F454411

General Info

Members Datasets Scaffolds Average Seq Length
493 252 484 186

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10040355|Ga0081539_100403552
Length 205
Sequence MNPAGAAGMYRRASSEGTSIVSVIVIQFITLDGIVSDPDGSAGTPAGGWAFRHGPDTVAGDKFRLGGILDDGVLLLGRTTWQLFSRIWPGRDDPFSARMNAVPKLVASRTLTDTSAWANSRLIDGDLPDAVKQERRDVVIAGSLSVVHTLMSHDLIDEYRLLTFPTVLGAGRRLFPTRATPEHLETLSAEHAGAAVLARYGRAAR

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
4 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
5 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
6 2902582711 Micromonospora sp. AP08 Isolate Unclassified
7 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
8 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.2
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 2.64
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10018684 3300002075 Bacteria 1448
2 JGI25406J46586_10000390 3300003203 Bacteria 20181
3 JGI25404J52841_10033330 3300003659 Bacteria 1098
4 Ga0070683_100000472 3300005329 Bacteria 28295
5 Ga0070680_100116359 3300005336 Bacteria 2228
6 Ga0068868_100091775 3300005338 Bacteria 2447
7 Ga0070692_10319782 3300005345 Bacteria 954
8 Ga0070671_100769203 3300005355 Bacteria 837
9 Ga0070673_100172188 3300005364 Bacteria 1848
10 Ga0070659_100145098 3300005366 Bacteria 1934
11 Ga0070709_10003246 3300005434 Bacteria 8725
12 Ga0070709_10052916 3300005434 Bacteria 2554
13 Ga0070709_10124067 3300005434 Bacteria 1755
14 Ga0070709_10145504 3300005434 Bacteria 1632
15 Ga0070714_100003116 3300005435 Bacteria 12312
16 Ga0070714_100012822 3300005435 Bacteria 6699
17 Ga0070714_100060939 3300005435 Bacteria 3239
18 Ga0070714_100071788 3300005435 Bacteria 2995
19 Ga0070714_100093873 3300005435 Bacteria 2632
20 Ga0070714_100094009 3300005435 Bacteria 2631
21 Ga0070714_100101393 3300005435 Bacteria 2536
22 Ga0070714_100755250 3300005435 Bacteria 940
23 Ga0070714_101191953 3300005435 Bacteria 743
24 Ga0070713_100001856 3300005436 Bacteria 13626
25 Ga0070713_100020597 3300005436 Bacteria 5059
26 Ga0070713_100040424 3300005436 Bacteria 3791
27 Ga0070713_100057796 3300005436 Bacteria 3231
28 Ga0070713_100086195 3300005436 Bacteria 2692
29 Ga0070713_100104757 3300005436 Bacteria 2456
30 Ga0070710_10007483 3300005437 Bacteria 5290
31 Ga0070710_10031731 3300005437 Bacteria 2855
32 Ga0070711_100004237 3300005439 Bacteria 8433
33 Ga0070711_100173903 3300005439 Bacteria 1643
34 Ga0070711_100314310 3300005439 Bacteria 1249
35 Ga0070700_100601292 3300005441 Bacteria 862
36 Ga0070694_100444310 3300005444 Bacteria 1023
37 Ga0070708_100172806 3300005445 Bacteria 2018
38 Ga0070708_100257954 3300005445 Bacteria 1638
39 Ga0070708_100878478 3300005445 Bacteria 842
40 Ga0070663_100525051 3300005455 Bacteria 986
41 Ga0070681_10066528 3300005458 Bacteria 3573
42 Ga0070706_100037337 3300005467 Bacteria 4487
43 Ga0070706_100518584 3300005467 Bacteria 1109
44 Ga0070707_100008251 3300005468 Bacteria 9666
45 Ga0070707_100014698 3300005468 Bacteria 7336
46 Ga0070707_100024717 3300005468 Bacteria 5692
47 Ga0070707_100120026 3300005468 Bacteria 2553
48 Ga0070707_100129331 3300005468 Bacteria 2455
49 Ga0070698_100002427 3300005471 Bacteria 20536
50 Ga0070698_100016597 3300005471 Bacteria 7771
51 Ga0070698_100033363 3300005471 Bacteria 5333
52 Ga0070699_100094511 3300005518 Bacteria 2617
53 Ga0070699_100098638 3300005518 Bacteria 2560
54 Ga0070684_100226977 3300005535 Bacteria 1704
55 Ga0070697_100209839 3300005536 Bacteria 1658
56 Ga0070696_100077043 3300005546 Bacteria 2355
57 Ga0070696_100163400 3300005546 Bacteria 1642
58 Ga0070665_100281019 3300005548 Bacteria 1666
59 Ga0070665_100370119 3300005548 Bacteria 1440
60 Ga0070704_100034029 3300005549 Bacteria 3452
61 Ga0068855_100551045 3300005563 Bacteria 1248
62 Ga0070664_100193583 3300005564 Bacteria 1812
63 Ga0068857_100058814 3300005577 Bacteria 3414
64 Ga0068854_100192020 3300005578 Bacteria 1601
65 Ga0068856_100146924 3300005614 Bacteria 2365
66 Ga0068856_100179742 3300005614 Bacteria 2128
67 Ga0068856_100342009 3300005614 Bacteria 1514
68 Ga0068859_100575859 3300005617 Bacteria 1220
69 Ga0068859_100986376 3300005617 Bacteria 925
70 Ga0068864_100140692 3300005618 Bacteria 2176
71 Ga0068860_100261927 3300005843 Bacteria 1685
72 Ga0068862_100636093 3300005844 Bacteria 1028
73 Ga0081455_10181529 3300005937 Bacteria 1593
74 Ga0081540_1018353 3300005983 Bacteria 4294
75 Ga0081540_1052483 3300005983 Bacteria 2007
76 Ga0081539_10000431 3300005985 Bacteria 89181
77 Ga0081539_10040355 3300005985 Bacteria 2740
78 Ga0070717_10022859 3300006028 Bacteria 4947
79 Ga0070717_10063337 3300006028 Bacteria 3069
80 Ga0070717_10067875 3300006028 Bacteria 2968
81 Ga0070717_10101595 3300006028 Bacteria 2442
82 Ga0070717_10148619 3300006028 Bacteria 2026
83 Ga0075363_100010338 3300006048 Bacteria 4426
84 Ga0070715_10035474 3300006163 Bacteria 2051
85 Ga0070716_100001229 3300006173 Bacteria 11286
86 Ga0070716_100015583 3300006173 Bacteria 3908
87 Ga0070716_100200223 3300006173 Bacteria 1327
88 Ga0070716_100417392 3300006173 Bacteria 969
