F454626

General Info

Members Datasets Scaffolds Average Seq Length
494 232 988 84

Family's Representative Sequence

Representative Sequence 3300046526|Ga0495666_0219485|Ga0495666_0219485_176_427
Length 83
Sequence MADKARNNAHCTLPDDGEQSTYRFIIVAAKRARQLQGGARPVLPTASKKPTVIAMEESRRGLVKYELIIPPPVTAEPAPEAVL

Samples

Sample ID Description Type Environment
1 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 7.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 32.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495666_0219485 3300046526 Bacteria 871
2 Ga0058863_11296785 3300004799 Bacteria 783
3 Ga0058863_11794887 3300004799 Unclassified 553
4 Ga0058862_12227188 3300004803 Bacteria 621
5 Ga0058862_12622157 3300004803 Bacteria 681
6 Ga0065712_10335459 3300005290 Bacteria 808
7 Ga0070658_10050231 3300005327 Bacteria 3380
8 Ga0070676_10718056 3300005328 Unclassified 731
9 Ga0070683_100026466 3300005329 Bacteria 5223
10 Ga0070690_101696276 3300005330 Unclassified 514
11 Ga0070670_101226501 3300005331 Unclassified 686
12 Ga0070666_10149854 3300005335 Bacteria 1627
13 Ga0070680_100381351 3300005336 Bacteria 1200
14 Ga0068868_100400228 3300005338 Unclassified 1185
15 Ga0068868_100775757 3300005338 Bacteria 863
16 Ga0068868_100937419 3300005338 Unclassified 789
17 Ga0070660_101636852 3300005339 Bacteria 548
18 Ga0070661_101290838 3300005344 Bacteria 612
19 Ga0070668_101418527 3300005347 Unclassified 633
20 Ga0070675_100676557 3300005354 Bacteria 939
21 Ga0070675_101233303 3300005354 Bacteria 689
22 Ga0070675_101707020 3300005354 Unclassified 581
23 Ga0070671_101213883 3300005355 Bacteria 664
24 Ga0070673_100825429 3300005364 Bacteria 857
25 Ga0070673_101429946 3300005364 Bacteria 651
26 Ga0070688_100185758 3300005365 Bacteria 1445
27 Ga0070659_101085731 3300005366 Unclassified 705
28 Ga0070667_100279754 3300005367 Bacteria 1498
29 Ga0070667_100427490 3300005367 Bacteria 1208
30 Ga0070667_101290264 3300005367 Unclassified 684
31 Ga0070667_101738158 3300005367 Bacteria 587
32 Ga0070709_10132334 3300005434 Bacteria 1704
33 Ga0070709_10423789 3300005434 Bacteria 998
34 Ga0070709_11265174 3300005434 Unclassified 594
35 Ga0070714_100289887 3300005435 Bacteria 1523
36 Ga0070713_100098405 3300005436 Bacteria 2530
37 Ga0070710_11085119 3300005437 Unclassified 587
38 Ga0070711_100291346 3300005439 Bacteria 1295
39 Ga0070711_100466201 3300005439 Bacteria 1036
40 Ga0070711_101296537 3300005439 Bacteria 632
41 Ga0070708_100090252 3300005445 Bacteria 2789
42 Ga0070678_100726029 3300005456 Unclassified 897
43 Ga0070678_100844827 3300005456 Bacteria 834
44 Ga0070685_10283474 3300005466 Unclassified 1110
45 Ga0070685_10304169 3300005466 Bacteria 1075
46 Ga0070707_101240401 3300005468 Unclassified 712
47 Ga0070698_100678753 3300005471 Unclassified 972
48 Ga0070699_101866226 3300005518 Bacteria 550
49 Ga0070679_101368175 3300005530 Bacteria 654
50 Ga0070679_101614895 3300005530 Bacteria 596
51 Ga0070684_100347724 3300005535 Bacteria 1363
52 Ga0070684_100763728 3300005535 Bacteria 903
53 Ga0070684_101211855 3300005535 Bacteria 710
54 Ga0070697_100274055 3300005536 Bacteria 1447
55 Ga0070697_100287658 3300005536 Bacteria 1411
56 Ga0068853_100734353 3300005539 Unclassified 943
57 Ga0070672_101381045 3300005543 Unclassified 630
58 Ga0070686_101165765 3300005544 Unclassified 639
59 Ga0070695_100622993 3300005545 Bacteria 849
60 Ga0070695_101014266 3300005545 Unclassified 675
61 Ga0070693_100259166 3300005547 Bacteria 1156
62 Ga0070665_100232865 3300005548 Bacteria 1842
63 Ga0070665_100298131 3300005548 Bacteria 1614
64 Ga0070665_101302210 3300005548 Unclassified 736
65 Ga0068855_100036530 3300005563 Bacteria 5847
66 Ga0068855_100262403 3300005563 Bacteria 1924
67 Ga0068855_100306424 3300005563 Bacteria 1758
68 Ga0068855_100569792 3300005563 Bacteria 1224
69 Ga0068857_101735067 3300005577 Unclassified 611
70 Ga0068856_102655822 3300005614 Unclassified 506
71 Ga0068852_100548446 3300005616 Bacteria 1156
72 Ga0068859_100625030 3300005617 Bacteria 1170
73 Ga0068859_101114775 3300005617 Unclassified 868
74 Ga0068864_100233796 3300005618 Bacteria 1701
75 Ga0068864_100537108 3300005618 Bacteria 1129
76 Ga0068864_101301754 3300005618 Bacteria 727
77 Ga0068864_102030556 3300005618 Bacteria 581
78 Ga0068866_10811161 3300005718 Unclassified 651
79 Ga0068861_101821649 3300005719 Bacteria 604
80 Ga0068861_101834611 3300005719 Unclassified 602
81 Ga0068863_100017732 3300005841 Bacteria 6814
82 Ga0068863_100912954 3300005841 Unclassified 879
