F454656

General Info

Members Datasets Scaffolds Average Seq Length
494 243 882 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954711539|2954721427
Length 274
Sequence HLNCGTMRPCGAHLVCHVLLIETDSGLVLVDSGYGLDDIAHPGRRVGPSRWYVRPVLDPQEAAACQVERLGFRRDDVRHIVLTHFDADHIGGLSDFPQAQVHVTAAEVRGAVHSPSRRERLRFRPAQWAHGPNLVEHSPDGEAWRGFAAARELTAIAPGIVLVSLPGHTRGHACVAVDTGARWILHAGDAFYHHGTLDPRTPVPAGLRVMETVVAHDLKKVRDNHARLTELYRRADPGLAIVCAHDPVLYEKMRTEADLPGNEGGSPQRRPSCY

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
226 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
227 2558860280 Kutzneria sp. 744 Isolate Unclassified
228 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
229 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
230 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
231 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
232 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
233 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
234 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
235 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
236 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
237 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
238 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
239 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
240 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
241 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
242 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
243 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.72
Nodule 0
Rhizoplane 12.75
Rhizosphere 67.41
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10038036 3300002067 Bacteria 1409
2 JGI24742J22300_10004853 3300002244 Bacteria 2206
3 JGI24751J29686_10001425 3300002459 Bacteria 5008
4 Ga0055540_1000127 3300003792 Bacteria 77764
5 Ga0070690_100010157 3300005330 Bacteria 5468
6 Ga0068869_100011181 3300005334 Bacteria 5882
7 Ga0070682_100006387 3300005337 Bacteria 6619
8 Ga0068868_100000835 3300005338 Bacteria 20892
9 Ga0070660_100036684 3300005339 Bacteria 3714
10 Ga0070689_100004121 3300005340 Bacteria 9790
11 Ga0070691_10017934 3300005341 Bacteria 3259
12 Ga0070691_10042021 3300005341 Bacteria 2163
13 Ga0070692_10006050 3300005345 Bacteria 5220
14 Ga0070668_100000372 3300005347 Bacteria 29698
15 Ga0070669_100001222 3300005353 Bacteria 18647
16 Ga0070669_100002156 3300005353 Bacteria 14243
17 Ga0070669_100020458 3300005353 Bacteria 4726
18 Ga0070671_100006107 3300005355 Bacteria 9595
19 Ga0070671_100175326 3300005355 Bacteria 1814
20 Ga0070674_100001670 3300005356 Bacteria 11986
21 Ga0070674_100038785 3300005356 Bacteria 3213
22 Ga0070688_100044708 3300005365 Bacteria 2734
23 Ga0070667_100000312 3300005367 Bacteria 54191
24 Ga0070667_100000464 3300005367 Bacteria 41703
25 Ga0070667_100001413 3300005367 Bacteria 21486
26 Ga0070667_100002632 3300005367 Bacteria 15542
27 Ga0070667_100002947 3300005367 Bacteria 14624
28 Ga0070667_100035089 3300005367 Bacteria 4201
29 Ga0070667_100305855 3300005367 Bacteria 1432
30 Ga0070709_10031263 3300005434 Bacteria 3201
31 Ga0070710_10000500 3300005437 Bacteria 18414
32 Ga0070710_10428698 3300005437 Bacteria 892
33 Ga0070701_10015603 3300005438 Bacteria 3512
34 Ga0070711_100000507 3300005439 Bacteria 20268
35 Ga0070705_100001225 3300005440 Bacteria 13875
36 Ga0070700_100002796 3300005441 Bacteria 8942
37 Ga0070700_100025748 3300005441 Bacteria 3467
38 Ga0070694_100018788 3300005444 Bacteria 4392
39 Ga0070663_100012997 3300005455 Bacteria 5288
40 Ga0070663_100221413 3300005455 Bacteria 1486
41 Ga0070678_100004403 3300005456 Bacteria 7979
42 Ga0070678_100032296 3300005456 Bacteria 3622
43 Ga0070662_100007279 3300005457 Bacteria 7171
44 Ga0068867_100000651 3300005459 Bacteria 23001
45 Ga0070685_10034000 3300005466 Bacteria 2869
46 Ga0070685_10241105 3300005466 Bacteria 1193
47 Ga0068853_100002607 3300005539 Bacteria 13556
48 Ga0068853_100010575 3300005539 Bacteria 7462
49 Ga0068853_100043932 3300005539 Bacteria 3824
50 Ga0070695_100025719 3300005545 Bacteria 3636
51 Ga0070695_100057405 3300005545 Bacteria 2515
52 Ga0070696_100005957 3300005546 Bacteria 8138
53 Ga0070693_100003998 3300005547 Bacteria 6927
54 Ga0070665_100013837 3300005548 Bacteria 8115
55 Ga0070665_100035553 3300005548 Bacteria 5010
