275 Ga0495660_0017592 3300046810 Bacteria 4114
276 Ga0495660_0035789 3300046810 Bacteria 2771
277 Ga0495604_0001530 3300047317 Bacteria 19039
278 Ga0495604_0006133 3300047317 Bacteria 9544
279 Ga0495604_0016556 3300047317 Bacteria 5894
280 Ga0495674_0005602 3300047319 Bacteria 12040
281 Ga0495672_0001261 3300047320 Bacteria 25372
282 Ga0495672_0005023 3300047320 Bacteria 10583
283 Ga0495672_0008104 3300047320 Bacteria 7802
284 Ga0495672_0009749 3300047320 Bacteria 6921
285 Ga0495672_0018479 3300047320 Bacteria 4624
286 Ga0495672_0024191 3300047320 Bacteria 3917
287 Ga0495676_0051399 3300047321 Bacteria 3297
288 Ga0495680_0030912 3300047322 Bacteria 4363
289 Ga0495680_0094512 3300047322 Bacteria 2237
290 Ga0495683_0000414 3300047323 Bacteria 34203
291 Ga0495683_0002098 3300047323 Bacteria 12356
292 Ga0495683_0005348 3300047323 Bacteria 7130
293 Ga0495683_0019873 3300047323 Bacteria 3464
294 Ga0495675_0014943 3300047444 Bacteria 4908
295 Ga0495677_0020039 3300047445 Bacteria 2424
296 Ga0495679_001026 3300047446 Bacteria 17130
297 Ga0495679_001361 3300047446 Bacteria 14049
298 Ga0495679_003630 3300047446 Bacteria 7374
299 Ga0495673_0000986 3300047469 Bacteria 25501
300 Ga0495673_0006102 3300047469 Bacteria 7155
301 Ga0495673_0027073 3300047469 Bacteria 2732
302 Ga0495681_0001628 3300047470 Bacteria 16675
303 Ga0495681_0002153 3300047470 Bacteria 14283
304 Ga0495681_0002896 3300047470 Bacteria 12125
305 Ga0495681_0004813 3300047470 Bacteria 9146
306 Ga0495681_0005371 3300047470 Bacteria 8594
307 Ga0495681_0005835 3300047470 Bacteria 8176
308 Ga0495681_0021249 3300047470 Bacteria 3500
309 Ga0495684_0061598 3300047471 Bacteria 2854
310 Ga0495686_0007450 3300047472 Bacteria 8204
311 Ga0495686_0012951 3300047472 Bacteria 5812
312 Ga0495593_0038092 3300047673 Bacteria 2597
313 Ga0495602_0004697 3300048088 Bacteria 14276
314 Ga0495626_0000508 3300048091 Bacteria 38935
315 Ga0495626_0003265 3300048091 Bacteria 10480
316 Ga0496102_0000649 3300048905 Bacteria 35082
317 Ga0496103_0004465 3300048906 Bacteria 8482
318 Ga0496110_0073413 3300048913 Bacteria 3036
319 Ga0496116_0000444 3300048919 Bacteria 57719
320 Ga0496116_0021927 3300048919 Bacteria 4804
321 Ga0496117_0000894 3300048920 Bacteria 45883
322 Ga0496117_0002500 3300048920 Bacteria 23077
323 Ga0496117_0008445 3300048920 Bacteria 9776
324 Ga0496117_0009319 3300048920 Bacteria 9156
325 Ga0496117_0011256 3300048920 Bacteria 8030
326 Ga0496118_0009283 3300048921 Bacteria 9976
327 Ga0496118_0010801 3300048921 Bacteria 8995
328 Ga0496118_0012129 3300048921 Bacteria 8317
329 Ga0496118_0052418 3300048921 Bacteria 3112
330 Ga0496119_0005794 3300048922 Bacteria 11687
331 Ga0496119_0034184 3300048922 Bacteria 3354
332 Ga0496120_0002853 3300048923 Bacteria 16636
333 Ga0496120_0010377 3300048923 Bacteria 6503
334 Ga0496121_0000815 3300048924 Bacteria 56865
335 Ga0496121_0010661 3300048924 Bacteria 10317
336 Ga0496121_0011100 3300048924 Bacteria 10053
337 Ga0496121_0092395 3300048924 Bacteria 2359
338 Ga0496122_0009089 3300048925 Bacteria 10536
339 Ga0496122_0031226 3300048925 Bacteria 4439
340 Ga0496122_0032596 3300048925 Bacteria 4304
341 Ga0496122_0036485 3300048925 Bacteria 3973
342 Ga0496123_0001415 3300048926 Bacteria 33525
343 Ga0496123_0004831 3300048926 Bacteria 13892
344 Ga0496123_0009968 3300048926 Bacteria 8469
345 Ga0496124_0005617 3300048927 Bacteria 14030
346 Ga0496124_0007310 3300048927 Bacteria 11778
347 Ga0496124_0008749 3300048927 Bacteria 10516
348 Ga0496124_0012669 3300048927 Bacteria 8294
349 Ga0496124_0046606 3300048927 Bacteria 3711
350 Ga0496124_0058499 3300048927 Bacteria 3241
351 Ga0496125_0003033 3300048928 Bacteria 21006
352 Ga0496125_0003310 3300048928 Bacteria 19722
353 Ga0496125_0005680 3300048928 Bacteria 13755
354 Ga0496125_0007943 3300048928 Bacteria 11203
355 Ga0496125_0011526 3300048928 Bacteria 8832
356 Ga0496125_0015520 3300048928 Bacteria 7362
357 Ga0496125_0029332 3300048928 Bacteria 4946
358 Ga0496125_0044673 3300048928 Bacteria 3741
359 Ga0496125_0045970 3300048928 Bacteria 3668
360 Ga0496126_0008825 3300048929 Bacteria 10809
361 Ga0496126_0083338 3300048929 Bacteria 2822
362 Ga0495678_003785 3300049459 Bacteria 9129
363 Ga0495678_004084 3300049459 Bacteria 8656
364 Ga0495678_005755 3300049459 Bacteria 6735
365 Ga0495682_0010891 3300049460 Bacteria 3504
366 Ga0495682_0030709 3300049460 Bacteria 1987
367 Ga0501226_000006 3300049853 Bacteria 259153
368 Ga0500634_0000596 3300053161 Bacteria 12051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042137 Ga0450902_002512 Ga0450902_002512_936_2588 548
2 3300046692 Ga0495671_0036999 Ga0495671_0036999_794_2446 548
3 iso_pu_bacteria 2651869719 2652546164 566
4 3300046557 Ga0495622_0044546 Ga0495622_0044546_21_1766 579
5 3300046453 Ga0495627_015758 Ga0495627_015758_15_1817 598