89 Ga0070716_100797744 3300006173 Bacteria 731
90 Ga0070712_100065320 3300006175 Bacteria 2582
91 Ga0070712_100067654 3300006175 Bacteria 2542
92 Ga0070712_100088523 3300006175 Bacteria 2262
93 Ga0070712_100092258 3300006175 Bacteria 2221
94 Ga0070712_100184610 3300006175 Bacteria 1627
95 Ga0070712_101068103 3300006175 Bacteria 700
96 Ga0097621_100450480 3300006237 Bacteria 1159
97 Ga0097621_100622190 3300006237 Bacteria 988
98 Ga0068871_100047410 3300006358 Bacteria 3465
99 Ga0075433_10962510 3300006852 Bacteria 744
100 Ga0075434_100083035 3300006871 Bacteria 3201
101 Ga0075434_100117974 3300006871 Bacteria 2667
102 Ga0075436_100082734 3300006914 Bacteria 2227
103 Ga0075436_100123284 3300006914 Bacteria 1814
104 Ga0097620_100575854 3300006931 Bacteria 1220
105 Ga0097620_100986388 3300006931 Bacteria 925
106 Ga0075435_100039712 3300007076 Bacteria 3756
107 Ga0075435_100121580 3300007076 Bacteria 2179
108 Ga0075435_100265619 3300007076 Bacteria 1463
109 Ga0099794_10240640 3300007265 Bacteria 932
110 Ga0105240_10627744 3300009093 Bacteria 1180
111 Ga0105240_10813485 3300009093 Unclassified 1011
112 Ga0105247_10348099 3300009101 Bacteria 1041
113 Ga0105247_10487258 3300009101 Bacteria 896
114 Ga0105243_10286765 3300009148 Bacteria 1486
115 Ga0105248_10547197 3300009177 Bacteria 1306
116 Ga0105237_10763560 3300009545 Bacteria 973
117 Ga0105249_11076853 3300009553 Bacteria 874
118 Ga0157338_1003093 3300012515 Bacteria 1354
119 Ga0157373_10233620 3300013100 Bacteria 1299
120 Ga0157370_10197383 3300013104 Bacteria 1867
121 Ga0157369_10018601 3300013105 Bacteria 7788
122 Ga0157369_10336999 3300013105 Bacteria 1567
123 Ga0157369_10396706 3300013105 Bacteria 1431
124 Ga0157369_11542365 3300013105 Bacteria 676
125 Ga0157378_10182258 3300013297 Bacteria 1976
126 Ga0163162_10507435 3300013306 Bacteria 1336
127 Ga0157372_10112456 3300013307 Bacteria 3120
128 Ga0157372_10350571 3300013307 Bacteria 1720
129 Ga0157375_10376150 3300013308 Bacteria 1587
130 Ga0163163_11066542 3300014325 Bacteria 871
131 Ga0157380_10278345 3300014326 Bacteria 1529
132 Ga0182008_10002839 3300014497 Bacteria 10713
133 Ga0157376_10341974 3300014969 Bacteria 1429
134 Ga0157376_11333847 3300014969 Bacteria 748
135 Ga0182007_10002995 3300015262 Bacteria 8177
136 Ga0182005_1018608 3300015265 Bacteria 1920
137 Ga0163161_10184367 3300017792 Bacteria 1602
138 Ga0206354_10446002 3300020081 Bacteria 953
139 Ga0213875_10001497 3300021388 Bacteria 15016
140 Ga0213875_10014330 3300021388 Bacteria 3869
141 Ga0213875_10089861 3300021388 Bacteria 1433
142 Ga0224572_1004942 3300024225 Bacteria 2355
143 Ga0228598_1032415 3300024227 Bacteria 1030
144 Ga0207653_10026252 3300025885 Bacteria 1867
145 Ga0207692_10005900 3300025898 Bacteria 4939
146 Ga0207692_10006103 3300025898 Bacteria 4876
147 Ga0207692_10058398 3300025898 Bacteria 1987
148 Ga0207692_10090109 3300025898 Bacteria 1661
149 Ga0207692_10341846 3300025898 Bacteria 921
150 Ga0207680_10104786 3300025903 Bacteria 1823
151 Ga0207647_10009567 3300025904 Bacteria 6878
152 Ga0207647_10268125 3300025904 Bacteria 976
153 Ga0207685_10074140 3300025905 Bacteria 1389
154 Ga0207685_10118432 3300025905 Bacteria 1158
155 Ga0207699_10000884 3300025906 Bacteria 14307
156 Ga0207699_10009287 3300025906 Bacteria 4889
157 Ga0207699_10037826 3300025906 Bacteria 2761
158 Ga0207699_10152784 3300025906 Bacteria 1529
159 Ga0207699_10266982 3300025906 Bacteria 1185
160 Ga0207705_10290068 3300025909 Unclassified 1253
161 Ga0207684_10061257 3300025910 Bacteria 3196
162 Ga0207684_10309119 3300025910 Bacteria 1363
163 Ga0207684_10453648 3300025910 Bacteria 1101
164 Ga0207654_10420283 3300025911 Bacteria 933
165 Ga0207707_10358202 3300025912 Bacteria 1256
166 Ga0207695_10321050 3300025913 Bacteria 1438
167 Ga0207671_10227768 3300025914 Bacteria 1462
168 Ga0207693_10045670 3300025915 Bacteria 3442
169 Ga0207693_10063653 3300025915 Bacteria 2889
170 Ga0207693_10074759 3300025915 Bacteria 2653
171 Ga0207693_10078098 3300025915 Bacteria 2591
172 Ga0207693_10192721 3300025915 Unclassified 1604
173 Ga0207693_10255283 3300025915 Bacteria 1375
174 Ga0207663_10043313 3300025916 Bacteria 2755
175 Ga0207663_10124370 3300025916 Bacteria 1771
176 Ga0207663_10157844 3300025916 Bacteria 1598
177 Ga0207663_10172727 3300025916 Bacteria 1537
178 Ga0207663_11006834 3300025916 Bacteria 668
179 Ga0207657_10066132 3300025919 Bacteria 3078
180 Ga0207649_10131203 3300025920 Bacteria 1702
181 Ga0207646_10040260 3300025922 Bacteria 4203
182 Ga0207646_10089932 3300025922 Bacteria 2748
183 Ga0207646_10509538 3300025922 Bacteria 1084
184 Ga0207700_10008396 3300025928 Bacteria 6396
185 Ga0207700_10034725 3300025928 Bacteria 3623
186 Ga0207700_10039534 3300025928 Bacteria 3435
187 Ga0207700_10056569 3300025928 Bacteria 2953
188 Ga0207700_10062208 3300025928 Bacteria 2834
189 Ga0207700_10198286 3300025928 Bacteria 1690
190 Ga0207700_10511017 3300025928 Bacteria 1064
191 Ga0207700_10734316 3300025928 Bacteria 882
192 Ga0207664_10004550 3300025929 Bacteria 9400