56 Ga0070665_100073589 3300005548 Bacteria 3422
57 Ga0070665_100102378 3300005548 Bacteria 2867
58 Ga0070665_100149604 3300005548 Unclassified 2338
59 Ga0070704_100002830 3300005549 Bacteria 9825
60 Ga0068855_100325405 3300005563 Bacteria 1698
61 Ga0068854_100000467 3300005578 Bacteria 24919
62 Ga0070702_100006942 3300005615 Bacteria 5392
63 Ga0068852_100033296 3300005616 Bacteria 4277
64 Ga0068859_100000574 3300005617 Bacteria 36714
65 Ga0068859_100001307 3300005617 Bacteria 25448
66 Ga0068859_100002234 3300005617 Bacteria 19639
67 Ga0068866_10000811 3300005718 Bacteria 13964
68 Ga0068861_100003284 3300005719 Bacteria 10703
69 Ga0068863_100000397 3300005841 Bacteria 44254
70 Ga0068863_100000496 3300005841 Bacteria 39941
71 Ga0068863_100002385 3300005841 Bacteria 18673
72 Ga0068863_100231149 3300005841 Bacteria 1784
73 Ga0068858_100003041 3300005842 Bacteria 16812
74 Ga0068858_100003095 3300005842 Bacteria 16641
75 Ga0068858_100068693 3300005842 Bacteria 3284
76 Ga0068860_100000011 3300005843 Bacteria 328172
77 Ga0068860_100000190 3300005843 Bacteria 97582
78 Ga0068860_100004866 3300005843 Bacteria 13685
79 Ga0068862_100000024 3300005844 Bacteria 197686
80 Ga0068862_100000054 3300005844 Bacteria 143584
81 Ga0068862_100002068 3300005844 Bacteria 18113
82 Ga0081455_10012418 3300005937 Bacteria 8498
83 Ga0075365_10003736 3300006038 Bacteria 7920
84 Ga0075363_100006197 3300006048 Bacteria 5408
85 Ga0075363_100030037 3300006048 Bacteria 2810
86 Ga0075363_100058673 3300006048 Bacteria 2067
87 Ga0075363_100135949 3300006048 Bacteria 1381
88 Ga0075363_100154180 3300006048 Bacteria 1298
89 Ga0075364_10001468 3300006051 Bacteria 12827
90 Ga0075364_10008768 3300006051 Bacteria 6050
91 Ga0075364_10016027 3300006051 Bacteria 4655
92 Ga0075364_10040402 3300006051 Bacteria 3025
93 Ga0075364_10079470 3300006051 Bacteria 2167
94 Ga0070715_10003073 3300006163 Bacteria 5233
95 Ga0070716_100001642 3300006173 Bacteria 10095
96 Ga0070716_100035533 3300006173 Bacteria 2741
97 Ga0070712_100007622 3300006175 Bacteria 6768
98 Ga0075367_10001161 3300006178 Bacteria 11007
99 Ga0075369_10007525 3300006186 Bacteria 4153
100 Ga0075369_10014201 3300006186 Bacteria 3178
101 Ga0075369_10035704 3300006186 Bacteria 2114
102 Ga0075369_10039886 3300006186 Bacteria 2006
103 Ga0097621_100033040 3300006237 Bacteria 4117
104 Ga0075370_10000202 3300006353 Bacteria 21044
105 Ga0075370_10344254 3300006353 Bacteria 890
106 Ga0075428_100038394 3300006844 Bacteria 5269
107 Ga0075430_100012098 3300006846 Bacteria 7347
108 Ga0075431_100229490 3300006847 Bacteria 1892
109 Ga0068865_100000210 3300006881 Bacteria 32558
110 Ga0068865_100364568 3300006881 Bacteria 1174
111 Ga0097620_100000574 3300006931 Bacteria 36714
112 Ga0097620_100001307 3300006931 Bacteria 25448
113 Ga0097620_100002234 3300006931 Bacteria 19639
114 Ga0111539_10525640 3300009094 Bacteria 1378
115 Ga0105245_10001485 3300009098 Bacteria 21201
116 Ga0105247_10000046 3300009101 Bacteria 151843
117 Ga0105247_10000085 3300009101 Bacteria 102010
118 Ga0105247_10002027 3300009101 Bacteria 14035
119 Ga0105247_10016122 3300009101 Bacteria 4477
120 Ga0105247_10221719 3300009101 Bacteria 1280
121 Ga0114129_10011281 3300009147 Bacteria 12734
122 Ga0105243_10002619 3300009148 Bacteria 14980
123 Ga0105241_10022728 3300009174 Bacteria 4647
124 Ga0105242_10001311 3300009176 Bacteria 19688
125 Ga0105248_10000233 3300009177 Bacteria 63881
126 Ga0105248_10000302 3300009177 Bacteria 58644
127 Ga0105248_10001866 3300009177 Bacteria 23361
128 Ga0105248_10409019 3300009177 Bacteria 1528
129 Ga0105237_10002379 3300009545 Bacteria 23343
130 Ga0105237_10006029 3300009545 Bacteria 13566
131 Ga0105238_10066291 3300009551 Bacteria 3612
132 Ga0105238_10109123 3300009551 Bacteria 2749
133 Ga0105238_10744722 3300009551 Bacteria 994
134 Ga0105249_10000001 3300009553 Bacteria 504948
135 Ga0105249_10000333 3300009553 Bacteria 47704
136 Ga0105249_10000613 3300009553 Bacteria 32543
137 Ga0105249_10169625 3300009553 Bacteria 2115
138 Ga0105239_10008621 3300010375 Bacteria 11558
139 Ga0105239_10010346 3300010375 Bacteria 10446
140 Ga0105239_10012745 3300010375 Bacteria 9353
141 Ga0105239_10121636 3300010375 Bacteria 2899
142 Ga0105239_10263401 3300010375 Bacteria 1938
143 Ga0157371_10214792 3300013102 Bacteria 1381