6 3300041405 Ga0439438_008800 Ga0439438_008800_337_2223 614
7 3300025735 Ga0207713_1006902 Ga0207713_10069024 621
8 3300042016 Ga0439463_001031 Ga0439463_001031_4771_6765 632
9 iso_pu_bacteria 2860867994 2860871525 633
10 3300046694 Ga0495649_0029756 Ga0495649_0029756_1091_3007 636
11 3300049460 Ga0495682_0030709 Ga0495682_0030709_23_1942 637
12 3300046460 Ga0495638_0006441 Ga0495638_0006441_5283_7253 641
13 3300046501 Ga0495607_0005219 Ga0495607_0005219_1889_3859 641
14 3300046542 Ga0495597_0018967 Ga0495597_0018967_370_2340 641
15 3300047472 Ga0495686_0007450 Ga0495686_0007450_953_2923 641
16 3300049459 Ga0495678_003785 Ga0495678_003785_1889_3859 641
17 3300009011 Ga0105251_10002069 Ga0105251_1000206911 642
18 3300046458 Ga0495591_014035 Ga0495591_014035_253_2223 642
19 3300046460 Ga0495638_0004230 Ga0495638_0004230_6865_8835 642
20 3300046491 Ga0495584_0013811 Ga0495584_0013811_1661_3631 642
21 3300046523 Ga0495644_0001472 Ga0495644_0001472_5999_7969 642
22 3300046542 Ga0495597_0006443 Ga0495597_0006443_3295_5265 642
23 3300046692 Ga0495671_0008276 Ga0495671_0008276_2971_4941 642
24 3300046692 Ga0495671_0048505 Ga0495671_0048505_79_2049 642
25 3300046694 Ga0495649_0005733 Ga0495649_0005733_480_2450 642
26 3300046694 Ga0495649_0016102 Ga0495649_0016102_300_2270 642
27 3300047320 Ga0495672_0001261 Ga0495672_0001261_6820_8790 642
28 3300047320 Ga0495672_0009749 Ga0495672_0009749_1776_3746 642
29 3300047323 Ga0495683_0002098 Ga0495683_0002098_1314_3284 642
30 3300047445 Ga0495677_0020039 Ga0495677_0020039_249_2219 642
31 3300047469 Ga0495673_0006102 Ga0495673_0006102_4488_6458 642
32 3300047470 Ga0495681_0021249 Ga0495681_0021249_1501_3471 642
33 3300048913 Ga0496110_0073413 Ga0496110_0073413_616_2586 642
34 3300048927 Ga0496124_0008749 Ga0496124_0008749_6937_8907 642
35 iso_pu_bacteria 2808606373 2808907455 644
36 3300049853 Ga0501226_000006 Ga0501226_000006_90951_92942 645
37 3300017792 Ga0163161_10004905 Ga0163161_100049053 646
38 3300006058 Ga0075432_10000033 Ga0075432_1000003315 647
39 3300046453 Ga0495627_001950 Ga0495627_001950_3393_5375 647
40 3300046458 Ga0495591_004581 Ga0495591_004581_2827_4809 647
41 3300046492 Ga0495585_0006114 Ga0495585_0006114_5209_7191 647
42 3300046794 Ga0495589_0009415 Ga0495589_0009415_81_2063 647
43 3300047320 Ga0495672_0005023 Ga0495672_0005023_4032_6014 647
44 3300047470 Ga0495681_0002153 Ga0495681_0002153_6424_8406 647
45 3300046460 Ga0495638_0005029 Ga0495638_0005029_5815_7797 649
46 iso_pu_bacteria 2599185167 2599400139 650
47 iso_pu_bacteria 2599185179 2599451531 650
48 iso_pu_bacteria 2599185190 2599512703 650
49 iso_pu_bacteria 2599185191 2599520054 650
50 iso_pu_bacteria 2599185290 2599891379 650
51 iso_pu_bacteria 2675903420 2677899798 650
52 iso_pu_bacteria 2931390751 2931394871 650
53 3300041411 Ga0439466_0000555 Ga0439466_0000555_3035_5029 653
54 3300042993 Ga0439440_0003974 Ga0439440_0003974_645_2639 653
55 3300046458 Ga0495591_012257 Ga0495591_012257_73_2040 653
56 3300046460 Ga0495638_0020098 Ga0495638_0020098_463_2430 653
57 3300046501 Ga0495607_0004781 Ga0495607_0004781_2611_4578 653
58 3300046507 Ga0495606_0001691 Ga0495606_0001691_17062_19029 653
59 3300046512 Ga0495610_0013736 Ga0495610_0013736_2459_4426 653
60 3300046513 Ga0495616_0035219 Ga0495616_0035219_561_2528 653
61 3300046523 Ga0495644_0018983 Ga0495644_0018983_440_2407 653
62 3300046530 Ga0495654_0028120 Ga0495654_0028120_837_2804 653
63 3300046660 Ga0495625_0004767 Ga0495625_0004767_5126_7093 653
64 3300046660 Ga0495625_0017217 Ga0495625_0017217_2457_4439 653
65 3300046665 Ga0495661_0035410 Ga0495661_0035410_73_2040 653
66 3300047446 Ga0495679_003630 Ga0495679_003630_4954_6921 653
67 3300048091 Ga0495626_0000508 Ga0495626_0000508_18919_20886 653
68 iso_pu_bacteria 2511231008 2511277802 653
69 iso_pu_bacteria 2511231018 2511341615 653
70 iso_pu_bacteria 2511231019 2511345029 653
71 iso_pu_bacteria 2511231020 2511349739 653
72 iso_pu_bacteria 2511231156 2511823605 653
73 iso_pu_bacteria 2597489888 2597865011 653
74 iso_pu_bacteria 2597489889 2597870866 653
75 iso_pu_bacteria 2599185189 2599509348 653
76 iso_pu_bacteria 2599185212 2599611709 653
77 iso_pu_bacteria 2599185248 2599770195 653
78 iso_pu_bacteria 2599185288 2599878354 653
79 iso_pu_bacteria 2599185289 2599887606 653
80 iso_pu_bacteria 2599185291 2599899915 653
81 iso_pu_bacteria 2599185303 2599947554 653
82 iso_pu_bacteria 2599185305 2599960492 653
83 iso_pu_bacteria 2599185306 2599964797 653
84 iso_pu_bacteria 2599185308 2599976090 653
85 iso_pu_bacteria 2599185311 2599995654 653
86 iso_pu_bacteria 2599185313 2600005321 653
87 iso_pu_bacteria 2599185314 2600010029 653
88 iso_pu_bacteria 2599185315 2600017468 653
89 iso_pu_bacteria 2599185316 2600022683 653