193 Ga0207664_10011522 3300025929 Bacteria 6291
194 Ga0207664_10013293 3300025929 Bacteria 5904
195 Ga0207664_10023556 3300025929 Bacteria 4615
196 Ga0207664_10024017 3300025929 Bacteria 4576
197 Ga0207664_10033894 3300025929 Bacteria 3929
198 Ga0207664_10057395 3300025929 Bacteria 3094
199 Ga0207664_10107070 3300025929 Bacteria 2319
200 Ga0207664_10124499 3300025929 Bacteria 2162
201 Ga0207664_10447019 3300025929 Bacteria 1153
202 Ga0207709_10134178 3300025935 Bacteria 1692
203 Ga0207704_10820467 3300025938 Bacteria 778
204 Ga0207665_10004358 3300025939 Bacteria 9402
205 Ga0207665_10015904 3300025939 Bacteria 4939
206 Ga0207665_10035485 3300025939 Bacteria 3310
207 Ga0207665_10107644 3300025939 Bacteria 1955
208 Ga0207665_10746446 3300025939 Bacteria 771
209 Ga0207665_10807282 3300025939 Bacteria 741
210 Ga0207691_10134116 3300025940 Bacteria 2186
211 Ga0207711_10399231 3300025941 Bacteria 1277
212 Ga0207689_10108710 3300025942 Bacteria 2279
213 Ga0207661_10001717 3300025944 Bacteria 14982
214 Ga0207679_10214807 3300025945 Bacteria 1615
215 Ga0207712_11039267 3300025961 Bacteria 728
216 Ga0207640_10504151 3300025981 Bacteria 1008
217 Ga0207703_10343017 3300026035 Bacteria 1373
218 Ga0207678_10028196 3300026067 Bacteria 4903
219 Ga0207678_10103022 3300026067 Bacteria 2436
220 Ga0207708_10534878 3300026075 Bacteria 986
221 Ga0207702_10131051 3300026078 Bacteria 2256
222 Ga0207702_10297299 3300026078 Bacteria 1531
223 Ga0207702_10489235 3300026078 Bacteria 1198
224 Ga0207676_10326169 3300026095 Bacteria 1411
225 Ga0207674_10165769 3300026116 Bacteria 2164
226 Ga0207675_100722472 3300026118 Bacteria 1006
227 Ga0207683_10040968 3300026121 Bacteria 4043
228 Ga0268265_10139496 3300028380 Bacteria 2028
229 Ga0268264_10579416 3300028381 Bacteria 1104
230 Ga0265338_10001818 3300028800 Bacteria 33491
231 Ga0265338_10016347 3300028800 Bacteria 8081
232 Ga0307511_10000091 3300030521 Bacteria 76296
233 Ga0307512_10004693 3300030522 Bacteria 14801
234 Ga0307509_10127492 3300031507 Unclassified 2508
235 Ga0307508_10019560 3300031616 Bacteria 6152
236 Ga0307518_10221110 3300031838 Bacteria 1236
237 Ga0307415_100853431 3300032126 Bacteria 836
238 Ga0307507_10043419 3300033179 Bacteria 4461
239 Ga0373948_0012908 3300034817 Bacteria 1500
240 Ga0373950_0045491 3300034818 Bacteria 850
241 Ga0373926_0009473 3300035083 Bacteria 3254
242 Ga0373926_0167969 3300035083 Bacteria 839
243 Ga0373934_0003755 3300035086 Bacteria 5585
244 Ga0373934_0071301 3300035086 Bacteria 1390
245 Ga0373934_0134235 3300035086 Bacteria 1010
246 Ga0373940_0061248 3300035088 Bacteria 1077
247 Ga0373944_0055057 3300035089 Bacteria 1263
248 Ga0373944_0342642 3300035089 Bacteria 567
249 Ga0373923_0010275 3300035111 Bacteria 3400
250 Ga0373932_0052460 3300035112 Bacteria 1215
251 Ga0373936_0004715 3300035113 Bacteria 5151
252 Ga0373936_0150969 3300035113 Bacteria 1007
253 Ga0373941_0080297 3300035115 Bacteria 1100
254 Ga0373945_0000254 3300035116 Bacteria 14906
255 Ga0373953_0032707 3300035117 Bacteria 2030
256 Ga0373954_0046042 3300035118 Bacteria 2038
257 Ga0373956_0050448 3300035119 Bacteria 1868
258 Ga0373956_0262949 3300035119 Bacteria 820
259 Ga0373957_0005272 3300035120 Bacteria 4001
260 Ga0373957_0035190 3300035120 Bacteria 1859
261 Ga0373960_0154214 3300035121 Bacteria 787
262 Ga0373943_0008576 3300035170 Bacteria 4581
263 Ga0373943_0397027 3300035170 Bacteria 796
264 Ga0373946_0022827 3300035171 Bacteria 2439
265 Ga0373946_0210776 3300035171 Bacteria 934
266 Ga0373955_0002045 3300035172 Bacteria 8678
267 Ga0373955_0324447 3300035172 Bacteria 930
268 Ga0373955_0567739 3300035172 Bacteria 694
269 Ga0373962_0025897 3300035242 Bacteria 1577
270 Ga0373962_0234153 3300035242 Bacteria 633
271 Ga0373924_0001098 3300035410 Bacteria 8636
272 Ga0373924_0026928 3300035410 Bacteria 2283
273 Ga0373924_0027912 3300035410 Bacteria 2247
274 Ga0373935_0032250 3300035692 Bacteria 3254
275 Ga0373935_0149135 3300035692 Bacteria 1585
276 Ga0373933_0019346 3300035724 Bacteria 3845
277 Ga0373933_0137065 3300035724 Bacteria 1542
278 Ga0373933_0268767 3300035724 Bacteria 1100
279 Ga0373933_0404630 3300035724 Bacteria 890
280 Ga0373947_0009452 3300035725 Bacteria 5599
281 Ga0373937_0004466 3300036401 Bacteria 11884
282 Ga0373937_0009186 3300036401 Bacteria 8581
283 Ga0373937_0304561 3300036401 Bacteria 1506
284 Ga0373937_0519877 3300036401 Bacteria 1131
285 Ga0373937_0717943 3300036401 Bacteria 946
286 Ga0373937_1270018 3300036401 Bacteria 684
287 Ga0373925_0025579 3300037068 Bacteria 4313
288 Ga0373925_0031345 3300037068 Bacteria 3906
289 Ga0373925_0194753 3300037068 Bacteria 1609
290 Ga0373925_0243605 3300037068 Bacteria 1440
291 Ga0395899_0035055 3300037312 Bacteria 3768
292 Ga0395900_0051252 3300037418 Bacteria 4252
293 Ga0395898_0045792 3300037466 Bacteria 4299
294 Ga0395898_0369702 3300037466 Unclassified 1367
295 Ga0395905_0088640 3300037471 Bacteria 2900
296 Ga0436364_0600139 3300037853 Bacteria 5202
297 Ga0436364_0985210 3300037853 Bacteria 5562
298 Ga0436364_1156752 3300037853 Bacteria 3785