144 Ga0157378_10004561 3300013297 Bacteria 12148
145 Ga0157378_10164125 3300013297 Bacteria 2079
146 Ga0163162_10002507 3300013306 Bacteria 17359
147 Ga0157372_10008733 3300013307 Bacteria 10760
148 Ga0157375_10001858 3300013308 Bacteria 18172
149 Ga0163163_10045650 3300014325 Bacteria 4302
150 Ga0163163_10055162 3300014325 Bacteria 3928
151 Ga0157380_10000978 3300014326 Bacteria 18124
152 Ga0182008_10291102 3300014497 Bacteria 852
153 Ga0157377_10074220 3300014745 Bacteria 1973
154 Ga0157379_10054479 3300014968 Bacteria 3573
155 Ga0157379_10125814 3300014968 Bacteria 2306
156 Ga0157376_10373599 3300014969 Bacteria 1371
157 Ga0163161_10007821 3300017792 Bacteria 7396
158 Ga0163161_10052520 3300017792 Bacteria 2955
159 Ga0213876_10001276 3300021384 Bacteria 15892
160 Ga0209051_1000014 3300025303 Bacteria 552732
161 Ga0207653_10134396 3300025885 Bacteria 900
162 Ga0207692_10009029 3300025898 Bacteria 4150
163 Ga0207642_10000605 3300025899 Bacteria 11038
164 Ga0207642_10002853 3300025899 Bacteria 5393
165 Ga0207642_10201605 3300025899 Bacteria 1099
166 Ga0207710_10000071 3300025900 Bacteria 151859
167 Ga0207710_10000125 3300025900 Bacteria 93726
168 Ga0207710_10015665 3300025900 Bacteria 3206
169 Ga0207688_10000578 3300025901 Bacteria 18023
170 Ga0207680_10006834 3300025903 Bacteria 5538
171 Ga0207647_10027677 3300025904 Bacteria 3693
172 Ga0207699_10079923 3300025906 Bacteria 2024
173 Ga0207645_10028650 3300025907 Bacteria 3595
174 Ga0207654_10186449 3300025911 Bacteria 1357
175 Ga0207671_10008554 3300025914 Bacteria 8658
176 Ga0207671_10044472 3300025914 Bacteria 3284
177 Ga0207693_10000902 3300025915 Bacteria 26647
178 Ga0207663_10004342 3300025916 Bacteria 7038
179 Ga0207663_10046689 3300025916 Bacteria 2669
180 Ga0207660_10213537 3300025917 Bacteria 1512
181 Ga0207657_10128441 3300025919 Bacteria 2080
182 Ga0207681_10001544 3300025923 Bacteria 14844
183 Ga0207681_10001914 3300025923 Bacteria 13328
184 Ga0207681_10062210 3300025923 Bacteria 2569
185 Ga0207687_10111795 3300025927 Bacteria 2029
186 Ga0207644_10086600 3300025931 Bacteria 2326
187 Ga0207644_10106222 3300025931 Bacteria 2116
188 Ga0207706_10004987 3300025933 Bacteria 12400
189 Ga0207686_10040670 3300025934 Bacteria 2828
190 Ga0207686_10243873 3300025934 Bacteria 1309
191 Ga0207709_10180644 3300025935 Bacteria 1490
192 Ga0207669_10000513 3300025937 Bacteria 16934
193 Ga0207669_10010102 3300025937 Bacteria 4531
194 Ga0207704_10001421 3300025938 Bacteria 10700
195 Ga0207665_10003892 3300025939 Bacteria 9990
196 Ga0207665_10007827 3300025939 Bacteria 7055
197 Ga0207711_10000106 3300025941 Bacteria 89143
198 Ga0207711_10000356 3300025941 Bacteria 48645
199 Ga0207711_10143255 3300025941 Bacteria 2151
200 Ga0207711_10198316 3300025941 Bacteria 1831
201 Ga0207711_10282662 3300025941 Bacteria 1528
202 Ga0207689_10114248 3300025942 Bacteria 2219
203 Ga0207689_10190272 3300025942 Bacteria 1693
204 Ga0207667_10281944 3300025949 Bacteria 1698
205 Ga0207712_10000006 3300025961 Bacteria 573204
206 Ga0207712_10000289 3300025961 Bacteria 47458
207 Ga0207712_10043525 3300025961 Bacteria 3098
208 Ga0207668_10016874 3300025972 Bacteria 4567
209 Ga0207668_10254016 3300025972 Bacteria 1429
210 Ga0207640_10012278 3300025981 Bacteria 4874
211 Ga0207658_10000272 3300025986 Bacteria 54201
212 Ga0207658_10000578 3300025986 Bacteria 32934
213 Ga0207658_10001884 3300025986 Bacteria 15702
214 Ga0207658_10003203 3300025986 Bacteria 11650
215 Ga0207658_10152479 3300025986 Bacteria 1884
216 Ga0207677_10014158 3300026023 Bacteria 4647
217 Ga0207677_10205352 3300026023 Bacteria 1569
218 Ga0207703_10060014 3300026035 Bacteria 3108
219 Ga0207703_10135949 3300026035 Bacteria 2128
220 Ga0207703_10171502 3300026035 Bacteria 1908
221 Ga0207639_10005081 3300026041 Bacteria 8864
222 Ga0207639_10050061 3300026041 Bacteria 3171
223 Ga0207708_10003006 3300026075 Bacteria 12424
224 Ga0207641_10000264 3300026088 Bacteria 66489
225 Ga0207641_10000643 3300026088 Bacteria 38084
226 Ga0207641_10002907 3300026088 Bacteria 15499
227 Ga0207641_10329437 3300026088 Bacteria 1450
228 Ga0207648_10000632 3300026089 Bacteria 39466
229 Ga0207676_10221293 3300026095 Bacteria 1686
230 Ga0207675_100000889 3300026118 Bacteria 29863
231 Ga0207683_10000441 3300026121 Bacteria 38357
232 Ga0207683_10050419 3300026121 Bacteria 3646