83 Ga0068863_101239722 3300005841 Bacteria 752
84 Ga0068863_102023333 3300005841 Bacteria 586
85 Ga0068863_102099355 3300005841 Unclassified 575
86 Ga0068858_100112733 3300005842 Bacteria 2540
87 Ga0068858_100456426 3300005842 Bacteria 1232
88 Ga0068858_100550244 3300005842 Unclassified 1117
89 Ga0068858_101766794 3300005842 Unclassified 611
90 Ga0068858_102171458 3300005842 Unclassified 549
91 Ga0068860_100201457 3300005843 Bacteria 1929
92 Ga0068860_101757351 3300005843 Bacteria 642
93 Ga0068862_100572446 3300005844 Bacteria 1081
94 Ga0068862_101548127 3300005844 Bacteria 669
95 Ga0070717_10195775 3300006028 Unclassified 1768
96 Ga0070717_10796070 3300006028 Bacteria 860
97 Ga0070716_100283139 3300006173 Bacteria 1145
98 Ga0097621_100218243 3300006237 Bacteria 1661
99 Ga0097621_101140874 3300006237 Bacteria 733
100 Ga0097621_101290675 3300006237 Bacteria 689
101 Ga0068871_100628119 3300006358 Unclassified 979
102 Ga0068871_101727765 3300006358 Unclassified 594
103 Ga0068871_101763277 3300006358 Bacteria 588
104 Ga0075434_100538961 3300006871 Bacteria 1187
105 Ga0075434_101641085 3300006871 Bacteria 651
106 Ga0068865_100264026 3300006881 Unclassified 1364
107 Ga0068865_100392833 3300006881 Bacteria 1134
108 Ga0075436_100004302 3300006914 Bacteria 9777
109 Ga0097620_100237447 3300006931 Bacteria 1912
110 Ga0097620_100625020 3300006931 Bacteria 1170
111 Ga0097620_101114623 3300006931 Unclassified 868
112 Ga0075435_100378267 3300007076 Unclassified 1216
113 Ga0105240_10004528 3300009093 Bacteria 21116
114 Ga0105240_10031206 3300009093 Bacteria 6914
115 Ga0105240_10053774 3300009093 Bacteria 5051
116 Ga0105240_10101917 3300009093 Bacteria 3490
117 Ga0105240_10221615 3300009093 Bacteria 2203
118 Ga0105240_10236265 3300009093 Bacteria 2121
119 Ga0105240_10382985 3300009093 Bacteria 1588
120 Ga0111539_10503819 3300009094 Bacteria 1410
121 Ga0105245_10934674 3300009098 Unclassified 910
122 Ga0105245_11515148 3300009098 Unclassified 722
123 Ga0105245_11536523 3300009098 Unclassified 717
124 Ga0105245_11903815 3300009098 Unclassified 648
125 Ga0114129_11611269 3300009147 Bacteria 794
126 Ga0105241_10302653 3300009174 Bacteria 1373
127 Ga0105241_10379222 3300009174 Bacteria 1235
128 Ga0105241_11079589 3300009174 Unclassified 755
129 Ga0105241_11518233 3300009174 Bacteria 645
130 Ga0105242_10086073 3300009176 Bacteria 2637
131 Ga0105242_10568723 3300009176 Unclassified 1090
132 Ga0105242_11997604 3300009176 Bacteria 622
133 Ga0105242_13296382 3300009176 Unclassified 502
134 Ga0105248_10260735 3300009177 Bacteria 1951
135 Ga0105248_10428164 3300009177 Bacteria 1490
136 Ga0105248_10473638 3300009177 Unclassified 1412
137 Ga0105248_10537995 3300009177 Bacteria 1318
138 Ga0105248_10553023 3300009177 Bacteria 1298
139 Ga0105248_10802215 3300009177 Bacteria 1062
140 Ga0105248_10809155 3300009177 Unclassified 1058
141 Ga0105248_11308553 3300009177 Bacteria 820
142 Ga0105248_12929998 3300009177 Bacteria 544
143 Ga0105237_10028749 3300009545 Bacteria 5657
144 Ga0105237_11372406 3300009545 Unclassified 713
145 Ga0105237_11636612 3300009545 Unclassified 651
146 Ga0105237_12146272 3300009545 Unclassified 568
147 Ga0105237_12294838 3300009545 Unclassified 549
148 Ga0105238_10067585 3300009551 Bacteria 3575
149 Ga0105238_10176000 3300009551 Bacteria 2116
150 Ga0105238_10241514 3300009551 Bacteria 1784
151 Ga0105238_10334981 3300009551 Bacteria 1501
152 Ga0105238_11381036 3300009551 Unclassified 731
153 Ga0105238_11478293 3300009551 Bacteria 708
154 Ga0105249_10367881 3300009553 Bacteria 1461
155 Ga0105249_10438838 3300009553 Bacteria 1343
156 Ga0105239_10047500 3300010375 Unclassified 4704
157 Ga0105239_10171132 3300010375 Unclassified 2429
158 Ga0105239_12585328 3300010375 Bacteria 592
159 Ga0105246_10116451 3300011119 Bacteria 1973
160 Ga0157370_10449263 3300013104 Bacteria 1185
161 Ga0157370_10683238 3300013104 Bacteria 937
162 Ga0157370_10843849 3300013104 Bacteria 833
163 Ga0157369_10214447 3300013105 Bacteria 2017
164 Ga0157369_10339797 3300013105 Bacteria 1560
165 Ga0157369_10381459 3300013105 Bacteria 1463
166 Ga0157369_10473503 3300013105 Unclassified 1296
167 Ga0157369_12182088 3300013105 Unclassified 562
168 Ga0157374_10358575 3300013296 Bacteria 1449
169 Ga0157374_10465127 3300013296 Unclassified 1267
170 Ga0157374_10593278 3300013296 Unclassified 1117
171 Ga0157374_10778076 3300013296 Bacteria 972
172 Ga0157374_11063805 3300013296 Bacteria 829
173 Ga0157374_11267039 3300013296 Bacteria 759