299 Ga0436364_1165846 3300037853 Bacteria 1109
300 Ga0436364_1290057 3300037853 Bacteria 1997
301 Ga0436364_1318244 3300037853 Bacteria 60856
302 Ga0395901_0420088 3300038443 Bacteria 1371
303 Ga0436362_1265052 3300039453 Bacteria 732
304 Ga0451853_0596437 3300041512 Bacteria 1222
305 Ga0466972_0368606 3300044658 Unclassified 672
306 Ga0466963_0047133 3300044694 Bacteria 2844
307 Ga0466968_0335398 3300044735 Bacteria 732
308 Ga0466957_0518173 3300044842 Bacteria 828
309 Ga0466967_0636212 3300045976 Bacteria 1054
310 Ga0466967_0821235 3300045976 Bacteria 923
311 Ga0466967_1143399 3300045976 Bacteria 776
312 Ga0495592_0034171 3300046454 Bacteria 3833
313 Ga0495592_0062350 3300046454 Bacteria 2737
314 Ga0495592_0123439 3300046454 Bacteria 1819
315 Ga0495603_0066232 3300046455 Bacteria 2127
316 Ga0495603_0432077 3300046455 Unclassified 754
317 Ga0495629_0003564 3300046459 Bacteria 11761
318 Ga0495629_0051215 3300046459 Bacteria 2890
319 Ga0495629_0193602 3300046459 Bacteria 1407
320 Ga0495638_0065884 3300046460 Bacteria 2228
321 Ga0495641_0004974 3300046461 Bacteria 9184
322 Ga0495641_0014683 3300046461 Bacteria 4227
323 Ga0495651_0002326 3300046462 Bacteria 14669
324 Ga0495651_0016317 3300046462 Bacteria 5751
325 Ga0495651_0073135 3300046462 Bacteria 2603
326 Ga0495651_0148208 3300046462 Bacteria 1694
327 Ga0495653_0018867 3300046463 Bacteria 5596
328 Ga0495653_0030192 3300046463 Bacteria 4319
329 Ga0495653_0075334 3300046463 Bacteria 2511
330 Ga0495653_0105887 3300046463 Bacteria 2029
331 Ga0495580_0004793 3300046472 Bacteria 11328
332 Ga0495580_0340555 3300046472 Bacteria 1017
333 Ga0495582_0001436 3300046473 Bacteria 13433
334 Ga0495582_0108393 3300046473 Bacteria 1559
335 Ga0495605_0194646 3300046474 Bacteria 886
336 Ga0495639_0000402 3300046475 Bacteria 20524
337 Ga0495662_0008618 3300046476 Bacteria 5010
338 Ga0495662_0203902 3300046476 Bacteria 975
339 Ga0495664_0002285 3300046477 Bacteria 10270
340 Ga0495664_0017444 3300046477 Bacteria 4104
341 Ga0495664_0187604 3300046477 Bacteria 1253
342 Ga0495664_0238792 3300046477 Bacteria 1099
343 Ga0495664_0331392 3300046477 Bacteria 917
344 Ga0495585_0075244 3300046492 Bacteria 1836
345 Ga0495594_0001951 3300046499 Bacteria 10762
346 Ga0495608_0008537 3300046511 Bacteria 7174
347 Ga0495608_0034175 3300046511 Bacteria 3433
348 Ga0495608_0042990 3300046511 Bacteria 3020
349 Ga0495608_0445391 3300046511 Unclassified 788
350 Ga0495618_0001484 3300046514 Bacteria 15746
351 Ga0495618_0034640 3300046514 Bacteria 3167
352 Ga0495618_0304047 3300046514 Bacteria 991
353 Ga0495628_0010393 3300046516 Bacteria 7909
354 Ga0495628_0033335 3300046516 Bacteria 4152
355 Ga0495628_0042731 3300046516 Bacteria 3613
356 Ga0495628_0205112 3300046516 Bacteria 1484
357 Ga0495628_0693986 3300046516 Bacteria 719
358 Ga0495630_0004912 3300046517 Bacteria 9395
359 Ga0495630_0118961 3300046517 Bacteria 2004
360 Ga0495666_0023129 3300046526 Bacteria 3074
361 Ga0495652_0011848 3300046529 Bacteria 7881
362 Ga0495652_0013055 3300046529 Bacteria 7486
363 Ga0495652_0040601 3300046529 Bacteria 4021
364 Ga0495652_0113470 3300046529 Bacteria 2175
365 Ga0495652_0206576 3300046529 Bacteria 1487
366 Ga0495665_0001242 3300046531 Bacteria 13592
367 Ga0495640_0082590 3300046533 Bacteria 2133
368 Ga0495640_0100217 3300046533 Bacteria 1902
369 Ga0495640_0136947 3300046533 Bacteria 1580
370 Ga0495586_0008412 3300046535 Bacteria 5490
371 Ga0495587_0004256 3300046536 Bacteria 9461
372 Ga0495587_0015291 3300046536 Bacteria 4794
373 Ga0495587_0023973 3300046536 Bacteria 3744
374 Ga0495645_0053936 3300046543 Bacteria 2921
375 Ga0495645_0054089 3300046543 Bacteria 2917
376 Ga0495645_0064574 3300046543 Bacteria 2648
377 Ga0495667_0001987 3300046559 Bacteria 13548
378 Ga0495667_0004154 3300046559 Bacteria 9740
379 Ga0495667_0020300 3300046559 Bacteria 4484
380 Ga0495667_0047400 3300046559 Bacteria 2840
381 Ga0495667_0118019 3300046559 Bacteria 1713
382 Ga0495634_0029049 3300046642 Bacteria 3831
383 Ga0495634_0490184 3300046642 Bacteria 721
384 Ga0495611_0022878 3300046648 Bacteria 2707
385 Ga0495635_0010440 3300046663 Bacteria 6496
386 Ga0495635_0029514 3300046663 Unclassified 3814
387 Ga0495635_0043438 3300046663 Bacteria 3101
388 Ga0495657_0000601 3300046675 Bacteria 32938
389 Ga0495657_0002719 3300046675 Bacteria 14760
390 Ga0495657_0032522 3300046675 Bacteria 3638
391 Ga0495657_0063860 3300046675 Bacteria 2427
392 Ga0495657_0239201 3300046675 Bacteria 1096
393 Ga0495599_0028364 3300046678 Bacteria 3508
394 Ga0495599_0036502 3300046678 Bacteria 3087
395 Ga0495599_0083271 3300046678 Bacteria 1998
396 Ga0495599_0161529 3300046678 Bacteria 1384
397 Ga0495623_0107274 3300046679 Bacteria 1696
398 Ga0495623_0145244 3300046679 Bacteria 1407
399 Ga0495623_0159799 3300046679 Bacteria 1325
400 Ga0495646_0037505 3300046680 Bacteria 2997
401 Ga0495646_0075148 3300046680 Bacteria 1981
402 Ga0495646_0184710 3300046680 Bacteria 1142
403 Ga0495647_0024914 3300046681 Bacteria 2181
404 Ga0495658_0002687 3300046683 Bacteria 8951