233 Ga0207698_10039829 3300026142 Bacteria 3485
234 Ga0268266_10009827 3300028379 Bacteria 8411
235 Ga0268266_10015970 3300028379 Bacteria 6422
236 Ga0268266_10076104 3300028379 Bacteria 2916
237 Ga0268266_10099631 3300028379 Bacteria 2558
238 Ga0268266_10199739 3300028379 Unclassified 1829
239 Ga0268265_10000012 3300028380 Bacteria 343132
240 Ga0268265_10000032 3300028380 Bacteria 225953
241 Ga0268265_10015624 3300028380 Bacteria 5198
242 Ga0268264_10000026 3300028381 Bacteria 459088
243 Ga0268264_10000223 3300028381 Bacteria 110442
244 Ga0268264_10003287 3300028381 Bacteria 13973
245 Ga0307516_10012200 3300031730 Bacteria 9278
246 Ga0307516_10078550 3300031730 Bacteria 3146
247 Ga0307518_10011278 3300031838 Bacteria 6389
248 Ga0307409_100195896 3300031995 Bacteria 1803
249 Ga0307411_10270165 3300032005 Bacteria 1348
250 Ga0307415_100245244 3300032126 Bacteria 1452
251 Ga0436364_0154072 3300037853 Bacteria 15306
252 Ga0436365_1823845 3300039437 Bacteria 75216
253 Ga0439436_0040926 3300041404 Bacteria 1327
254 Ga0439466_0010955 3300041411 Bacteria 3361
255 Ga0439465_0002176 3300041413 Bacteria 6432
256 Ga0439465_0017705 3300041413 Bacteria 2226
257 Ga0439465_0038067 3300041413 Bacteria 1548
258 Ga0439465_0074724 3300041413 Bacteria 1140
259 Ga0451853_0833425 3300041512 Bacteria 913
260 Ga0439445_0028010 3300042004 Bacteria 1450
261 Ga0439448_0007494 3300042005 Bacteria 3166
262 Ga0439457_000888 3300042014 Bacteria 9036
263 Ga0466965_0010017 3300044683 Bacteria 4410
264 Ga0466966_0238056 3300044684 Bacteria 1098
265 Ga0466963_0022498 3300044694 Bacteria 3992
266 Ga0466963_0118253 3300044694 Bacteria 1822
267 Ga0466957_0083587 3300044842 Bacteria 1992
268 Ga0466958_0128836 3300045836 Bacteria 1588
269 Ga0466967_0720687 3300045976 Bacteria 988
270 Ga0495603_0052557 3300046455 Bacteria 2419
271 Ga0495629_0016013 3300046459 Bacteria 5389
272 Ga0495638_0007052 3300046460 Bacteria 8106
273 Ga0495641_0050172 3300046461 Bacteria 1908
274 Ga0495582_0013867 3300046473 Bacteria 4440
275 Ga0495639_0054283 3300046475 Bacteria 1826
276 Ga0495594_0040393 3300046499 Bacteria 2553
277 Ga0495620_0069597 3300046515 Bacteria 1443
278 Ga0495640_0013282 3300046533 Bacteria 6262
279 Ga0495634_0099736 3300046642 Bacteria 1878
280 Ga0495635_0211889 3300046663 Bacteria 1312
281 Ga0495613_0457622 3300046689 Bacteria 864
282 Ga0495581_0045899 3300047315 Bacteria 2525
283 Ga0495636_0006927 3300047318 Bacteria 4457
284 Ga0495687_001586 3300047443 Bacteria 20547
285 Ga0495685_065303 3300047447 Bacteria 1223
286 Ga0495686_0134828 3300047472 Bacteria 1461
287 Ga0495593_0017603 3300047673 Bacteria 4022
288 Ga0496100_0000043 3300048903 Bacteria 89692
289 Ga0496100_0006066 3300048903 Bacteria 6564
290 Ga0496100_0013336 3300048903 Bacteria 4737
291 Ga0496100_0118575 3300048903 Bacteria 1849
292 Ga0496100_0153525 3300048903 Bacteria 1645
293 Ga0496100_0203895 3300048903 Bacteria 1443
294 Ga0496101_0000374 3300048904 Bacteria 29694
295 Ga0496101_0002043 3300048904 Bacteria 12285
296 Ga0496101_0013385 3300048904 Bacteria 5493
297 Ga0496101_0016790 3300048904 Bacteria 4955
298 Ga0496101_0057056 3300048904 Bacteria 2823
299 Ga0496101_0062223 3300048904 Bacteria 2713
300 Ga0496101_0226836 3300048904 Bacteria 1451
301 Ga0496102_0000344 3300048905 Bacteria 56680
302 Ga0496102_0000846 3300048905 Bacteria 29425
303 Ga0496102_0002013 3300048905 Bacteria 17555
304 Ga0496102_0012506 3300048905 Bacteria 7349
305 Ga0496102_0035888 3300048905 Bacteria 4465
306 Ga0496102_0036961 3300048905 Bacteria 4402
307 Ga0496102_0096229 3300048905 Bacteria 2745
308 Ga0496103_0001219 3300048906 Bacteria 17632
309 Ga0496103_0001370 3300048906 Bacteria 16438
310 Ga0496103_0018955 3300048906 Bacteria 4131
311 Ga0496103_0021756 3300048906 Bacteria 3860
312 Ga0496103_0128350 3300048906 Bacteria 1618
313 Ga0496104_0010256 3300048907 Bacteria 8368
314 Ga0496104_0017348 3300048907 Bacteria 6553
315 Ga0496104_0062990 3300048907 Bacteria 3516
316 Ga0496105_0023566 3300048908 Bacteria 4994
317 Ga0496105_0171155 3300048908 Bacteria 1780
318 Ga0496106_0000210 3300048909 Bacteria 40806
319 Ga0496106_0000276 3300048909 Bacteria 36292
320 Ga0496106_0001519 3300048909 Bacteria 17445
321 Ga0496106_0002482 3300048909 Bacteria 13750
322 Ga0496106_0049647 3300048909 Bacteria 3161