90 iso_pu_bacteria 2599185317 2600027721 653
91 iso_pu_bacteria 2599185318 2600034487 653
92 iso_pu_bacteria 2599185319 2600041672 653
93 iso_pu_bacteria 2599185321 2600052291 653
94 iso_pu_bacteria 2599185322 2600057657 653
95 iso_pu_bacteria 2599185323 2600065136 653
96 iso_pu_bacteria 2599185324 2600072398 653
97 iso_pu_bacteria 2599185325 2600075958 653
98 iso_pu_bacteria 2600254930 2600356570 653
99 iso_pu_bacteria 2600255296 2601689729 653
100 iso_pu_bacteria 2619619299 2621298431 653
101 iso_pu_bacteria 2643221571 2643874396 653
102 iso_pu_bacteria 2643221589 2643956577 653
103 iso_pu_bacteria 2643221602 2644025380 653
104 iso_pu_bacteria 2643221650 2644281711 653
105 iso_pu_bacteria 2643221713 2644621769 653
106 iso_pu_bacteria 2667528170 2671090267 653
107 iso_pu_bacteria 2667528176 2671125927 653
108 iso_pu_bacteria 2675903515 2678262526 653
109 iso_pu_bacteria 2721755607 2723249759 653
110 iso_pu_bacteria 2738541265 2738671186 653
111 iso_pu_bacteria 2738541282 2738749580 653
112 iso_pu_bacteria 2738541294 2738808564 653
113 iso_pu_bacteria 2738541303 2738858620 653
114 iso_pu_bacteria 2738541309 2738895924 653
115 iso_pu_bacteria 2744054620 2745008868 653
116 iso_pu_bacteria 2791355520 2794596333 653
117 iso_pu_bacteria 2808606377 2808930686 653
118 iso_pu_bacteria 2808606381 2808952808 653
119 iso_pu_bacteria 2808606382 2808957253 653
120 iso_pu_bacteria 2808606385 2808977340 653
121 iso_pu_bacteria 2808606388 2808992495 653
122 iso_pu_bacteria 2808606445 2809218847 653
123 iso_pu_bacteria 2816332298 2817492420 653
124 iso_pu_bacteria 2825651385 2825653117 653
125 iso_pu_bacteria 2834028612 2834034535 653
126 iso_pu_bacteria 2842826826 2842829481 653
127 iso_pu_bacteria 2842837860 2842840938 653
128 iso_pu_bacteria 2852612431 2852613275 653
129 iso_pu_bacteria 2852667396 2852668989 653
130 iso_pu_bacteria 2860339153 2860340905 653
131 iso_pu_bacteria 2908446538 2908450920 653
132 iso_pu_bacteria 2919456309 2919460993 653
133 iso_pu_bacteria 2929144301 2929145957 653
134 iso_pu_bacteria 2929189879 2929193527 653
135 iso_pu_bacteria 2931396565 2931396648 653
136 iso_pu_bacteria 2939636861 2939637544 653
137 iso_pu_bacteria 2945928738 2945932432 653
138 iso_pu_bacteria 2945961074 2945962345 653
139 iso_pu_bacteria 2946006987 2946008635 653
140 iso_pu_bacteria 2946027586 2946031989 653
141 iso_pu_bacteria 2947233263 2947238837 653
142 iso_pu_bacteria 8054347763 8054350859 653
143 iso_pu_bacteria 8055817908 8055822322 653
144 iso_pu_bacteria 8056125926 8056127494 653
145 iso_pu_bacteria 8056148874 8056153081 653
146 iso_pu_bacteria 8056161164 8056161987 653
147 3300005353 Ga0070669_100001277 Ga0070669_1000012773 654
148 3300005457 Ga0070662_100000565 Ga0070662_10000056518 654
149 3300005539 Ga0068853_100046063 Ga0068853_1000460632 654
150 3300005564 Ga0070664_100050747 Ga0070664_1000507472 654
151 3300005834 Ga0068851_10000040 Ga0068851_1000004052 654
152 3300009011 Ga0105251_10001487 Ga0105251_100014875 654
153 3300013100 Ga0157373_10011340 Ga0157373_100113402 654
154 3300013105 Ga0157369_10015934 Ga0157369_100159343 654
155 3300013308 Ga0157375_10004911 Ga0157375_100049114 654
156 3300014497 Ga0182008_10001805 Ga0182008_100018055 654
157 3300017792 Ga0163161_10007668 Ga0163161_100076682 654
158 3300025321 Ga0207656_10000047 Ga0207656_1000004733 654
159 3300025735 Ga0207713_1001287 Ga0207713_100128710 654
160 3300025923 Ga0207681_10001026 Ga0207681_100010263 654
161 3300025933 Ga0207706_10000460 Ga0207706_1000046022 654
162 3300026041 Ga0207639_10055138 Ga0207639_100551382 654
163 3300028786 Ga0307517_10074548 Ga0307517_100745483 654
164 3300031507 Ga0307509_10046554 Ga0307509_100465542 654
165 3300047446 Ga0495679_001026 Ga0495679_001026_2175_4145 654
166 3300048920 Ga0496117_0011256 Ga0496117_0011256_5762_7744 654
167 3300048922 Ga0496119_0005794 Ga0496119_0005794_9081_11063 654
168 3300048923 Ga0496120_0002853 Ga0496120_0002853_9043_11025 654
169 3300048924 Ga0496121_0010661 Ga0496121_0010661_7644_9626 654
170 3300048925 Ga0496122_0009089 Ga0496122_0009089_7980_9959 654
171 3300048925 Ga0496122_0031226 Ga0496122_0031226_227_2209 654
172 3300048926 Ga0496123_0004831 Ga0496123_0004831_622_2601 654
173 3300048926 Ga0496123_0009968 Ga0496123_0009968_6306_8288 654
174 3300048928 Ga0496125_0003033 Ga0496125_0003033_12675_14654 654
175 3300048928 Ga0496125_0003310 Ga0496125_0003310_12655_14637 654
176 iso_pu_bacteria 2511231006 2511268807 654
177 iso_pu_bacteria 2511231021 2511357320 654
178 iso_pu_bacteria 2554235341 2555671348 654
179 iso_pu_bacteria 2582580891 2583793756 654
180 iso_pu_bacteria 2597489887 2597859431 654
181 iso_pu_bacteria 2599185160 2599354496 654
182 iso_pu_bacteria 2599185161 2599359790 654
183 iso_pu_bacteria 2599185162 2599366112 654