174 Ga0157378_10291149 3300013297 Bacteria 1577
175 Ga0157378_10918032 3300013297 Bacteria 907
176 Ga0157378_11170970 3300013297 Unclassified 807
177 Ga0157378_11490495 3300013297 Unclassified 721
178 Ga0157378_12670583 3300013297 Unclassified 552
179 Ga0163162_10885954 3300013306 Bacteria 1006
180 Ga0163162_11258217 3300013306 Bacteria 840
181 Ga0163162_11818977 3300013306 Bacteria 696
182 Ga0163162_12347683 3300013306 Bacteria 613
183 Ga0163162_12356880 3300013306 Unclassified 612
184 Ga0157372_10116891 3300013307 Bacteria 3058
185 Ga0157372_11508001 3300013307 Bacteria 774
186 Ga0157372_12553620 3300013307 Unclassified 586
187 Ga0157372_12625018 3300013307 Unclassified 578
188 Ga0157375_11373593 3300013308 Bacteria 832
189 Ga0157375_12627144 3300013308 Unclassified 602
190 Ga0163163_10024835 3300014325 Bacteria 5706
191 Ga0163163_10134922 3300014325 Bacteria 2509
192 Ga0163163_10417411 3300014325 Unclassified 1401
193 Ga0163163_10487664 3300014325 Bacteria 1294
194 Ga0163163_10520973 3300014325 Bacteria 1251
195 Ga0163163_11140910 3300014325 Unclassified 842
196 Ga0163163_12510676 3300014325 Unclassified 573
197 Ga0157377_10761616 3300014745 Unclassified 710
198 Ga0157379_10807059 3300014968 Bacteria 886
199 Ga0157376_10217278 3300014969 Bacteria 1768
200 Ga0157376_10436931 3300014969 Unclassified 1273
201 Ga0157376_10630987 3300014969 Unclassified 1070
202 Ga0157376_12743097 3300014969 Bacteria 533
203 Ga0163161_10520962 3300017792 Unclassified 971
204 Ga0184601_135663 3300019183 Bacteria 815
205 Ga0184599_132480 3300019188 Bacteria 726
206 Ga0184603_115663 3300019192 Unclassified 588
207 Ga0197907_10214457 3300020069 Bacteria 971
208 Ga0197907_10332616 3300020069 Unclassified 593
209 Ga0206356_10431405 3300020070 Bacteria 629
210 Ga0206356_11714174 3300020070 Unclassified 722
211 Ga0206355_1023940 3300020076 Unclassified 552
212 Ga0206355_1067017 3300020076 Unclassified 624
213 Ga0206355_1302744 3300020076 Bacteria 747
214 Ga0206355_1370304 3300020076 Unclassified 543
215 Ga0206352_10017264 3300020078 Bacteria 711
216 Ga0206352_10367517 3300020078 Bacteria 1268
217 Ga0206352_11032326 3300020078 Unclassified 555
218 Ga0206353_10805921 3300020082 Bacteria 1167
219 Ga0154015_1548442 3300020610 Bacteria 1068
220 Ga0213875_10005863 3300021388 Bacteria 6531
221 Ga0213875_10090165 3300021388 Bacteria 1430
222 Ga0224712_10124129 3300022467 Bacteria 1121
223 Ga0224712_10304780 3300022467 Bacteria 746
224 Ga0224712_10693976 3300022467 Bacteria 501
225 Ga0247553_106684 3300023672 Bacteria 617
226 Ga0207692_11172971 3300025898 Unclassified 510
227 Ga0207642_10362210 3300025899 Bacteria 858
228 Ga0207680_10153773 3300025903 Bacteria 1536
229 Ga0207680_10880344 3300025903 Unclassified 642
230 Ga0207680_10964717 3300025903 Unclassified 611
231 Ga0207685_10150584 3300025905 Bacteria 1052
232 Ga0207699_10239760 3300025906 Bacteria 1245
233 Ga0207645_10725832 3300025907 Unclassified 675
234 Ga0207705_10842194 3300025909 Bacteria 711
235 Ga0207684_10557034 3300025910 Bacteria 980
236 Ga0207654_10582623 3300025911 Unclassified 797
237 Ga0207654_10610334 3300025911 Unclassified 779
238 Ga0207695_10004204 3300025913 Bacteria 19775
239 Ga0207695_10048240 3300025913 Unclassified 4499
240 Ga0207695_10080191 3300025913 Bacteria 3306
241 Ga0207695_10121429 3300025913 Bacteria 2580
242 Ga0207695_10359935 3300025913 Bacteria 1341
243 Ga0207695_10471691 3300025913 Unclassified 1137
244 Ga0207671_10381796 3300025914 Unclassified 1119
245 Ga0207671_10487069 3300025914 Unclassified 983
246 Ga0207671_10949941 3300025914 Unclassified 678
247 Ga0207663_11552401 3300025916 Bacteria 533
248 Ga0207663_11623950 3300025916 Bacteria 520
249 Ga0207663_11738749 3300025916 Bacteria 502
250 Ga0207649_11151032 3300025920 Bacteria 613
251 Ga0207652_10614495 3300025921 Bacteria 974
252 Ga0207694_10220211 3300025924 Bacteria 1548
253 Ga0207694_10265846 3300025924 Bacteria 1406
254 Ga0207694_10393019 3300025924 Bacteria 1152
255 Ga0207650_10300836 3300025925 Bacteria 1310
256 Ga0207650_10738197 3300025925 Bacteria 833
257 Ga0207650_10812698 3300025925 Unclassified 792
258 Ga0207659_10774735 3300025926 Unclassified 824
259 Ga0207687_11813754 3300025927 Unclassified 522
260 Ga0207700_10026648 3300025928 Bacteria 4034
261 Ga0207664_11697014 3300025929 Bacteria 554
262 Ga0207686_10153107 3300025934 Bacteria 1607
263 Ga0207670_10874811 3300025936 Bacteria 752
264 Ga0207670_10995216 3300025936 Unclassified 705
265 Ga0207704_10177974 3300025938 Bacteria 1534