405 Ga0495613_0001023 3300046689 Bacteria 21297
406 Ga0495613_0087439 3300046689 Bacteria 2259
407 Ga0495613_0118919 3300046689 Bacteria 1898
408 Ga0495613_0244799 3300046689 Bacteria 1253
409 Ga0495624_0034682 3300046690 Bacteria 3262
410 Ga0495589_0071352 3300046794 Bacteria 1697
411 Ga0495600_0001561 3300046809 Bacteria 12745
412 Ga0495600_0065726 3300046809 Bacteria 2371
413 Ga0495600_0078401 3300046809 Bacteria 2157
414 Ga0495600_0472140 3300046809 Unclassified 774
415 Ga0495581_0062295 3300047315 Bacteria 2155
416 Ga0495581_0063160 3300047315 Bacteria 2139
417 Ga0495604_0002830 3300047317 Bacteria 13923
418 Ga0495604_0006668 3300047317 Bacteria 9150
419 Ga0495604_0051676 3300047317 Bacteria 3184
420 Ga0495636_0056342 3300047318 Bacteria 1655
421 Ga0495674_0025659 3300047319 Bacteria 5399
422 Ga0495674_0076761 3300047319 Bacteria 2873
423 Ga0495674_0080996 3300047319 Bacteria 2785
424 Ga0495674_0134055 3300047319 Bacteria 2085
425 Ga0495674_0140964 3300047319 Bacteria 2026
426 Ga0495674_0707199 3300047319 Bacteria 790
427 Ga0495676_0001517 3300047321 Bacteria 20088
428 Ga0495680_0003765 3300047322 Bacteria 14752
429 Ga0495680_0007733 3300047322 Bacteria 9816
430 Ga0495680_0109768 3300047322 Bacteria 2045
431 Ga0495680_0342463 3300047322 Bacteria 1042
432 Ga0495683_0060555 3300047323 Bacteria 1876
433 Ga0495687_062048 3300047443 Bacteria 1536
434 Ga0495675_0039462 3300047444 Bacteria 3006
435 Ga0495675_0057067 3300047444 Bacteria 2475
436 Ga0495675_0089009 3300047444 Bacteria 1939
437 Ga0495684_0003423 3300047471 Bacteria 12435
438 Ga0495684_0003471 3300047471 Bacteria 12335
439 Ga0495684_0098584 3300047471 Bacteria 2209
440 Ga0495684_0166331 3300047471 Bacteria 1642
441 Ga0495593_0002037 3300047673 Bacteria 12051
442 Ga0495593_0134984 3300047673 Bacteria 1251
443 Ga0495602_0027678 3300048088 Bacteria 5443
444 Ga0495602_0047598 3300048088 Bacteria 3862
445 Ga0495602_0049058 3300048088 Bacteria 3785
446 Ga0495602_0111094 3300048088 Bacteria 2226
447 Ga0496100_0383908 3300048903 Bacteria 1067
448 Ga0496101_0047713 3300048904 Bacteria 3076
449 Ga0496102_0173227 3300048905 Bacteria 2031
450 Ga0496104_0066884 3300048907 Bacteria 3413
451 Ga0496106_0160005 3300048909 Bacteria 1781
452 Ga0496108_0037114 3300048911 Bacteria 4057
453 Ga0496108_0823865 3300048911 Bacteria 800
454 Ga0496110_0014870 3300048913 Bacteria 6467
455 Ga0496111_0167645 3300048914 Bacteria 1631
456 Ga0496112_0091795 3300048915 Bacteria 3005
457 Ga0496112_0388967 3300048915 Bacteria 1335
458 Ga0496113_0031477 3300048916 Bacteria 3850
459 Ga0496114_0030640 3300048917 Bacteria 4427
460 Ga0501034_0583270 3300049571 Bacteria 1025
461 Ga0501042_0046884 3300049578 Bacteria 3081
462 Ga0501044_0374514 3300049823 Bacteria 1340
463 Ga0501044_0415391 3300049823 Bacteria 1256
464 nmdc:mga03n38_5824_c1 3300050490 Bacteria 4233
465 nmdc:mga07m45_177289_c1 3300050496 Bacteria 1239
466 nmdc:mga0n895_205038_c1 3300050512 Bacteria 2002
467 nmdc:mga0rr50_681241_c1 3300050513 Unclassified 877
468 nmdc:mga0rr50_743235_c1 3300050513 Bacteria 837
469 nmdc:mga08x19_175152_c1 3300050514 Bacteria 1462
470 nmdc:mga08x19_318920_c1 3300050514 Unclassified 1081
471 nmdc:mga08x19_46779_c1 3300050514 Bacteria 2768
472 nmdc:mga0a205_746400_c1 3300050515 Bacteria 827
473 nmdc:mga0a205_813758_c1 3300050515 Bacteria 782
474 Ga0495601_0026612 3300053077 Bacteria 3572
475 Ga0495601_0033297 3300053077 Bacteria 3211
476 Ga0495601_0319803 3300053077 Bacteria 1010
477 Ga0495595_0016140 3300053084 Bacteria 3190
478 Ga0495595_0234548 3300053084 Bacteria 917
479 Ga0495619_0003369 3300053085 Bacteria 10333
480 Ga0495619_0072391 3300053085 Bacteria 2308
481 Ga0495619_0291725 3300053085 Bacteria 1130
482 Ga0500646_0004261 3300053090 Bacteria 3625
483 Ga0500641_0250905 3300053096 Bacteria 742
484 Ga0500588_0001855 3300053146 Bacteria 4130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030521 Ga0307511_10000091 Ga0307511_1000009120 153
2 3300035089 Ga0373944_0342642 Ga0373944_0342642_42_557 169
3 3300036401 Ga0373937_0717943 Ga0373937_0717943_407_922 169
4 3300036401 Ga0373937_1270018 Ga0373937_1270018_77_652 171
5 3300038443 Ga0395901_0420088 Ga0395901_0420088_842_1357 171
6 3300035410 Ga0373924_0027912 Ga0373924_0027912_165_683 172
7 3300005467 Ga0070706_100037337 Ga0070706_1000373373 177
8 3300025910 Ga0207684_10061257 Ga0207684_100612573 177
9 3300025922 Ga0207646_10040260 Ga0207646_100402603 177
10 3300005548 Ga0070665_100370119 Ga0070665_1003701191 178
11 iso_pu_bacteria 2870782633 2870787574 178
12 3300003203 JGI25406J46586_10000390 JGI25406J46586_1000039012 179
13 3300005435 Ga0070714_100101393 Ga0070714_1001013932 179
14 3300005985 Ga0081539_10000431 Ga0081539_1000043128 179
15 3300009093 Ga0105240_10813485 Ga0105240_108134852 179
16 3300009101 Ga0105247_10348099 Ga0105247_103480992 179
17 3300025909 Ga0207705_10290068 Ga0207705_102900682 179
18 3300025939 Ga0207665_10746446 Ga0207665_107464461 179
19 3300046517 Ga0495630_0118961 Ga0495630_0118961_1407_1946 179