184 iso_pu_bacteria 2599185163 2599372902 654
185 iso_pu_bacteria 2599185164 2599379604 654
186 iso_pu_bacteria 2599185165 2599385418 654
187 iso_pu_bacteria 2599185166 2599391761 654
188 iso_pu_bacteria 2599185168 2599403527 654
189 iso_pu_bacteria 2599185181 2599461330 654
190 iso_pu_bacteria 2599185182 2599469874 654
191 iso_pu_bacteria 2599185186 2599490350 654
192 iso_pu_bacteria 2599185257 2599804020 654
193 iso_pu_bacteria 2599185356 2600213946 654
194 iso_pu_bacteria 2600254931 2600364337 654
195 iso_pu_bacteria 2600255313 2601774112 654
196 iso_pu_bacteria 2667528171 2671097077 654
197 iso_pu_bacteria 2671180172 2671770412 654
198 iso_pu_bacteria 2773857670 2774123459 654
199 iso_pu_bacteria 2784132072 2784315998 654
200 iso_pu_bacteria 2818991464 2819702171 654
201 iso_pu_bacteria 2844665904 2844671870 654
202 iso_pu_bacteria 2917070673 2917075213 654
203 iso_pu_bacteria 2923153595 2923158039 654
204 iso_pu_bacteria 2935353572 2935356201 654
205 iso_pu_bacteria 2984286254 2984288138 654
206 iso_pu_bacteria 3007395558 3007397348 654
207 iso_pu_bacteria 637000220 637321669 654
208 iso_pu_bacteria 8015687852 8015692136 654
209 iso_pu_bacteria 8019769354 8019773080 654
210 iso_pu_bacteria 8054503363 8054507380 654
211 iso_pu_bacteria 8055770955 8055775346 654
212 iso_pu_bacteria 8056131705 8056135784 654
213 iso_pu_bacteria 8057798959 8057804165 654
214 3300002771 JGI25163J39215_1000455 JGI25163J39215_10004555 657
215 3300002772 JGI25164J39214_1000272 JGI25164J39214_100027219 657
216 3300003214 JGI25165J46597_1000496 JGI25165J46597_100049619 657
217 3300003751 Ga0055538_1000079 Ga0055538_100007966 657
218 3300003752 Ga0055539_1000120 Ga0055539_100012066 657
219 3300003756 Ga0055533_1000128 Ga0055533_100012866 657
220 3300003758 Ga0055532_1000116 Ga0055532_100011666 657
221 3300003759 Ga0055525_1000165 Ga0055525_100016566 657
222 3300003841 Ga0055541_1000080 Ga0055541_100008066 657
223 3300005288 Ga0065714_10002255 Ga0065714_1000225512 657
224 3300005288 Ga0065714_10002472 Ga0065714_100024728 657
225 3300005288 Ga0065714_10003339 Ga0065714_100033392 657
226 3300005288 Ga0065714_10065296 Ga0065714_100652965 657
227 3300005289 Ga0065704_10076822 Ga0065704_100768221 657
228 3300005331 Ga0070670_100002613 Ga0070670_1000026133 657
229 3300005344 Ga0070661_100006754 Ga0070661_1000067543 657
230 3300005564 Ga0070664_100009176 Ga0070664_1000091763 657
231 3300006946 Ga0079104_1000545 Ga0079104_100054536 657
232 3300009011 Ga0105251_10034214 Ga0105251_100342142 657
233 3300009036 Ga0105244_10005906 Ga0105244_100059063 657
234 3300009036 Ga0105244_10006198 Ga0105244_100061982 657
235 3300009092 Ga0105250_10000381 Ga0105250_100003817 657
236 3300009148 Ga0105243_10106130 Ga0105243_101061301 657
237 3300009176 Ga0105242_10000321 Ga0105242_1000032116 657
238 3300009545 Ga0105237_10015275 Ga0105237_100152752 657
239 3300011119 Ga0105246_10000513 Ga0105246_100005132 657
240 3300013100 Ga0157373_10001051 Ga0157373_100010516 657
241 3300013100 Ga0157373_10001800 Ga0157373_100018006 657
242 3300013102 Ga0157371_10001305 Ga0157371_1000130515 657
243 3300013104 Ga0157370_10008724 Ga0157370_100087243 657
244 3300013105 Ga0157369_10008322 Ga0157369_100083225 657
245 3300013105 Ga0157369_10009567 Ga0157369_100095675 657
246 3300013306 Ga0163162_10010694 Ga0163162_100106941 657
247 3300013306 Ga0163162_10026121 Ga0163162_100261211 657
248 3300013308 Ga0157375_10008675 Ga0157375_100086755 657
249 3300015262 Ga0182007_10000945 Ga0182007_100009453 657
250 3300017792 Ga0163161_10002323 Ga0163161_100023236 657
251 3300017792 Ga0163161_10004427 Ga0163161_100044273 657
252 3300017792 Ga0163161_10005710 Ga0163161_100057102 657
253 3300025207 Ga0209760_100011 Ga0209760_10001160 657
254 3300025224 Ga0209784_100017 Ga0209784_10001780 657
255 3300025225 Ga0209566_100014 Ga0209566_10001480 657
256 3300025226 Ga0209674_100028 Ga0209674_10002880 657
257 3300025229 Ga0209147_100105 Ga0209147_10010580 657
258 3300025230 Ga0209563_100032 Ga0209563_10003280 657
259 3300025231 Ga0207427_100008 Ga0207427_100008241 657
260 3300025233 Ga0209437_100014 Ga0209437_100014470 657
261 3300025233 Ga0209437_101834 Ga0209437_1018342 657
262 3300025242 Ga0209258_100194 Ga0209258_10019445 657
263 3300025246 Ga0209646_1000416 Ga0209646_100041620 657
264 3300025253 Ga0209677_100018 Ga0209677_10001880 657
265 3300025261 Ga0209233_1000008 Ga0209233_1000008470 657
266 3300025292 Ga0209676_1001648 Ga0209676_10016482 657
267 3300025298 Ga0209050_1001348 Ga0209050_100134819 657
268 3300025711 Ga0207696_1000043 Ga0207696_100004312 657
269 3300025728 Ga0207655_1000407 Ga0207655_100040756 657
270 3300025728 Ga0207655_1016478 Ga0207655_10164782 657
271 3300025735 Ga0207713_1000358 Ga0207713_100035832 657