266 Ga0207704_10815594 3300025938 Bacteria 780
267 Ga0207665_10750983 3300025939 Bacteria 769
268 Ga0207665_10843766 3300025939 Unclassified 725
269 Ga0207691_10910878 3300025940 Unclassified 736
270 Ga0207711_10313103 3300025941 Bacteria 1449
271 Ga0207711_10378887 3300025941 Bacteria 1313
272 Ga0207711_10411071 3300025941 Bacteria 1258
273 Ga0207711_10560315 3300025941 Bacteria 1066
274 Ga0207711_10582572 3300025941 Bacteria 1044
275 Ga0207711_10760860 3300025941 Unclassified 903
276 Ga0207661_10324827 3300025944 Bacteria 1384
277 Ga0207661_10491925 3300025944 Bacteria 1120
278 Ga0207667_10026393 3300025949 Bacteria 6348
279 Ga0207667_10407704 3300025949 Bacteria 1384
280 Ga0207667_11066247 3300025949 Bacteria 793
281 Ga0207712_10364013 3300025961 Bacteria 1205
282 Ga0207668_11192171 3300025972 Unclassified 684
283 Ga0207658_11144797 3300025986 Unclassified 711
284 Ga0207677_10841918 3300026023 Unclassified 824
285 Ga0207703_11021613 3300026035 Bacteria 793
286 Ga0207703_11350706 3300026035 Unclassified 685
287 Ga0207639_10448783 3300026041 Bacteria 1170
288 Ga0207639_10679673 3300026041 Unclassified 954
289 Ga0207639_10966859 3300026041 Bacteria 797
290 Ga0207641_10303290 3300026088 Bacteria 1509
291 Ga0207641_11568908 3300026088 Unclassified 660
292 Ga0207648_10520862 3300026089 Unclassified 1089
293 Ga0207676_10568114 3300026095 Unclassified 1086
294 Ga0207676_11722992 3300026095 Bacteria 625
295 Ga0207676_12541798 3300026095 Unclassified 509
296 Ga0207674_11175584 3300026116 Bacteria 737
297 Ga0207674_12072089 3300026116 Bacteria 533
298 Ga0207675_102606230 3300026118 Unclassified 515
299 Ga0207683_11029063 3300026121 Unclassified 764
300 Ga0207698_10370848 3300026142 Unclassified 1359
301 Ga0207698_10419727 3300026142 Bacteria 1283
302 Ga0268266_10200078 3300028379 Bacteria 1828
303 Ga0268266_10619505 3300028379 Bacteria 1040
304 Ga0268266_11619562 3300028379 Bacteria 623
305 Ga0268264_10444432 3300028381 Bacteria 1255
306 Ga0268264_12407172 3300028381 Bacteria 532
307 Ga0265777_104951 3300030877 Bacteria 867
308 Ga0265777_112671 3300030877 Bacteria 637
309 Ga0265777_115614 3300030877 Unclassified 594
310 Ga0265776_106684 3300030880 Unclassified 627
311 Ga0265760_10140877 3300031090 Unclassified 785
312 Ga0265331_10064197 3300031250 Bacteria 1729
313 Ga0265331_10300264 3300031250 Bacteria 719
314 Ga0265316_10032889 3300031344 Bacteria 4230
315 Ga0265316_10138797 3300031344 Bacteria 1827
316 Ga0265316_10164594 3300031344 Unclassified 1657
317 Ga0265316_10337012 3300031344 Bacteria 1093
318 Ga0265316_10711257 3300031344 Bacteria 708
319 Ga0265314_10075628 3300031711 Unclassified 2240
320 Ga0265342_10043166 3300031712 Bacteria 2722
321 Ga0316053_108703 3300032120 Unclassified 689
322 Ga0373926_0194337 3300035083 Unclassified 780
323 Ga0373934_0040952 3300035086 Bacteria 1828
324 Ga0373934_0204846 3300035086 Bacteria 813
325 Ga0373934_0210983 3300035086 Bacteria 800
326 Ga0373923_0571797 3300035111 Unclassified 555
327 Ga0373945_0184812 3300035116 Unclassified 860
328 Ga0373953_0110929 3300035117 Unclassified 1160
329 Ga0373953_0162068 3300035117 Unclassified 961
330 Ga0373953_0297168 3300035117 Unclassified 705
331 Ga0373954_0164406 3300035118 Bacteria 1086
332 Ga0373954_0481998 3300035118 Bacteria 614
333 Ga0373957_0259432 3300035120 Bacteria 732
334 Ga0373943_0247659 3300035170 Unclassified 1000
335 Ga0373955_0071151 3300035172 Bacteria 1945
336 Ga0373955_0487385 3300035172 Bacteria 753
337 Ga0373931_0414524 3300035691 Unclassified 855
338 Ga0373935_0496479 3300035692 Unclassified 886
339 Ga0373935_1074514 3300035692 Unclassified 599
340 Ga0373927_0236450 3300035695 Bacteria 1200
341 Ga0373927_0664168 3300035695 Unclassified 689
342 Ga0373933_0500709 3300035724 Bacteria 796
343 Ga0373933_0659439 3300035724 Bacteria 688
344 Ga0373933_0834179 3300035724 Unclassified 607
345 Ga0373947_0167234 3300035725 Unclassified 1425
346 Ga0373947_0477631 3300035725 Unclassified 846
347 Ga0373947_0750512 3300035725 Bacteria 666
348 Ga0373937_0010018 3300036401 Bacteria 8266
349 Ga0373937_0088628 3300036401 Bacteria 2865
350 Ga0373937_0212137 3300036401 Bacteria 1822
351 Ga0373937_1132752 3300036401 Unclassified 731
352 Ga0373937_1463701 3300036401 Unclassified 631
353 Ga0373937_1499765 3300036401 Unclassified 622
354 Ga0265778_044621 3300036457 Unclassified 596
355 Ga0373925_0147828 3300037068 Bacteria 1843
356 Ga0373925_0241995 3300037068 Bacteria 1445