20 3300048915 Ga0496112_0388967 Ga0496112_0388967_54_593 179
21 3300007076 Ga0075435_100121580 Ga0075435_1001215801 180
22 3300050513 nmdc:mga0rr50_681241_c1 nmdc:mga0rr50_681241_c1_175_750 180
23 iso_pu_bacteria 2547132424 2548695144 180
24 iso_pu_bacteria 2582581314 2585321356 181
25 iso_pu_bacteria 2784746768 2785373592 181
26 iso_pu_bacteria 2895442618 2895443173 181
27 iso_pu_bacteria 2902582711 2902585421 181
28 iso_pu_bacteria 2917736166 2917737106 181
29 iso_pu_bacteria 2954701450 2954711429 181
30 iso_pu_bacteria 8053945823 8053948856 181
31 3300005435 Ga0070714_100094009 Ga0070714_1000940092 182
32 3300005455 Ga0070663_100525051 Ga0070663_1005250511 182
33 3300013105 Ga0157369_11542365 Ga0157369_115423651 182
34 3300013307 Ga0157372_10350571 Ga0157372_103505712 182
35 3300014969 Ga0157376_11333847 Ga0157376_113338471 182
36 3300021388 Ga0213875_10014330 Ga0213875_100143304 182
37 3300025922 Ga0207646_10509538 Ga0207646_105095382 182
38 3300037853 Ga0436364_1156752 Ga0436364_1156752_636_1184 182
39 3300044735 Ga0466968_0335398 Ga0466968_0335398_93_641 182
40 3300048911 Ga0496108_0823865 Ga0496108_0823865_211_762 182
41 3300003659 JGI25404J52841_10033330 JGI25404J52841_100333302 183
42 3300005336 Ga0070680_100116359 Ga0070680_1001163594 183
43 3300005338 Ga0068868_100091775 Ga0068868_1000917752 183
44 3300005345 Ga0070692_10319782 Ga0070692_103197821 183
45 3300005355 Ga0070671_100769203 Ga0070671_1007692032 183
46 3300005364 Ga0070673_100172188 Ga0070673_1001721882 183
47 3300005366 Ga0070659_100145098 Ga0070659_1001450984 183
48 3300005434 Ga0070709_10052916 Ga0070709_100529162 183
49 3300005434 Ga0070709_10124067 Ga0070709_101240672 183
50 3300005435 Ga0070714_100071788 Ga0070714_1000717882 183
51 3300005435 Ga0070714_100093873 Ga0070714_1000938733 183
52 3300005435 Ga0070714_101191953 Ga0070714_1011919531 183
53 3300005436 Ga0070713_100057796 Ga0070713_1000577963 183
54 3300005441 Ga0070700_100601292 Ga0070700_1006012922 183
55 3300005444 Ga0070694_100444310 Ga0070694_1004443101 183
56 3300005535 Ga0070684_100226977 Ga0070684_1002269773 183
57 3300005546 Ga0070696_100163400 Ga0070696_1001634002 183
58 3300005548 Ga0070665_100281019 Ga0070665_1002810191 183
59 3300005578 Ga0068854_100192020 Ga0068854_1001920202 183
60 3300005614 Ga0068856_100146924 Ga0068856_1001469243 183
61 3300005614 Ga0068856_100342009 Ga0068856_1003420092 183
62 3300005617 Ga0068859_100575859 Ga0068859_1005758592 183
63 3300005618 Ga0068864_100140692 Ga0068864_1001406923 183
64 3300005843 Ga0068860_100261927 Ga0068860_1002619271 183
65 3300005844 Ga0068862_100636093 Ga0068862_1006360932 183
66 3300005983 Ga0081540_1018353 Ga0081540_10183536 183
67 3300006163 Ga0070715_10035474 Ga0070715_100354742 183
68 3300006173 Ga0070716_100015583 Ga0070716_1000155833 183
69 3300006173 Ga0070716_100797744 Ga0070716_1007977441 183
70 3300006175 Ga0070712_100065320 Ga0070712_1000653203 183
71 3300006175 Ga0070712_100088523 Ga0070712_1000885232 183
72 3300006175 Ga0070712_100092258 Ga0070712_1000922581 183
73 3300006237 Ga0097621_100450480 Ga0097621_1004504802 183
74 3300006237 Ga0097621_100622190 Ga0097621_1006221902 183
75 3300006358 Ga0068871_100047410 Ga0068871_1000474103 183
76 3300006852 Ga0075433_10962510 Ga0075433_109625101 183
77 3300006914 Ga0075436_100082734 Ga0075436_1000827342 183
78 3300006931 Ga0097620_100575854 Ga0097620_1005758542 183
79 3300007076 Ga0075435_100265619 Ga0075435_1002656192 183
80 3300009093 Ga0105240_10627744 Ga0105240_106277442 183
81 3300009101 Ga0105247_10487258 Ga0105247_104872582 183
82 3300009148 Ga0105243_10286765 Ga0105243_102867652 183
83 3300009177 Ga0105248_10547197 Ga0105248_105471971 183
84 3300009545 Ga0105237_10763560 Ga0105237_107635602 183
85 3300009553 Ga0105249_11076853 Ga0105249_110768531 183
86 3300012515 Ga0157338_1003093 Ga0157338_10030932 183
87 3300013100 Ga0157373_10233620 Ga0157373_102336202 183
88 3300013104 Ga0157370_10197383 Ga0157370_101973831 183
89 3300013105 Ga0157369_10018601 Ga0157369_100186016 183
90 3300013105 Ga0157369_10336999 Ga0157369_103369992 183
91 3300013105 Ga0157369_10396706 Ga0157369_103967062 183
92 3300013297 Ga0157378_10182258 Ga0157378_101822581 183
93 3300013306 Ga0163162_10507435 Ga0163162_105074352 183
94 3300013308 Ga0157375_10376150 Ga0157375_103761501 183
95 3300014325 Ga0163163_11066542 Ga0163163_110665422 183
96 3300014326 Ga0157380_10278345 Ga0157380_102783452 183
97 3300014969 Ga0157376_10341974 Ga0157376_103419742 183
98 3300017792 Ga0163161_10184367 Ga0163161_101843672 183
99 3300020081 Ga0206354_10446002 Ga0206354_104460021 183
100 3300024225 Ga0224572_1004942 Ga0224572_10049422 183
101 3300024227 Ga0228598_1032415 Ga0228598_10324151 183
102 3300025885 Ga0207653_10026252 Ga0207653_100262522 183
103 3300025898 Ga0207692_10058398 Ga0207692_100583982 183
104 3300025898 Ga0207692_10341846 Ga0207692_103418462 183
105 3300025903 Ga0207680_10104786 Ga0207680_101047862 183
106 3300025904 Ga0207647_10268125 Ga0207647_102681251 183
107 3300025905 Ga0207685_10118432 Ga0207685_101184321 183