272 3300025735 Ga0207713_1015476 Ga0207713_10154762 657
273 3300025914 Ga0207671_10001896 Ga0207671_1000189621 657
274 3300025920 Ga0207649_10000237 Ga0207649_1000023740 657
275 3300025925 Ga0207650_10000425 Ga0207650_1000042521 657
276 3300025945 Ga0207679_10000005 Ga0207679_100000053 657
277 3300027111 Ga0209281_1000018 Ga0209281_1000018419 657
278 3300031548 Ga0307408_100052302 Ga0307408_1000523022 657
279 3300031731 Ga0307405_10000217 Ga0307405_100002176 657
280 3300032005 Ga0307411_10001653 Ga0307411_100016532 657
281 3300041405 Ga0439438_001223 Ga0439438_001223_1160_3139 657
282 3300041407 Ga0439447_000266 Ga0439447_000266_460_2439 657
283 3300041411 Ga0439466_0026309 Ga0439466_0026309_16_1998 657
284 3300041997 Ga0439431_0002017 Ga0439431_0002017_2026_4008 657
285 3300042006 Ga0439432_011569 Ga0439432_011569_979_2961 657
286 3300042010 Ga0439452_002435 Ga0439452_002435_4514_6493 657
287 3300042115 Ga0450911_002796 Ga0450911_002796_804_2804 657
288 3300042115 Ga0450911_003838 Ga0450911_003838_188_2167 657
289 3300042124 Ga0450922_000170 Ga0450922_000170_439_2418 657
290 3300042125 Ga0450923_002755 Ga0450923_002755_115_2094 657
291 3300042137 Ga0450902_002484 Ga0450902_002484_141_2120 657
292 3300042138 Ga0450903_003696 Ga0450903_003696_612_2591 657
293 3300042142 Ga0450905_001662 Ga0450905_001662_571_2550 657
294 3300042146 Ga0450907_002654 Ga0450907_002654_1244_3223 657
295 3300046452 Ga0495617_007681 Ga0495617_007681_1224_3203 657
296 3300046452 Ga0495617_017431 Ga0495617_017431_325_2304 657
297 3300046453 Ga0495627_001093 Ga0495627_001093_12607_14586 657
298 3300046455 Ga0495603_0007044 Ga0495603_0007044_848_2827 657
299 3300046455 Ga0495603_0039485 Ga0495603_0039485_54_2033 657
300 3300046458 Ga0495591_001050 Ga0495591_001050_13482_15461 657
301 3300046458 Ga0495591_007460 Ga0495591_007460_203_2182 657
302 3300046458 Ga0495591_014135 Ga0495591_014135_524_2503 657
303 3300046463 Ga0495653_0002215 Ga0495653_0002215_7562_9541 657
304 3300046474 Ga0495605_0002122 Ga0495605_0002122_5674_7653 657
305 3300046474 Ga0495605_0030409 Ga0495605_0030409_307_2286 657
306 3300046491 Ga0495584_0002809 Ga0495584_0002809_6924_8903 657
307 3300046492 Ga0495585_0005061 Ga0495585_0005061_410_2389 657
308 3300046499 Ga0495594_0024545 Ga0495594_0024545_65_2044 657
309 3300046501 Ga0495607_0005587 Ga0495607_0005587_1742_3721 657
310 3300046506 Ga0495583_0004489 Ga0495583_0004489_6346_8325 657
311 3300046507 Ga0495606_0004905 Ga0495606_0004905_5342_7330 657
312 3300046507 Ga0495606_0005869 Ga0495606_0005869_5630_7630 657
313 3300046507 Ga0495606_0009911 Ga0495606_0009911_5416_7404 657
314 3300046512 Ga0495610_0002466 Ga0495610_0002466_5954_7951 657
315 3300046512 Ga0495610_0003044 Ga0495610_0003044_5741_7720 657
316 3300046512 Ga0495610_0006218 Ga0495610_0006218_6077_8056 657
317 3300046512 Ga0495610_0006999 Ga0495610_0006999_5500_7488 657
318 3300046515 Ga0495620_0002281 Ga0495620_0002281_1059_3038 657
319 3300046515 Ga0495620_0004477 Ga0495620_0004477_4185_6164 657
320 3300046517 Ga0495630_0063022 Ga0495630_0063022_175_2154 657
321 3300046518 Ga0495631_0000173 Ga0495631_0000173_21181_23160 657
322 3300046519 Ga0495632_0005262 Ga0495632_0005262_564_2543 657
323 3300046523 Ga0495644_0020691 Ga0495644_0020691_12_1991 657
324 3300046526 Ga0495666_0015999 Ga0495666_0015999_1180_3159 657
325 3300046528 Ga0495642_0000230 Ga0495642_0000230_15533_17512 657
326 3300046530 Ga0495654_0002464 Ga0495654_0002464_5405_7393 657
327 3300046530 Ga0495654_0004057 Ga0495654_0004057_697_2694 657
328 3300046530 Ga0495654_0004875 Ga0495654_0004875_5694_7673 657
329 3300046530 Ga0495654_0005332 Ga0495654_0005332_5299_7278 657
330 3300046538 Ga0495609_0018116 Ga0495609_0018116_934_2913 657
331 3300046542 Ga0495597_0004241 Ga0495597_0004241_510_2489 657
332 3300046542 Ga0495597_0004489 Ga0495597_0004489_3533_5512 657
333 3300046616 Ga0495668_0019968 Ga0495668_0019968_1214_3193 657
334 3300046642 Ga0495634_0001370 Ga0495634_0001370_12782_14761 657
335 3300046642 Ga0495634_0046305 Ga0495634_0046305_305_2284 657
336 3300046660 Ga0495625_0022084 Ga0495625_0022084_1835_3814 657
337 3300046663 Ga0495635_0000535 Ga0495635_0000535_5001_6980 657
338 3300046665 Ga0495661_0001241 Ga0495661_0001241_6236_8215 657
339 3300046665 Ga0495661_0001357 Ga0495661_0001357_12457_14436 657
340 3300046674 Ga0495588_0016024 Ga0495588_0016024_1058_3037 657
341 3300046679 Ga0495623_0001785 Ga0495623_0001785_5631_7610 657
342 3300046680 Ga0495646_0009846 Ga0495646_0009846_3705_5684 657
343 3300046689 Ga0495613_0015144 Ga0495613_0015144_3484_5463 657
344 3300046689 Ga0495613_0025120 Ga0495613_0025120_889_2868 657
345 3300046694 Ga0495649_0004689 Ga0495649_0004689_6228_8216 657
346 3300046694 Ga0495649_0049574 Ga0495649_0049574_227_2206 657