323 Ga0496107_0001269 3300048910 Bacteria 15449
324 Ga0496107_0001505 3300048910 Bacteria 14468
325 Ga0496107_0008836 3300048910 Bacteria 6980
326 Ga0496107_0027473 3300048910 Bacteria 4040
327 Ga0496107_0065738 3300048910 Bacteria 2629
328 Ga0496107_0145768 3300048910 Bacteria 1751
329 Ga0496108_0609312 3300048911 Bacteria 951
330 Ga0496109_0000616 3300048912 Bacteria 29646
331 Ga0496109_0176846 3300048912 Bacteria 2004
332 Ga0496109_0237192 3300048912 Bacteria 1716
333 Ga0496110_0011208 3300048913 Bacteria 7327
334 Ga0496110_0026491 3300048913 Bacteria 4962
335 Ga0496110_0078919 3300048913 Bacteria 2931
336 Ga0496111_0026830 3300048914 Bacteria 4070
337 Ga0496112_0013340 3300048915 Bacteria 7584
338 Ga0496113_0341169 3300048916 Bacteria 1201
339 Ga0496114_0000465 3300048917 Bacteria 29699
340 Ga0496114_0001008 3300048917 Bacteria 21115
341 Ga0496114_0009368 3300048917 Bacteria 7773
342 Ga0496114_0160676 3300048917 Bacteria 1953
343 Ga0496115_0001487 3300048918 Bacteria 16854
344 Ga0496115_0004419 3300048918 Bacteria 10187
345 Ga0496115_0081989 3300048918 Bacteria 2628
346 Ga0496115_0231665 3300048918 Bacteria 1523
347 Ga0496116_0001425 3300048919 Bacteria 26878
348 Ga0496116_0002643 3300048919 Bacteria 18559
349 Ga0496116_0008584 3300048919 Bacteria 8841
350 Ga0496116_0011222 3300048919 Bacteria 7439
351 Ga0496117_0000550 3300048920 Bacteria 61610
352 Ga0496117_0001153 3300048920 Bacteria 39795
353 Ga0496117_0001306 3300048920 Bacteria 36677
354 Ga0496117_0013414 3300048920 Bacteria 7152
355 Ga0496118_0000473 3300048921 Bacteria 66681
356 Ga0496118_0000516 3300048921 Bacteria 63445
357 Ga0496118_0001856 3300048921 Bacteria 30242
358 Ga0496118_0017322 3300048921 Bacteria 6566
359 Ga0496119_0002912 3300048922 Bacteria 18269
360 Ga0496119_0017108 3300048922 Bacteria 5478
361 Ga0496119_0022345 3300048922 Bacteria 4532
362 Ga0496119_0069956 3300048922 Bacteria 2060
363 Ga0496119_0134668 3300048922 Bacteria 1342
364 Ga0496120_0003530 3300048923 Bacteria 14153
365 Ga0496120_0040276 3300048923 Bacteria 2747
366 Ga0496121_0000048 3300048924 Bacteria 330242
367 Ga0496121_0001856 3300048924 Bacteria 33927
368 Ga0496121_0003201 3300048924 Bacteria 23581
369 Ga0496122_0000301 3300048925 Bacteria 109636
370 Ga0496123_0014124 3300048926 Bacteria 6641
371 Ga0496123_0016940 3300048926 Bacteria 5887
372 Ga0496124_0001160 3300048927 Bacteria 41305
373 Ga0496125_0000037 3300048928 Bacteria 330242
374 Ga0496125_0002458 3300048928 Bacteria 24073
375 Ga0496125_0013158 3300048928 Bacteria 8153
376 Ga0496125_0056178 3300048928 Bacteria 3199
377 Ga0496126_0000046 3300048929 Bacteria 330242
378 Ga0496126_0001953 3300048929 Bacteria 29245
379 Ga0496126_0002811 3300048929 Bacteria 22838
380 Ga0496126_0004146 3300048929 Bacteria 17518
381 Ga0501032_0045929 3300049569 Bacteria 2953
382 Ga0501034_0116308 3300049571 Bacteria 2662
383 Ga0501037_0048239 3300049573 Bacteria 3121
384 Ga0501038_0002426 3300049574 Bacteria 17371
385 Ga0501042_0088058 3300049578 Bacteria 2228
386 Ga0501046_0043426 3300049580 Bacteria 3579
387 Ga0501047_0015967 3300049581 Bacteria 7159
388 Ga0501073_0087753 3300049589 Bacteria 2163
389 Ga0501035_0011442 3300049822 Bacteria 8227
390 Ga0501044_0130055 3300049823 Bacteria 2512
391 Ga0501045_0532180 3300049824 Bacteria 872
392 nmdc:mga03683_72443_c1 3300050489 Bacteria 1475
393 nmdc:mga03n38_26738_c1 3300050490 Bacteria 2386
394 nmdc:mga03n38_32070_c1 3300050490 Bacteria 2222
395 nmdc:mga03n38_50843_c1 3300050490 Bacteria 1849
396 nmdc:mga00v17_136304_c1 3300050491 Bacteria 1572
397 nmdc:mga00v17_147806_c1 3300050491 Bacteria 1509
398 nmdc:mga00v17_23734_c1 3300050491 Bacteria 3551
399 nmdc:mga00v17_252203_c1 3300050491 Bacteria 1144
400 nmdc:mga00v17_25551_c1 3300050491 Bacteria 3433
401 nmdc:mga00v17_2837_c1 3300050491 Bacteria 8902
402 nmdc:mga0yw44_44642_c1 3300050492 Bacteria 2652
403 nmdc:mga0yw44_64776_c1 3300050492 Bacteria 2250
404 nmdc:mga06z11_28458_c1 3300050494 Bacteria 2682
405 nmdc:mga07m45_10305_c2 3300050496 Bacteria 4482
406 nmdc:mga07m45_174189_c1 3300050496 Bacteria 1251
407 nmdc:mga07m45_3684_c1 3300050496 Bacteria 7411
408 nmdc:mga05p37_24134_c1 3300050507 Bacteria 7387
409 nmdc:mga0qj67_9460_c1 3300050509 Bacteria 7254
410 nmdc:mga06r32_78954_c1 3300050510 Bacteria 3200
411 nmdc:mga0sz30_1198_c1 3300050516 Bacteria 9303