108 3300025906 Ga0207699_10037826 Ga0207699_100378263 183
109 3300025906 Ga0207699_10152784 Ga0207699_101527842 183
110 3300025911 Ga0207654_10420283 Ga0207654_104202832 183
111 3300025913 Ga0207695_10321050 Ga0207695_103210502 183
112 3300025914 Ga0207671_10227768 Ga0207671_102277682 183
113 3300025915 Ga0207693_10063653 Ga0207693_100636533 183
114 3300025915 Ga0207693_10078098 Ga0207693_100780982 183
115 3300025915 Ga0207693_10192721 Ga0207693_101927211 183
116 3300025916 Ga0207663_10043313 Ga0207663_100433135 183
117 3300025916 Ga0207663_11006834 Ga0207663_110068341 183
118 3300025919 Ga0207657_10066132 Ga0207657_100661323 183
119 3300025920 Ga0207649_10131203 Ga0207649_101312032 183
120 3300025928 Ga0207700_10039534 Ga0207700_100395344 183
121 3300025928 Ga0207700_10056569 Ga0207700_100565694 183
122 3300025928 Ga0207700_10511017 Ga0207700_105110172 183
123 3300025929 Ga0207664_10011522 Ga0207664_100115224 183
124 3300025929 Ga0207664_10023556 Ga0207664_100235562 183
125 3300025929 Ga0207664_10033894 Ga0207664_100338943 183
126 3300025929 Ga0207664_10057395 Ga0207664_100573952 183
127 3300025935 Ga0207709_10134178 Ga0207709_101341782 183
128 3300025938 Ga0207704_10820467 Ga0207704_108204672 183
129 3300025939 Ga0207665_10015904 Ga0207665_100159044 183
130 3300025939 Ga0207665_10035485 Ga0207665_100354856 183
131 3300025939 Ga0207665_10807282 Ga0207665_108072822 183
132 3300025940 Ga0207691_10134116 Ga0207691_101341162 183
133 3300025941 Ga0207711_10399231 Ga0207711_103992312 183
134 3300025942 Ga0207689_10108710 Ga0207689_101087102 183
135 3300025961 Ga0207712_11039267 Ga0207712_110392671 183
136 3300025981 Ga0207640_10504151 Ga0207640_105041512 183
137 3300026067 Ga0207678_10028196 Ga0207678_100281962 183
138 3300026075 Ga0207708_10534878 Ga0207708_105348782 183
139 3300026078 Ga0207702_10297299 Ga0207702_102972992 183
140 3300026078 Ga0207702_10489235 Ga0207702_104892352 183
141 3300026095 Ga0207676_10326169 Ga0207676_103261692 183
142 3300026116 Ga0207674_10165769 Ga0207674_101657692 183
143 3300026118 Ga0207675_100722472 Ga0207675_1007224721 183
144 3300026121 Ga0207683_10040968 Ga0207683_100409687 183
145 3300028380 Ga0268265_10139496 Ga0268265_101394962 183
146 3300028381 Ga0268264_10579416 Ga0268264_105794162 183
147 3300028800 Ga0265338_10001818 Ga0265338_100018184 183
148 3300028800 Ga0265338_10016347 Ga0265338_1001634710 183
149 3300034818 Ga0373950_0045491 Ga0373950_0045491_105_665 183
150 3300035083 Ga0373926_0009473 Ga0373926_0009473_1338_1898 183
151 3300035086 Ga0373934_0003755 Ga0373934_0003755_3822_4382 183
152 3300035088 Ga0373940_0061248 Ga0373940_0061248_133_693 183
153 3300035111 Ga0373923_0010275 Ga0373923_0010275_1722_2282 183
154 3300035112 Ga0373932_0052460 Ga0373932_0052460_555_1115 183
155 3300035113 Ga0373936_0004715 Ga0373936_0004715_3794_4354 183
156 3300035116 Ga0373945_0000254 Ga0373945_0000254_3726_4286 183
157 3300035117 Ga0373953_0032707 Ga0373953_0032707_1020_1580 183
158 3300035118 Ga0373954_0046042 Ga0373954_0046042_23_583 183
159 3300035119 Ga0373956_0050448 Ga0373956_0050448_210_770 183
160 3300035120 Ga0373957_0005272 Ga0373957_0005272_1211_1771 183
161 3300035121 Ga0373960_0154214 Ga0373960_0154214_179_739 183
162 3300035170 Ga0373943_0008576 Ga0373943_0008576_2885_3445 183
163 3300035171 Ga0373946_0022827 Ga0373946_0022827_1670_2230 183
164 3300035172 Ga0373955_0002045 Ga0373955_0002045_69_629 183
165 3300035172 Ga0373955_0567739 Ga0373955_0567739_117_677 183
166 3300035242 Ga0373962_0234153 Ga0373962_0234153_22_582 183
167 3300035410 Ga0373924_0001098 Ga0373924_0001098_1719_2279 183
168 3300035692 Ga0373935_0032250 Ga0373935_0032250_1757_2317 183
169 3300035724 Ga0373933_0137065 Ga0373933_0137065_923_1483 183
170 3300035724 Ga0373933_0268767 Ga0373933_0268767_207_776 183
171 3300035725 Ga0373947_0009452 Ga0373947_0009452_4242_4802 183
172 3300036401 Ga0373937_0004466 Ga0373937_0004466_2885_3445 183
173 3300036401 Ga0373937_0304561 Ga0373937_0304561_680_1240 183
174 3300036401 Ga0373937_0519877 Ga0373937_0519877_139_708 183
175 3300037068 Ga0373925_0243605 Ga0373925_0243605_798_1358 183
176 3300037466 Ga0395898_0369702 Ga0395898_0369702_207_770 183
177 3300037853 Ga0436364_1290057 Ga0436364_1290057_720_1301 183
178 3300041512 Ga0451853_0596437 Ga0451853_0596437_106_675 183
179 3300046454 Ga0495592_0123439 Ga0495592_0123439_913_1473 183
180 3300046455 Ga0495603_0066232 Ga0495603_0066232_201_761 183
181 3300046455 Ga0495603_0432077 Ga0495603_0432077_85_687 183
182 3300046459 Ga0495629_0003564 Ga0495629_0003564_938_1498 183
183 3300046461 Ga0495641_0004974 Ga0495641_0004974_1473_2033 183
184 3300046462 Ga0495651_0073135 Ga0495651_0073135_705_1274 183
185 3300046462 Ga0495651_0148208 Ga0495651_0148208_924_1484 183
186 3300046463 Ga0495653_0030192 Ga0495653_0030192_3737_4297 183
187 3300046463 Ga0495653_0075334 Ga0495653_0075334_798_1358 183
188 3300046472 Ga0495580_0004793 Ga0495580_0004793_8012_8572 183
189 3300046473 Ga0495582_0001436 Ga0495582_0001436_11936_12496 183