347 3300046794 Ga0495589_0021395 Ga0495589_0021395_926_2956 657
348 3300046809 Ga0495600_0051758 Ga0495600_0051758_687_2666 657
349 3300047317 Ga0495604_0006133 Ga0495604_0006133_1781_3760 657
350 3300047317 Ga0495604_0016556 Ga0495604_0016556_400_2379 657
351 3300047319 Ga0495674_0005602 Ga0495674_0005602_5393_7372 657
352 3300047320 Ga0495672_0008104 Ga0495672_0008104_5290_7278 657
353 3300047320 Ga0495672_0018479 Ga0495672_0018479_240_2219 657
354 3300047321 Ga0495676_0051399 Ga0495676_0051399_794_2773 657
355 3300047323 Ga0495683_0000414 Ga0495683_0000414_20646_22625 657
356 3300047444 Ga0495675_0014943 Ga0495675_0014943_591_2570 657
357 3300047446 Ga0495679_001361 Ga0495679_001361_5984_7963 657
358 3300047469 Ga0495673_0000986 Ga0495673_0000986_21749_23728 657
359 3300047469 Ga0495673_0027073 Ga0495673_0027073_235_2214 657
360 3300047470 Ga0495681_0001628 Ga0495681_0001628_12843_14822 657
361 3300047470 Ga0495681_0004813 Ga0495681_0004813_5204_7183 657
362 3300047470 Ga0495681_0005371 Ga0495681_0005371_890_2869 657
363 3300047470 Ga0495681_0005835 Ga0495681_0005835_5601_7580 657
364 3300047471 Ga0495684_0061598 Ga0495684_0061598_233_2212 657
365 3300047673 Ga0495593_0038092 Ga0495593_0038092_294_2273 657
366 3300048088 Ga0495602_0004697 Ga0495602_0004697_7823_9802 657
367 3300048091 Ga0495626_0003265 Ga0495626_0003265_2641_4620 657
368 3300048905 Ga0496102_0000649 Ga0496102_0000649_15849_17828 657
369 3300048906 Ga0496103_0004465 Ga0496103_0004465_1342_3321 657
370 3300048919 Ga0496116_0021927 Ga0496116_0021927_1863_3842 657
371 3300048920 Ga0496117_0002500 Ga0496117_0002500_3321_5351 657
372 3300048920 Ga0496117_0008445 Ga0496117_0008445_940_2940 657
373 3300048920 Ga0496117_0009319 Ga0496117_0009319_1346_3340 657
374 3300048921 Ga0496118_0009283 Ga0496118_0009283_7847_9841 657
375 3300048921 Ga0496118_0010801 Ga0496118_0010801_6391_8385 657
376 3300048921 Ga0496118_0012129 Ga0496118_0012129_961_2961 657
377 3300048921 Ga0496118_0052418 Ga0496118_0052418_297_2276 657
378 3300048922 Ga0496119_0034184 Ga0496119_0034184_947_2977 657
379 3300048923 Ga0496120_0010377 Ga0496120_0010377_4277_6307 657
380 3300048924 Ga0496121_0011100 Ga0496121_0011100_6500_8494 657
381 3300048924 Ga0496121_0092395 Ga0496121_0092395_222_2201 657
382 3300048925 Ga0496122_0032596 Ga0496122_0032596_1185_3179 657
383 3300048927 Ga0496124_0005617 Ga0496124_0005617_3085_5115 657
384 3300048927 Ga0496124_0007310 Ga0496124_0007310_7436_9430 657
385 3300048927 Ga0496124_0012669 Ga0496124_0012669_6162_8150 657
386 3300048927 Ga0496124_0046606 Ga0496124_0046606_675_2654 657
387 3300048927 Ga0496124_0058499 Ga0496124_0058499_895_2874 657
388 3300048928 Ga0496125_0005680 Ga0496125_0005680_3146_5134 657
389 3300048928 Ga0496125_0007943 Ga0496125_0007943_1680_3683 657
390 3300048928 Ga0496125_0011526 Ga0496125_0011526_1891_3885 657
391 3300048928 Ga0496125_0015520 Ga0496125_0015520_5101_7080 657
392 3300048928 Ga0496125_0029332 Ga0496125_0029332_1954_3948 657
393 3300048928 Ga0496125_0044673 Ga0496125_0044673_134_2128 657
394 3300048929 Ga0496126_0008825 Ga0496126_0008825_5950_7944 657
395 3300048929 Ga0496126_0083338 Ga0496126_0083338_417_2447 657
396 3300053161 Ga0500634_0000596 Ga0500634_0000596_9404_11383 657
397 3300002737 JGI25162J39368_1000358 JGI25162J39368_100035818 658
398 3300002771 JGI25163J39215_1000147 JGI25163J39215_10001478 658
399 3300002772 JGI25164J39214_1000266 JGI25164J39214_100026618 658
400 3300003214 JGI25165J46597_1000479 JGI25165J46597_100047918 658
401 3300003791 Ga0055530_10000367 Ga0055530_1000036739 658
402 3300005331 Ga0070670_100000045 Ga0070670_10000004510 658
403 3300006058 Ga0075432_10009359 Ga0075432_100093592 658
404 3300011119 Ga0105246_10013707 Ga0105246_100137072 658
405 3300013102 Ga0157371_10000402 Ga0157371_1000040236 658
406 3300014497 Ga0182008_10000149 Ga0182008_1000014919 658
407 3300015261 Ga0182006_1000561 Ga0182006_10005615 658
408 3300015265 Ga0182005_1001919 Ga0182005_10019193 658
409 3300025207 Ga0209760_100064 Ga0209760_10006469 658
410 3300025231 Ga0207427_100082 Ga0207427_10008264 658
411 3300025233 Ga0209437_100006 Ga0209437_100006196 658
412 3300025261 Ga0209233_1000105 Ga0209233_1000105177 658
413 3300025292 Ga0209676_1000006 Ga0209676_1000006175 658
414 3300025298 Ga0209050_1000260 Ga0209050_100026046 658
415 3300025303 Ga0209051_1000163 Ga0209051_100016376 658
416 3300025728 Ga0207655_1029852 Ga0207655_10298521 658
417 3300025925 Ga0207650_10000135 Ga0207650_1000013510 658
418 3300041405 Ga0439438_001736 Ga0439438_001736_1474_3456 658
419 3300041405 Ga0439438_008988 Ga0439438_008988_455_2437 658
420 3300041407 Ga0439447_000565 Ga0439447_000565_6524_8506 658
421 3300041407 Ga0439447_002981 Ga0439447_002981_29_2011 658
422 3300041411 Ga0439466_0013870 Ga0439466_0013870_500_2482 658