357 Ga0373925_0455948 3300037068 Unclassified 1047
358 Ga0373925_0475467 3300037068 Bacteria 1025
359 Ga0436364_0833529 3300037853 Bacteria 5918
360 Ga0436364_0882022 3300037853 Bacteria 514
361 Ga0436364_0889381 3300037853 Bacteria 1695
362 Ga0436364_0969537 3300037853 Bacteria 1646
363 Ga0436364_1122609 3300037853 Bacteria 15757
364 Ga0436364_1146049 3300037853 Bacteria 1766
365 Ga0436365_0328405 3300039437 Unclassified 727
366 Ga0436365_0763440 3300039437 Unclassified 2267
367 Ga0451793_1642038 3300041452 Unclassified 604
368 Ga0451853_2036335 3300041512 Bacteria 556
369 Ga0453684_0795702 3300044712 Bacteria 1020
370 Ga0466959_0527860 3300045049 Bacteria 797
371 Ga0451576_0025580 3300045051 Bacteria 6359
372 Ga0451576_0407861 3300045051 Bacteria 1425
373 Ga0451576_0608888 3300045051 Bacteria 1148
374 Ga0451576_0974450 3300045051 Bacteria 889
375 Ga0451576_2265857 3300045051 Bacteria 557
376 Ga0495592_0015864 3300046454 Bacteria 5715
377 Ga0495629_0783773 3300046459 Unclassified 629
378 Ga0495629_0880494 3300046459 Bacteria 588
379 Ga0495651_0021824 3300046462 Bacteria 4978
380 Ga0495651_0412906 3300046462 Unclassified 879
381 Ga0495651_0951697 3300046462 Unclassified 523
382 Ga0495653_0232481 3300046463 Bacteria 1233
383 Ga0495580_0007261 3300046472 Bacteria 8913
384 Ga0495580_0016423 3300046472 Bacteria 5555
385 Ga0495580_0057607 3300046472 Bacteria 2734
386 Ga0495580_0319366 3300046472 Bacteria 1055
387 Ga0495582_0068527 3300046473 Bacteria 1961
388 Ga0495582_0270166 3300046473 Bacteria 976
389 Ga0495639_0140770 3300046475 Bacteria 1160
390 Ga0495639_0171006 3300046475 Bacteria 1055
391 Ga0495639_0625828 3300046475 Bacteria 554
392 Ga0495662_0009664 3300046476 Bacteria 4730
393 Ga0495664_0034259 3300046477 Bacteria 2987
394 Ga0495585_0232168 3300046492 Bacteria 927
395 Ga0495594_0285767 3300046499 Bacteria 940
396 Ga0495608_0118172 3300046511 Bacteria 1701
397 Ga0495608_0244293 3300046511 Bacteria 1121
398 Ga0495628_0120789 3300046516 Bacteria 2010
399 Ga0495628_0386723 3300046516 Bacteria 1024
400 Ga0495630_0046610 3300046517 Bacteria 3240
401 Ga0495630_0338170 3300046517 Bacteria 1152
402 Ga0495644_0372740 3300046523 Bacteria 563
403 Ga0495652_0036027 3300046529 Bacteria 4304
404 Ga0495652_0198003 3300046529 Bacteria 1527
405 Ga0495665_0222458 3300046531 Bacteria 975
406 Ga0495665_0266150 3300046531 Bacteria 881
407 Ga0495665_0312103 3300046531 Bacteria 804
408 Ga0495640_0034991 3300046533 Bacteria 3557
409 Ga0495640_0264849 3300046533 Bacteria 1073
410 Ga0495586_0180174 3300046535 Bacteria 1195
411 Ga0495587_0030877 3300046536 Bacteria 3248
412 Ga0495587_0506885 3300046536 Unclassified 667
413 Ga0495645_0014003 3300046543 Bacteria 5683
414 Ga0495645_0140742 3300046543 Bacteria 1683
415 Ga0495645_0199920 3300046543 Bacteria 1357
416 Ga0495645_0320064 3300046543 Unclassified 1007
417 Ga0495645_0545154 3300046543 Unclassified 719
418 Ga0495633_0394610 3300046558 Unclassified 626
419 Ga0495633_0440071 3300046558 Bacteria 589
420 Ga0495667_0132848 3300046559 Bacteria 1605
421 Ga0495667_0246821 3300046559 Bacteria 1136
422 Ga0495634_0124036 3300046642 Bacteria 1652
423 Ga0495634_0571463 3300046642 Unclassified 658
424 Ga0495635_0043835 3300046663 Bacteria 3086
425 Ga0495635_0375883 3300046663 Unclassified 946
426 Ga0495635_0820388 3300046663 Bacteria 599
427 Ga0495635_0952747 3300046663 Bacteria 548
428 Ga0495657_0155639 3300046675 Bacteria 1417
429 Ga0495657_0171929 3300046675 Bacteria 1334
430 Ga0495657_0353760 3300046675 Bacteria 869
431 Ga0495599_0017430 3300046678 Bacteria 4465
432 Ga0495623_0054486 3300046679 Bacteria 2523
433 Ga0495623_0150388 3300046679 Bacteria 1376
434 Ga0495623_0166067 3300046679 Unclassified 1293
435 Ga0495623_0539186 3300046679 Bacteria 612
436 Ga0495646_0211765 3300046680 Bacteria 1051
437 Ga0495646_0586500 3300046680 Bacteria 567
438 Ga0495646_0659035 3300046680 Unclassified 528
439 Ga0495613_0247039 3300046689 Bacteria 1246
440 Ga0495613_0282175 3300046689 Bacteria 1153
441 Ga0495613_0435248 3300046689 Unclassified 890
442 Ga0495670_0304914 3300046691 Bacteria 854
443 Ga0495670_0421126 3300046691 Bacteria 722
444 Ga0495581_0252334 3300047315 Bacteria 1032
445 Ga0495604_0114341 3300047317 Bacteria 1963
446 Ga0495604_0138082 3300047317 Bacteria 1745
447 Ga0495604_0156256 3300047317 Bacteria 1615
448 Ga0495604_0311447 3300047317 Bacteria 1055
449 Ga0495604_0417623 3300047317 Bacteria 881
450 Ga0495604_0549010 3300047317 Unclassified 745
451 Ga0495636_0377116 3300047318 Unclassified 673