412 nmdc:mga0sz30_122368_c1 3300050516 Bacteria 1144
413 nmdc:mga0sz30_34247_c1 3300050516 Bacteria 2113
414 nmdc:mga0sz30_83444_c1 3300050516 Bacteria 1384
415 Ga0500646_0000219 3300053090 Bacteria 17239
416 Ga0500583_0002150 3300053092 Bacteria 5853
417 Ga0500556_0008081 3300053104 Bacteria 3029
418 Ga0500556_0022804 3300053104 Bacteria 2037
419 Ga0500579_104314 3300053143 Bacteria 1461
420 Ga0500616_0016453 3300053153 Bacteria 4210
421 Ga0500616_0038897 3300053153 Bacteria 2567
422 Ga0500616_0131852 3300053153 Bacteria 1180
423 2954721427 2954711539 Bacteria 10867210
424 2552110526 2551306166 Bacteria 9731570
425 2559432221 2558860280 Bacteria 11429938
426 2738663904 2738541264 Bacteria 5935393
427 2739143039 2738541356 Bacteria 5935017
428 2785339441 2784746763 Bacteria 9783172
429 2793979021 2791355406 Bacteria 11364898
430 2863409548 2863404153 Bacteria 9672205
431 2902814564 2902810491 Bacteria 6794147
432 2954730984 2954721474 Bacteria 10456478
433 2954731065 2954731030 Bacteria 10243860
434 2954749690 2954740390 Bacteria 10229294
435 2954749775 2954749733 Bacteria 10366972
436 2990068231 2990059506 Bacteria 9321252
437 8047902538 8047893842 Bacteria 11723082
438 8048128033 8048127548 Bacteria 11053136
439 8048370335 8048369669 Bacteria 11666822
440 8048389087 8048379754 Bacteria 11877923
441 8048411336 8048406513 Bacteria 8936924
442 JGI24735J21928_10038036
443 JGI24742J22300_10004853
444 JGI24751J29686_10001425
445 Ga0055540_1000127
446 Ga0070690_100010157
447 Ga0068869_100011181
448 Ga0070682_100006387
449 Ga0068868_100000835
450 Ga0070660_100036684
451 Ga0070689_100004121
452 Ga0070691_10017934
453 Ga0070691_10042021
454 Ga0070692_10006050
455 Ga0070668_100000372
456 Ga0070669_100001222
457 Ga0070669_100002156
458 Ga0070669_100020458
459 Ga0070671_100006107
460 Ga0070671_100175326
461 Ga0070674_100001670
462 Ga0070674_100038785
463 Ga0070688_100044708
464 Ga0070667_100000312
465 Ga0070667_100000464
466 Ga0070667_100001413
467 Ga0070667_100002632
468 Ga0070667_100002947
469 Ga0070667_100035089
470 Ga0070667_100305855
471 Ga0070709_10031263
472 Ga0070710_10000500
473 Ga0070710_10428698
474 Ga0070701_10015603
475 Ga0070711_100000507
476 Ga0070705_100001225
477 Ga0070700_100002796
478 Ga0070700_100025748
479 Ga0070694_100018788
480 Ga0070663_100012997
481 Ga0070663_100221413
482 Ga0070678_100004403
483 Ga0070678_100032296
484 Ga0070662_100007279
485 Ga0068867_100000651
486 Ga0070685_10034000
487 Ga0070685_10241105
488 Ga0068853_100002607
489 Ga0068853_100010575
490 Ga0068853_100043932
491 Ga0070695_100025719
492 Ga0070695_100057405
493 Ga0070696_100005957
494 Ga0070693_100003998
495 Ga0070665_100013837
496 Ga0070665_100035553
497 Ga0070665_100073589
498 Ga0070665_100102378
499 Ga0070665_100149604
500 Ga0070704_100002830
501 Ga0068855_100325405
502 Ga0068854_100000467
503 Ga0070702_100006942
504 Ga0068852_100033296
505 Ga0068859_100000574
506 Ga0068859_100001307
507 Ga0068859_100002234
508 Ga0068866_10000811
509 Ga0068861_100003284
510 Ga0068863_100000397
511 Ga0068863_100000496
512 Ga0068863_100002385
513 Ga0068863_100231149
514 Ga0068858_100003041
515 Ga0068858_100003095
516 Ga0068858_100068693
517 Ga0068860_100000011
518 Ga0068860_100000190
519 Ga0068860_100004866
520 Ga0068862_100000024
521 Ga0068862_100000054
522 Ga0068862_100002068
523 Ga0081455_10012418
524 Ga0075365_10003736
525 Ga0075363_100006197
526 Ga0075363_100030037
527 Ga0075363_100058673
528 Ga0075363_100135949
529 Ga0075363_100154180
530 Ga0075364_10001468
531 Ga0075364_10008768
532 Ga0075364_10016027
533 Ga0075364_10040402
534 Ga0075364_10079470
535 Ga0070715_10003073
536 Ga0070716_100001642
537 Ga0070716_100035533
538 Ga0070712_100007622
539 Ga0075367_10001161
540 Ga0075369_10007525
541 Ga0075369_10014201
542 Ga0075369_10035704
543 Ga0075369_10039886
544 Ga0097621_100033040
545 Ga0075370_10000202
546 Ga0075370_10344254
547 Ga0075428_100038394
548 Ga0075430_100012098
549 Ga0075431_100229490
550 Ga0068865_100000210
551 Ga0068865_100364568
552 Ga0097620_100000574
553 Ga0097620_100001307
554 Ga0097620_100002234
555 Ga0111539_10525640
556 Ga0105245_10001485
557 Ga0105247_10000046
558 Ga0105247_10000085
559 Ga0105247_10002027
560 Ga0105247_10016122
561 Ga0105247_10221719
562 Ga0114129_10011281
563 Ga0105243_10002619