423 3300042006 Ga0439432_000002 Ga0439432_000002_21835_23823 658
424 3300042009 Ga0439451_001231 Ga0439451_001231_2511_4493 658
425 3300042010 Ga0439452_000213 Ga0439452_000213_20825_22807 658
426 3300042010 Ga0439452_000260 Ga0439452_000260_26447_28429 658
427 3300042010 Ga0439452_004565 Ga0439452_004565_2234_4219 658
428 3300042435 Ga0439434_0000779 Ga0439434_0000779_795_2777 658
429 3300042461 Ga0439460_0002278 Ga0439460_0002278_2162_4144 658
430 3300046452 Ga0495617_001605 Ga0495617_001605_5784_7766 658
431 3300046452 Ga0495617_008169 Ga0495617_008169_595_2577 658
432 3300046457 Ga0495590_0005518 Ga0495590_0005518_1737_3719 658
433 3300046458 Ga0495591_000311 Ga0495591_000311_15874_17856 658
434 3300046458 Ga0495591_001730 Ga0495591_001730_1552_3534 658
435 3300046459 Ga0495629_0001982 Ga0495629_0001982_8674_10656 658
436 3300046460 Ga0495638_0007507 Ga0495638_0007507_5242_7224 658
437 3300046460 Ga0495638_0041808 Ga0495638_0041808_332_2314 658
438 3300046460 Ga0495638_0060938 Ga0495638_0060938_77_2059 658
439 3300046471 Ga0495650_0027196 Ga0495650_0027196_229_2211 658
440 3300046473 Ga0495582_0009631 Ga0495582_0009631_141_2123 658
441 3300046474 Ga0495605_0039524 Ga0495605_0039524_201_2183 658
442 3300046491 Ga0495584_0003725 Ga0495584_0003725_5195_7177 658
443 3300046491 Ga0495584_0007605 Ga0495584_0007605_136_2118 658
444 3300046491 Ga0495584_0024946 Ga0495584_0024946_117_2099 658
445 3300046492 Ga0495585_0000731 Ga0495585_0000731_21127_23109 658
446 3300046492 Ga0495585_0020975 Ga0495585_0020975_1190_3172 658
447 3300046492 Ga0495585_0025569 Ga0495585_0025569_846_2828 658
448 3300046499 Ga0495594_0023147 Ga0495594_0023147_191_2173 658
449 3300046500 Ga0495596_0000158 Ga0495596_0000158_29532_31514 658
450 3300046501 Ga0495607_0005417 Ga0495607_0005417_5198_7180 658
451 3300046506 Ga0495583_0001265 Ga0495583_0001265_10951_12933 658
452 3300046506 Ga0495583_0002227 Ga0495583_0002227_1826_3823 658
453 3300046512 Ga0495610_0004175 Ga0495610_0004175_2801_4783 658
454 3300046513 Ga0495616_0028420 Ga0495616_0028420_313_2295 658
455 3300046515 Ga0495620_0003971 Ga0495620_0003971_4667_6649 658
456 3300046517 Ga0495630_0014497 Ga0495630_0014497_1761_3743 658
457 3300046519 Ga0495632_0005284 Ga0495632_0005284_5050_7032 658
458 3300046520 Ga0495637_0000228 Ga0495637_0000228_15227_17209 658
459 3300046522 Ga0495643_0024900 Ga0495643_0024900_117_2099 658
460 3300046523 Ga0495644_0006119 Ga0495644_0006119_2468_4450 658
461 3300046524 Ga0495648_0014037 Ga0495648_0014037_3712_5694 658
462 3300046524 Ga0495648_0049692 Ga0495648_0049692_148_2130 658
463 3300046528 Ga0495642_0000364 Ga0495642_0000364_21091_23073 658
464 3300046530 Ga0495654_0000631 Ga0495654_0000631_19126_21123 658
465 3300046536 Ga0495587_0029733 Ga0495587_0029733_1215_3197 658
466 3300046538 Ga0495609_0001166 Ga0495609_0001166_4904_6886 658
467 3300046557 Ga0495622_0000901 Ga0495622_0000901_4531_6513 658
468 3300046615 Ga0495656_0002248 Ga0495656_0002248_2774_4756 658
469 3300046616 Ga0495668_0001375 Ga0495668_0001375_15928_17910 658
470 3300046660 Ga0495625_0008053 Ga0495625_0008053_5299_7281 658
471 3300046663 Ga0495635_0002382 Ga0495635_0002382_316_2298 658
472 3300046664 Ga0495659_0001223 Ga0495659_0001223_5470_7452 658
473 3300046689 Ga0495613_0001979 Ga0495613_0001979_3389_5371 658
474 3300046691 Ga0495670_0003314 Ga0495670_0003314_545_2527 658
475 3300046692 Ga0495671_0005589 Ga0495671_0005589_95_2077 658
476 3300046694 Ga0495649_0019352 Ga0495649_0019352_1051_3033 658
477 3300046810 Ga0495660_0017592 Ga0495660_0017592_556_2538 658
478 3300046810 Ga0495660_0035789 Ga0495660_0035789_716_2698 658
479 3300047317 Ga0495604_0001530 Ga0495604_0001530_11001_12983 658
480 3300047320 Ga0495672_0024191 Ga0495672_0024191_1366_3348 658
481 3300047322 Ga0495680_0030912 Ga0495680_0030912_2081_4063 658
482 3300047322 Ga0495680_0094512 Ga0495680_0094512_106_2088 658
483 3300047323 Ga0495683_0005348 Ga0495683_0005348_4754_6736 658
484 3300047323 Ga0495683_0019873 Ga0495683_0019873_1459_3441 658
485 3300047470 Ga0495681_0002896 Ga0495681_0002896_6869_8851 658
486 3300047472 Ga0495686_0012951 Ga0495686_0012951_288_2270 658
487 3300048919 Ga0496116_0000444 Ga0496116_0000444_20078_22054 658
488 3300048920 Ga0496117_0000894 Ga0496117_0000894_34856_36832 658
489 3300048924 Ga0496121_0000815 Ga0496121_0000815_20078_22054 658
490 3300048925 Ga0496122_0036485 Ga0496122_0036485_493_2469 658
491 3300048926 Ga0496123_0001415 Ga0496123_0001415_14954_16930 658
492 3300048928 Ga0496125_0045970 Ga0496125_0045970_223_2205 658
493 3300049459 Ga0495678_004084 Ga0495678_004084_933_2915 658
494 3300049459 Ga0495678_005755 Ga0495678_005755_3208_5190 658
495 3300049460 Ga0495682_0010891 Ga0495682_0010891_674_2656 658