452 Ga0495636_0429051 3300047318 Bacteria 633
453 Ga0495674_0007107 3300047319 Bacteria 10710
454 Ga0495674_0171992 3300047319 Bacteria 1807
455 Ga0495674_0734841 3300047319 Bacteria 772
456 Ga0495674_0770189 3300047319 Bacteria 750
457 Ga0495674_1107673 3300047319 Bacteria 602
458 Ga0495680_0047537 3300047322 Bacteria 3375
459 Ga0495675_0148538 3300047444 Bacteria 1449
460 Ga0495675_0168945 3300047444 Bacteria 1344
461 Ga0495675_0238196 3300047444 Bacteria 1096
462 Ga0495675_0331071 3300047444 Bacteria 899
463 Ga0495675_0569328 3300047444 Bacteria 645
464 Ga0495684_0001149 3300047471 Bacteria 21314
465 Ga0495684_0019311 3300047471 Bacteria 5245
466 Ga0495602_0098864 3300048088 Bacteria 2400
467 Ga0495602_0153568 3300048088 Bacteria 1806
468 Ga0495602_0193117 3300048088 Bacteria 1559
469 Ga0495602_0232526 3300048088 Bacteria 1384
470 Ga0495614_0377777 3300048089 Unclassified 663
471 Ga0496112_0628184 3300048915 Unclassified 1005
472 Ga0496112_0847095 3300048915 Bacteria 838
473 Ga0496113_0859895 3300048916 Bacteria 719
474 Ga0496115_0365644 3300048918 Bacteria 1175
475 Ga0496115_0687907 3300048918 Unclassified 805
476 Ga0501040_1127315 3300049576 Bacteria 569
477 nmdc:mga08y16_919403_c1 3300050511 Unclassified 860
478 nmdc:mga0n895_387938_c1 3300050512 Bacteria 1413
479 nmdc:mga0rr50_552995_c1 3300050513 Bacteria 980
480 nmdc:mga08x19_3162_c1 3300050514 Bacteria 9885
481 Ga0495601_0148530 3300053077 Bacteria 1530
482 Ga0495601_0557155 3300053077 Bacteria 737
483 Ga0495601_0981266 3300053077 Unclassified 532
484 Ga0495619_0335116 3300053085 Bacteria 1047
485 Ga0495619_0668997 3300053085 Bacteria 707
486 Ga0587066_102234 3300059490 Bacteria 653
487 Ga0587070_130317 3300059491 Bacteria 611
488 Ga0587077_205855 3300059493 Unclassified 547
489 Ga0587083_0210112 3300059505 Bacteria 561
490 Ga0587085_058961 3300059506 Bacteria 721
491 Ga0587128_127334 3300059630 Unclassified 560
492 Ga0587114_076623 3300059655 Unclassified 615
493 Ga0587071_158494 3300060344 Unclassified 567
494 Ga0501082_0000159 3300060353 Bacteria 57327
495 Ga0495666_0219485
496 Ga0058863_11296785
497 Ga0058863_11794887
498 Ga0058862_12227188
499 Ga0058862_12622157
500 Ga0065712_10335459
501 Ga0070658_10050231
502 Ga0070676_10718056
503 Ga0070683_100026466
504 Ga0070690_101696276
505 Ga0070670_101226501
506 Ga0070666_10149854
507 Ga0070680_100381351
508 Ga0068868_100400228
509 Ga0068868_100775757
510 Ga0068868_100937419
511 Ga0070660_101636852
512 Ga0070661_101290838
513 Ga0070668_101418527
514 Ga0070675_100676557
515 Ga0070675_101233303
516 Ga0070675_101707020
517 Ga0070671_101213883
518 Ga0070673_100825429
519 Ga0070673_101429946
520 Ga0070688_100185758
521 Ga0070659_101085731
522 Ga0070667_100279754
523 Ga0070667_100427490
524 Ga0070667_101290264
525 Ga0070667_101738158
526 Ga0070709_10132334
527 Ga0070709_10423789
528 Ga0070709_11265174
529 Ga0070714_100289887
530 Ga0070713_100098405
531 Ga0070710_11085119
532 Ga0070711_100291346
533 Ga0070711_100466201
534 Ga0070711_101296537
535 Ga0070708_100090252
536 Ga0070678_100726029
537 Ga0070678_100844827
538 Ga0070685_10283474
539 Ga0070685_10304169
540 Ga0070707_101240401
541 Ga0070698_100678753
542 Ga0070699_101866226
543 Ga0070679_101368175
544 Ga0070679_101614895
545 Ga0070684_100347724
546 Ga0070684_100763728
547 Ga0070684_101211855
548 Ga0070697_100274055
549 Ga0070697_100287658
550 Ga0068853_100734353
551 Ga0070672_101381045
552 Ga0070686_101165765
553 Ga0070695_100622993
554 Ga0070695_101014266
555 Ga0070693_100259166
556 Ga0070665_100232865
557 Ga0070665_100298131
558 Ga0070665_101302210
559 Ga0068855_100036530
560 Ga0068855_100262403
561 Ga0068855_100306424
562 Ga0068855_100569792
563 Ga0068857_101735067
564 Ga0068856_102655822
565 Ga0068852_100548446
566 Ga0068859_100625030
567 Ga0068859_101114775
568 Ga0068864_100233796
569 Ga0068864_100537108
570 Ga0068864_101301754
571 Ga0068864_102030556
572 Ga0068866_10811161
573 Ga0068861_101821649
574 Ga0068861_101834611
575 Ga0068863_100017732
576 Ga0068863_100912954
577 Ga0068863_101239722
578 Ga0068863_102023333
579 Ga0068863_102099355
580 Ga0068858_100112733
581 Ga0068858_100456426
582 Ga0068858_100550244
583 Ga0068858_101766794
584 Ga0068858_102171458
585 Ga0068860_100201457
586 Ga0068860_101757351
587 Ga0068862_100572446
588 Ga0068862_101548127
589 Ga0070717_10195775
590 Ga0070717_10796070
591 Ga0070716_100283139
592 Ga0097621_100218243
593 Ga0097621_101140874
594 Ga0097621_101290675
595 Ga0068871_100628119