564 Ga0105241_10022728
565 Ga0105242_10001311
566 Ga0105248_10000233
567 Ga0105248_10000302
568 Ga0105248_10001866
569 Ga0105248_10409019
570 Ga0105237_10002379
571 Ga0105237_10006029
572 Ga0105238_10066291
573 Ga0105238_10109123
574 Ga0105238_10744722
575 Ga0105249_10000001
576 Ga0105249_10000333
577 Ga0105249_10000613
578 Ga0105249_10169625
579 Ga0105239_10008621
580 Ga0105239_10010346
581 Ga0105239_10012745
582 Ga0105239_10121636
583 Ga0105239_10263401
584 Ga0157371_10214792
585 Ga0157378_10004561
586 Ga0157378_10164125
587 Ga0163162_10002507
588 Ga0157372_10008733
589 Ga0157375_10001858
590 Ga0163163_10045650
591 Ga0163163_10055162
592 Ga0157380_10000978
593 Ga0182008_10291102
594 Ga0157377_10074220
595 Ga0157379_10054479
596 Ga0157379_10125814
597 Ga0157376_10373599
598 Ga0163161_10007821
599 Ga0163161_10052520
600 Ga0213876_10001276
601 Ga0209051_1000014
602 Ga0207653_10134396
603 Ga0207692_10009029
604 Ga0207642_10000605
605 Ga0207642_10002853
606 Ga0207642_10201605
607 Ga0207710_10000071
608 Ga0207710_10000125
609 Ga0207710_10015665
610 Ga0207688_10000578
611 Ga0207680_10006834
612 Ga0207647_10027677
613 Ga0207699_10079923
614 Ga0207645_10028650
615 Ga0207654_10186449
616 Ga0207671_10008554
617 Ga0207671_10044472
618 Ga0207693_10000902
619 Ga0207663_10004342
620 Ga0207663_10046689
621 Ga0207660_10213537
622 Ga0207657_10128441
623 Ga0207681_10001544
624 Ga0207681_10001914
625 Ga0207681_10062210
626 Ga0207687_10111795
627 Ga0207644_10086600
628 Ga0207644_10106222
629 Ga0207706_10004987
630 Ga0207686_10040670
631 Ga0207686_10243873
632 Ga0207709_10180644
633 Ga0207669_10000513
634 Ga0207669_10010102
635 Ga0207704_10001421
636 Ga0207665_10003892
637 Ga0207665_10007827
638 Ga0207711_10000106
639 Ga0207711_10000356
640 Ga0207711_10143255
641 Ga0207711_10198316
642 Ga0207711_10282662
643 Ga0207689_10114248
644 Ga0207689_10190272
645 Ga0207667_10281944
646 Ga0207712_10000006
647 Ga0207712_10000289
648 Ga0207712_10043525
649 Ga0207668_10016874
650 Ga0207668_10254016
651 Ga0207640_10012278
652 Ga0207658_10000272
653 Ga0207658_10000578
654 Ga0207658_10001884
655 Ga0207658_10003203
656 Ga0207658_10152479
657 Ga0207677_10014158
658 Ga0207677_10205352
659 Ga0207703_10060014
660 Ga0207703_10135949
661 Ga0207703_10171502
662 Ga0207639_10005081
663 Ga0207639_10050061
664 Ga0207708_10003006
665 Ga0207641_10000264
666 Ga0207641_10000643
667 Ga0207641_10002907
668 Ga0207641_10329437
669 Ga0207648_10000632
670 Ga0207676_10221293
671 Ga0207675_100000889
672 Ga0207683_10000441
673 Ga0207683_10050419
674 Ga0207698_10039829
675 Ga0268266_10009827
676 Ga0268266_10015970
677 Ga0268266_10076104
678 Ga0268266_10099631
679 Ga0268266_10199739
680 Ga0268265_10000012
681 Ga0268265_10000032
682 Ga0268265_10015624
683 Ga0268264_10000026
684 Ga0268264_10000223
685 Ga0268264_10003287
686 Ga0307516_10012200
687 Ga0307516_10078550
688 Ga0307518_10011278
689 Ga0307409_100195896
690 Ga0307411_10270165
691 Ga0307415_100245244
692 Ga0436364_0154072
693 Ga0436365_1823845
694 Ga0439436_0040926
695 Ga0439466_0010955
696 Ga0439465_0002176
697 Ga0439465_0017705
698 Ga0439465_0038067
699 Ga0439465_0074724
700 Ga0451853_0833425
701 Ga0439445_0028010
702 Ga0439448_0007494
703 Ga0439457_000888
704 Ga0466965_0010017
705 Ga0466966_0238056
706 Ga0466963_0022498
707 Ga0466963_0118253
708 Ga0466957_0083587
709 Ga0466958_0128836
710 Ga0466967_0720687
711 Ga0495603_0052557
712 Ga0495629_0016013
713 Ga0495638_0007052
714 Ga0495641_0050172
715 Ga0495582_0013867
716 Ga0495639_0054283
717 Ga0495594_0040393
718 Ga0495620_0069597
719 Ga0495640_0013282
720 Ga0495634_0099736
721 Ga0495635_0211889
722 Ga0495613_0457622
723 Ga0495581_0045899
724 Ga0495636_0006927
725 Ga0495687_001586
726 Ga0495685_065303
727 Ga0495686_0134828
728 Ga0495593_0017603
729 Ga0496100_0000043
730 Ga0496100_0006066
731 Ga0496100_0013336
732 Ga0496100_0118575
733 Ga0496100_0153525
734 Ga0496100_0203895
735 Ga0496101_0000374
736 Ga0496101_0002043
737 Ga0496101_0013385
738 Ga0496101_0016790
739 Ga0496101_0057056
740 Ga0496101_0062223
741 Ga0496101_0226836
742 Ga0496102_0000344
743 Ga0496102_0000846
744 Ga0496102_0002013
745 Ga0496102_0012506
746 Ga0496102_0035888
747 Ga0496102_0036961
748 Ga0496102_0096229
749 Ga0496103_0001219
750 Ga0496103_0001370
751 Ga0496103_0018955
752 Ga0496103_0021756