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05430

Methyltransf_30

S-adenosyl-L-methionine-dependent methyltransferase

109

231

0.98

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

260

315

0.81

PF01266

DAO

FAD dependent oxidoreductase

257

623

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qy6-assembly1.cif.gz_A crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7 0.9146 5 235
6grl-assembly1.cif.gz_A structure of imine reductase (apo form) at 1.6 a resolution from saccharomonospora xinjiangensis 0.8931 260 292
4ffo-assembly1.cif.gz_A pylc in complex with phosphorylated d-ornithine 0.8862 260 292
4ffr-assembly1.cif.gz_A semet-labeled pylc (remote) 0.8859 260 292
4ffm-assembly1.cif.gz_A pylc in complex with l-lysine-ne-d-ornithine (cocrystallized with l-lysine-ne-d-ornithine) 0.8843 260 292
ID Description Score Start End Superfamily
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9858 260 294 3.50.50.60
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9811 260 295 3.50.50.60
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9754 262 294 3.50.50.60
3gmbB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9734 260 294 3.50.50.60
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9725 262 294 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3M2ZUK8-F1-model_v4 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC 0.9782 84 227 GO:0004808
GO:0016645
AF-A0A3S2X916-F1-model_v4 Bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC 0.9698 100 238 GO:0004808
GO:0016645
GO:0032259
AF-A0A7T5VBE4-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD 0.9649 5 235 GO:0004808
GO:0016645
GO:0032259
AF-A0A0F2QLI2-F1-model_v4 deleted 0.9634 2 233
AF-W8I3X1-F1-model_v4 deleted 0.9616 42 235

Feature Viewer

pLDDT pTM Quality
78.04 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map