596 Ga0068871_101727765
597 Ga0068871_101763277
598 Ga0075434_100538961
599 Ga0075434_101641085
600 Ga0068865_100264026
601 Ga0068865_100392833
602 Ga0075436_100004302
603 Ga0097620_100237447
604 Ga0097620_100625020
605 Ga0097620_101114623
606 Ga0075435_100378267
607 Ga0105240_10004528
608 Ga0105240_10031206
609 Ga0105240_10053774
610 Ga0105240_10101917
611 Ga0105240_10221615
612 Ga0105240_10236265
613 Ga0105240_10382985
614 Ga0111539_10503819
615 Ga0105245_10934674
616 Ga0105245_11515148
617 Ga0105245_11536523
618 Ga0105245_11903815
619 Ga0114129_11611269
620 Ga0105241_10302653
621 Ga0105241_10379222
622 Ga0105241_11079589
623 Ga0105241_11518233
624 Ga0105242_10086073
625 Ga0105242_10568723
626 Ga0105242_11997604
627 Ga0105242_13296382
628 Ga0105248_10260735
629 Ga0105248_10428164
630 Ga0105248_10473638
631 Ga0105248_10537995
632 Ga0105248_10553023
633 Ga0105248_10802215
634 Ga0105248_10809155
635 Ga0105248_11308553
636 Ga0105248_12929998
637 Ga0105237_10028749
638 Ga0105237_11372406
639 Ga0105237_11636612
640 Ga0105237_12146272
641 Ga0105237_12294838
642 Ga0105238_10067585
643 Ga0105238_10176000
644 Ga0105238_10241514
645 Ga0105238_10334981
646 Ga0105238_11381036
647 Ga0105238_11478293
648 Ga0105249_10367881
649 Ga0105249_10438838
650 Ga0105239_10047500
651 Ga0105239_10171132
652 Ga0105239_12585328
653 Ga0105246_10116451
654 Ga0157370_10449263
655 Ga0157370_10683238
656 Ga0157370_10843849
657 Ga0157369_10214447
658 Ga0157369_10339797
659 Ga0157369_10381459
660 Ga0157369_10473503
661 Ga0157369_12182088
662 Ga0157374_10358575
663 Ga0157374_10465127
664 Ga0157374_10593278
665 Ga0157374_10778076
666 Ga0157374_11063805
667 Ga0157374_11267039
668 Ga0157378_10291149
669 Ga0157378_10918032
670 Ga0157378_11170970
671 Ga0157378_11490495
672 Ga0157378_12670583
673 Ga0163162_10885954
674 Ga0163162_11258217
675 Ga0163162_11818977
676 Ga0163162_12347683
677 Ga0163162_12356880
678 Ga0157372_10116891
679 Ga0157372_11508001
680 Ga0157372_12553620
681 Ga0157372_12625018
682 Ga0157375_11373593
683 Ga0157375_12627144
684 Ga0163163_10024835
685 Ga0163163_10134922
686 Ga0163163_10417411
687 Ga0163163_10487664
688 Ga0163163_10520973
689 Ga0163163_11140910
690 Ga0163163_12510676
691 Ga0157377_10761616
692 Ga0157379_10807059
693 Ga0157376_10217278
694 Ga0157376_10436931
695 Ga0157376_10630987
696 Ga0157376_12743097
697 Ga0163161_10520962
698 Ga0184601_135663
699 Ga0184599_132480
700 Ga0184603_115663
701 Ga0197907_10214457
702 Ga0197907_10332616
703 Ga0206356_10431405
704 Ga0206356_11714174
705 Ga0206355_1023940
706 Ga0206355_1067017
707 Ga0206355_1302744
708 Ga0206355_1370304
709 Ga0206352_10017264
710 Ga0206352_10367517
711 Ga0206352_11032326
712 Ga0206353_10805921
713 Ga0154015_1548442
714 Ga0213875_10005863
715 Ga0213875_10090165
716 Ga0224712_10124129
717 Ga0224712_10304780
718 Ga0224712_10693976
719 Ga0247553_106684
720 Ga0207692_11172971
721 Ga0207642_10362210
722 Ga0207680_10153773
723 Ga0207680_10880344
724 Ga0207680_10964717
725 Ga0207685_10150584
726 Ga0207699_10239760
727 Ga0207645_10725832
728 Ga0207705_10842194
729 Ga0207684_10557034
730 Ga0207654_10582623
731 Ga0207654_10610334
732 Ga0207695_10004204
733 Ga0207695_10048240
734 Ga0207695_10080191
735 Ga0207695_10121429
736 Ga0207695_10359935
737 Ga0207695_10471691
738 Ga0207671_10381796
739 Ga0207671_10487069
740 Ga0207671_10949941
741 Ga0207663_11552401
742 Ga0207663_11623950
743 Ga0207663_11738749
744 Ga0207649_11151032
745 Ga0207652_10614495
746 Ga0207694_10220211
747 Ga0207694_10265846
748 Ga0207694_10393019
749 Ga0207650_10300836
750 Ga0207650_10738197
751 Ga0207650_10812698
752 Ga0207659_10774735
753 Ga0207687_11813754
754 Ga0207700_10026648
755 Ga0207664_11697014
756 Ga0207686_10153107
757 Ga0207670_10874811
758 Ga0207670_10995216
759 Ga0207704_10177974
760 Ga0207704_10815594
761 Ga0207665_10750983
762 Ga0207665_10843766
763 Ga0207691_10910878
764 Ga0207711_10313103
765 Ga0207711_10378887
766 Ga0207711_10411071
767 Ga0207711_10560315
768 Ga0207711_10582572
769 Ga0207711_10760860
770 Ga0207661_10324827
771 Ga0207661_10491925
772 Ga0207667_10026393
773 Ga0207667_10407704
774 Ga0207667_11066247
775 Ga0207712_10364013
776 Ga0207668_11192171
777 Ga0207658_11144797
778 Ga0207677_10841918
779 Ga0207703_11021613
780 Ga0207703_11350706
781 Ga0207639_10448783
782 Ga0207639_10679673
783 Ga0207639_10966859
784 Ga0207641_10303290
785 Ga0207641_11568908
786 Ga0207648_10520862
787 Ga0207676_10568114
788 Ga0207676_11722992
789 Ga0207676_12541798