753 Ga0496103_0128350
754 Ga0496104_0010256
755 Ga0496104_0017348
756 Ga0496104_0062990
757 Ga0496105_0023566
758 Ga0496105_0171155
759 Ga0496106_0000210
760 Ga0496106_0000276
761 Ga0496106_0001519
762 Ga0496106_0002482
763 Ga0496106_0049647
764 Ga0496107_0001269
765 Ga0496107_0001505
766 Ga0496107_0008836
767 Ga0496107_0027473
768 Ga0496107_0065738
769 Ga0496107_0145768
770 Ga0496108_0609312
771 Ga0496109_0000616
772 Ga0496109_0176846
773 Ga0496109_0237192
774 Ga0496110_0011208
775 Ga0496110_0026491
776 Ga0496110_0078919
777 Ga0496111_0026830
778 Ga0496112_0013340
779 Ga0496113_0341169
780 Ga0496114_0000465
781 Ga0496114_0001008
782 Ga0496114_0009368
783 Ga0496114_0160676
784 Ga0496115_0001487
785 Ga0496115_0004419
786 Ga0496115_0081989
787 Ga0496115_0231665
788 Ga0496116_0001425
789 Ga0496116_0002643
790 Ga0496116_0008584
791 Ga0496116_0011222
792 Ga0496117_0000550
793 Ga0496117_0001153
794 Ga0496117_0001306
795 Ga0496117_0013414
796 Ga0496118_0000473
797 Ga0496118_0000516
798 Ga0496118_0001856
799 Ga0496118_0017322
800 Ga0496119_0002912
801 Ga0496119_0017108
802 Ga0496119_0022345
803 Ga0496119_0069956
804 Ga0496119_0134668
805 Ga0496120_0003530
806 Ga0496120_0040276
807 Ga0496121_0000048
808 Ga0496121_0001856
809 Ga0496121_0003201
810 Ga0496122_0000301
811 Ga0496123_0014124
812 Ga0496123_0016940
813 Ga0496124_0001160
814 Ga0496125_0000037
815 Ga0496125_0002458
816 Ga0496125_0013158
817 Ga0496125_0056178
818 Ga0496126_0000046
819 Ga0496126_0001953
820 Ga0496126_0002811
821 Ga0496126_0004146
822 Ga0501032_0045929
823 Ga0501034_0116308
824 Ga0501037_0048239
825 Ga0501038_0002426
826 Ga0501042_0088058
827 Ga0501046_0043426
828 Ga0501047_0015967
829 Ga0501073_0087753
830 Ga0501035_0011442
831 Ga0501044_0130055
832 Ga0501045_0532180
833 nmdc:mga03683_72443_c1
834 nmdc:mga03n38_26738_c1
835 nmdc:mga03n38_32070_c1
836 nmdc:mga03n38_50843_c1
837 nmdc:mga00v17_136304_c1
838 nmdc:mga00v17_147806_c1
839 nmdc:mga00v17_23734_c1
840 nmdc:mga00v17_252203_c1
841 nmdc:mga00v17_25551_c1
842 nmdc:mga00v17_2837_c1
843 nmdc:mga0yw44_44642_c1
844 nmdc:mga0yw44_64776_c1
845 nmdc:mga06z11_28458_c1
846 nmdc:mga07m45_10305_c2
847 nmdc:mga07m45_174189_c1
848 nmdc:mga07m45_3684_c1
849 nmdc:mga05p37_24134_c1
850 nmdc:mga0qj67_9460_c1
851 nmdc:mga06r32_78954_c1
852 nmdc:mga0sz30_1198_c1
853 nmdc:mga0sz30_122368_c1
854 nmdc:mga0sz30_34247_c1
855 nmdc:mga0sz30_83444_c1
856 Ga0500646_0000219
857 Ga0500583_0002150
858 Ga0500556_0008081
859 Ga0500556_0022804
860 Ga0500579_104314
861 Ga0500616_0016453
862 Ga0500616_0038897
863 Ga0500616_0131852
864 2954721427
865 2552110526
866 2559432221
867 2738663904
868 2739143039
869 2785339441
870 2793979021
871 2863409548
872 2902814564
873 2954730984
874 2954731065
875 2954749690
876 2954749775
877 2990068231
878 8047902538
879 8048128033
880 8048370335
881 8048389087
882 8048411336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

12

245

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8183 14 242
2r2d-assembly1.cif.gz_A structure of a quorum-quenching lactonase (aiib) from agrobacterium tumefaciens 0.8077 14 245
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.7982 8 252
6n9i-assembly2.cif.gz_B structure of the quorum quenching lactonase from parageobacillus caldoxylosilyticus - free 0.7963 12 245
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.7911 14 252
ID Description Score Start End Superfamily
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9867 1 250 3.60.15.10
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9713 1 250 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8221 8 241 3.60.15.10
af_Q7YWN4_71_188_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.8122 143 179 3.30.505.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8017 14 245 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A318HE69-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9955 152 250
AF-A0A0U0RGE1-F1-model_v4 Metallo-beta-lactamase superfamily protein (EC 3.1.1.81) 0.9874 1 250 GO:0102007
AF-P9WLD6-F1-model_v4 Probable metallo-hydrolase MT2357 (EC 3.-.-.-) 0.9871 1 250 GO:0016787
GO:0046872
AF-A0A655ISI6-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9864 77 250
AF-A0A4R7V311-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9852 8 243 GO:0016787

Map