790 Ga0207674_11175584
791 Ga0207674_12072089
792 Ga0207675_102606230
793 Ga0207683_11029063
794 Ga0207698_10370848
795 Ga0207698_10419727
796 Ga0268266_10200078
797 Ga0268266_10619505
798 Ga0268266_11619562
799 Ga0268264_10444432
800 Ga0268264_12407172
801 Ga0265777_104951
802 Ga0265777_112671
803 Ga0265777_115614
804 Ga0265776_106684
805 Ga0265760_10140877
806 Ga0265331_10064197
807 Ga0265331_10300264
808 Ga0265316_10032889
809 Ga0265316_10138797
810 Ga0265316_10164594
811 Ga0265316_10337012
812 Ga0265316_10711257
813 Ga0265314_10075628
814 Ga0265342_10043166
815 Ga0316053_108703
816 Ga0373926_0194337
817 Ga0373934_0040952
818 Ga0373934_0204846
819 Ga0373934_0210983
820 Ga0373923_0571797
821 Ga0373945_0184812
822 Ga0373953_0110929
823 Ga0373953_0162068
824 Ga0373953_0297168
825 Ga0373954_0164406
826 Ga0373954_0481998
827 Ga0373957_0259432
828 Ga0373943_0247659
829 Ga0373955_0071151
830 Ga0373955_0487385
831 Ga0373931_0414524
832 Ga0373935_0496479
833 Ga0373935_1074514
834 Ga0373927_0236450
835 Ga0373927_0664168
836 Ga0373933_0500709
837 Ga0373933_0659439
838 Ga0373933_0834179
839 Ga0373947_0167234
840 Ga0373947_0477631
841 Ga0373947_0750512
842 Ga0373937_0010018
843 Ga0373937_0088628
844 Ga0373937_0212137
845 Ga0373937_1132752
846 Ga0373937_1463701
847 Ga0373937_1499765
848 Ga0265778_044621
849 Ga0373925_0147828
850 Ga0373925_0241995
851 Ga0373925_0455948
852 Ga0373925_0475467
853 Ga0436364_0833529
854 Ga0436364_0882022
855 Ga0436364_0889381
856 Ga0436364_0969537
857 Ga0436364_1122609
858 Ga0436364_1146049
859 Ga0436365_0328405
860 Ga0436365_0763440
861 Ga0451793_1642038
862 Ga0451853_2036335
863 Ga0453684_0795702
864 Ga0466959_0527860
865 Ga0451576_0025580
866 Ga0451576_0407861
867 Ga0451576_0608888
868 Ga0451576_0974450
869 Ga0451576_2265857
870 Ga0495592_0015864
871 Ga0495629_0783773
872 Ga0495629_0880494
873 Ga0495651_0021824
874 Ga0495651_0412906
875 Ga0495651_0951697
876 Ga0495653_0232481
877 Ga0495580_0007261
878 Ga0495580_0016423
879 Ga0495580_0057607
880 Ga0495580_0319366
881 Ga0495582_0068527
882 Ga0495582_0270166
883 Ga0495639_0140770
884 Ga0495639_0171006
885 Ga0495639_0625828
886 Ga0495662_0009664
887 Ga0495664_0034259
888 Ga0495585_0232168
889 Ga0495594_0285767
890 Ga0495608_0118172
891 Ga0495608_0244293
892 Ga0495628_0120789
893 Ga0495628_0386723
894 Ga0495630_0046610
895 Ga0495630_0338170
896 Ga0495644_0372740
897 Ga0495652_0036027
898 Ga0495652_0198003
899 Ga0495665_0222458
900 Ga0495665_0266150
901 Ga0495665_0312103
902 Ga0495640_0034991
903 Ga0495640_0264849
904 Ga0495586_0180174
905 Ga0495587_0030877
906 Ga0495587_0506885
907 Ga0495645_0014003
908 Ga0495645_0140742
909 Ga0495645_0199920
910 Ga0495645_0320064
911 Ga0495645_0545154
912 Ga0495633_0394610
913 Ga0495633_0440071
914 Ga0495667_0132848
915 Ga0495667_0246821
916 Ga0495634_0124036
917 Ga0495634_0571463
918 Ga0495635_0043835
919 Ga0495635_0375883
920 Ga0495635_0820388
921 Ga0495635_0952747
922 Ga0495657_0155639
923 Ga0495657_0171929
924 Ga0495657_0353760
925 Ga0495599_0017430
926 Ga0495623_0054486
927 Ga0495623_0150388
928 Ga0495623_0166067
929 Ga0495623_0539186
930 Ga0495646_0211765
931 Ga0495646_0586500
932 Ga0495646_0659035
933 Ga0495613_0247039
934 Ga0495613_0282175
935 Ga0495613_0435248
936 Ga0495670_0304914
937 Ga0495670_0421126
938 Ga0495581_0252334
939 Ga0495604_0114341
940 Ga0495604_0138082
941 Ga0495604_0156256
942 Ga0495604_0311447
943 Ga0495604_0417623
944 Ga0495604_0549010
945 Ga0495636_0377116
946 Ga0495636_0429051
947 Ga0495674_0007107
948 Ga0495674_0171992
949 Ga0495674_0734841
950 Ga0495674_0770189
951 Ga0495674_1107673
952 Ga0495680_0047537
953 Ga0495675_0148538
954 Ga0495675_0168945
955 Ga0495675_0238196
956 Ga0495675_0331071
957 Ga0495675_0569328
958 Ga0495684_0001149
959 Ga0495684_0019311
960 Ga0495602_0098864
961 Ga0495602_0153568
962 Ga0495602_0193117
963 Ga0495602_0232526
964 Ga0495614_0377777
965 Ga0496112_0628184
966 Ga0496112_0847095
967 Ga0496113_0859895
968 Ga0496115_0365644
969 Ga0496115_0687907
970 Ga0501040_1127315
971 nmdc:mga08y16_919403_c1
972 nmdc:mga0n895_387938_c1
973 nmdc:mga0rr50_552995_c1
974 nmdc:mga08x19_3162_c1
975 Ga0495601_0148530
976 Ga0495601_0557155
977 Ga0495601_0981266
978 Ga0495619_0335116
979 Ga0495619_0668997
980 Ga0587066_102234
981 Ga0587070_130317
982 Ga0587077_205855
983 Ga0587083_0210112
984 Ga0587085_058961
985 Ga0587128_127334
986 Ga0587114_076623
987 Ga0587071_158494
988 Ga0501082_0000159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

19

65

0.89

Map