190 3300046475 Ga0495639_0000402 Ga0495639_0000402_11931_12491 183
191 3300046476 Ga0495662_0008618 Ga0495662_0008618_1693_2253 183
192 3300046477 Ga0495664_0002285 Ga0495664_0002285_7999_8559 183
193 3300046477 Ga0495664_0331392 Ga0495664_0331392_148_708 183
194 3300046499 Ga0495594_0001951 Ga0495594_0001951_3830_4390 183
195 3300046511 Ga0495608_0034175 Ga0495608_0034175_798_1358 183
196 3300046511 Ga0495608_0445391 Ga0495608_0445391_121_690 183
197 3300046514 Ga0495618_0001484 Ga0495618_0001484_7152_7712 183
198 3300046516 Ga0495628_0042731 Ga0495628_0042731_2138_2698 183
199 3300046516 Ga0495628_0693986 Ga0495628_0693986_144_704 183
200 3300046517 Ga0495630_0004912 Ga0495630_0004912_1684_2244 183
201 3300046526 Ga0495666_0023129 Ga0495666_0023129_2041_2601 183
202 3300046529 Ga0495652_0011848 Ga0495652_0011848_24_584 183
203 3300046529 Ga0495652_0113470 Ga0495652_0113470_1592_2152 183
204 3300046529 Ga0495652_0206576 Ga0495652_0206576_738_1307 183
205 3300046531 Ga0495665_0001242 Ga0495665_0001242_1666_2226 183
206 3300046533 Ga0495640_0136947 Ga0495640_0136947_938_1498 183
207 3300046535 Ga0495586_0008412 Ga0495586_0008412_1300_1860 183
208 3300046536 Ga0495587_0004256 Ga0495587_0004256_7982_8542 183
209 3300046543 Ga0495645_0064574 Ga0495645_0064574_625_1185 183
210 3300046559 Ga0495667_0004154 Ga0495667_0004154_8027_8587 183
211 3300046559 Ga0495667_0020300 Ga0495667_0020300_234_794 183
212 3300046559 Ga0495667_0047400 Ga0495667_0047400_724_1293 183
213 3300046642 Ga0495634_0029049 Ga0495634_0029049_1840_2400 183
214 3300046663 Ga0495635_0010440 Ga0495635_0010440_5726_6286 183
215 3300046663 Ga0495635_0029514 Ga0495635_0029514_45_614 183
216 3300046675 Ga0495657_0002719 Ga0495657_0002719_9886_10446 183
217 3300046675 Ga0495657_0063860 Ga0495657_0063860_579_1148 183
218 3300046678 Ga0495599_0083271 Ga0495599_0083271_410_970 183
219 3300046678 Ga0495599_0161529 Ga0495599_0161529_27_587 183
220 3300046679 Ga0495623_0107274 Ga0495623_0107274_51_611 183
221 3300046680 Ga0495646_0075148 Ga0495646_0075148_624_1184 183
222 3300046681 Ga0495647_0024914 Ga0495647_0024914_1515_2075 183
223 3300046683 Ga0495658_0002687 Ga0495658_0002687_365_925 183
224 3300046689 Ga0495613_0001023 Ga0495613_0001023_12277_12837 183
225 3300046690 Ga0495624_0034682 Ga0495624_0034682_2165_2725 183
226 3300046809 Ga0495600_0065726 Ga0495600_0065726_1601_2161 183
227 3300047315 Ga0495581_0063160 Ga0495581_0063160_1497_2057 183
228 3300047317 Ga0495604_0006668 Ga0495604_0006668_7494_8054 183
229 3300047319 Ga0495674_0025659 Ga0495674_0025659_247_816 183
230 3300047319 Ga0495674_0080996 Ga0495674_0080996_1288_1848 183
231 3300047319 Ga0495674_0140964 Ga0495674_0140964_88_648 183
232 3300047321 Ga0495676_0001517 Ga0495676_0001517_11655_12215 183
233 3300047322 Ga0495680_0003765 Ga0495680_0003765_8050_8610 183
234 3300047322 Ga0495680_0109768 Ga0495680_0109768_1052_1621 183
235 3300047322 Ga0495680_0342463 Ga0495680_0342463_100_660 183
236 3300047444 Ga0495675_0039462 Ga0495675_0039462_1200_1760 183
237 3300047471 Ga0495684_0003423 Ga0495684_0003423_8991_9551 183
238 3300047471 Ga0495684_0166331 Ga0495684_0166331_695_1264 183
239 3300047673 Ga0495593_0002037 Ga0495593_0002037_8007_8567 183
240 3300048088 Ga0495602_0049058 Ga0495602_0049058_142_702 183
241 3300048088 Ga0495602_0111094 Ga0495602_0111094_23_583 183
242 3300048904 Ga0496101_0047713 Ga0496101_0047713_1851_2411 183
243 3300048905 Ga0496102_0173227 Ga0496102_0173227_677_1237 183
244 3300048909 Ga0496106_0160005 Ga0496106_0160005_1184_1744 183
245 3300048911 Ga0496108_0037114 Ga0496108_0037114_488_1048 183
246 3300048913 Ga0496110_0014870 Ga0496110_0014870_2027_2587 183
247 3300048914 Ga0496111_0167645 Ga0496111_0167645_197_757 183
248 3300048915 Ga0496112_0091795 Ga0496112_0091795_184_744 183
249 3300048916 Ga0496113_0031477 Ga0496113_0031477_2840_3400 183
250 3300048917 Ga0496114_0030640 Ga0496114_0030640_2231_2791 183
251 3300049578 Ga0501042_0046884 Ga0501042_0046884_1215_1775 183
252 3300049823 Ga0501044_0374514 Ga0501044_0374514_377_931 183
253 3300050512 nmdc:mga0n895_205038_c1 nmdc:mga0n895_205038_c1_983_1534 183
254 3300050513 nmdc:mga0rr50_743235_c1 nmdc:mga0rr50_743235_c1_166_717 183
255 3300050514 nmdc:mga08x19_175152_c1 nmdc:mga08x19_175152_c1_812_1363 183
256 3300050515 nmdc:mga0a205_813758_c1 nmdc:mga0a205_813758_c1_137_697 183
257 3300053077 Ga0495601_0026612 Ga0495601_0026612_1776_2336 183
258 3300053084 Ga0495595_0234548 Ga0495595_0234548_26_586 183
259 3300053085 Ga0495619_0003369 Ga0495619_0003369_1756_2316 183
260 3300053085 Ga0495619_0291725 Ga0495619_0291725_448_1017 183
261 3300005434 Ga0070709_10003246 Ga0070709_100032464 184
262 3300005434 Ga0070709_10145504 Ga0070709_101455042 184
263 3300005435 Ga0070714_100003116 Ga0070714_1000031161 184
264 3300005435 Ga0070714_100012822 Ga0070714_1000128223 184
265 3300005435 Ga0070714_100060939 Ga0070714_1000609394 184
266 3300005436 Ga0070713_100001856 Ga0070713_1000018564 184
267 3300005436 Ga0070713_100020597 Ga0070713_1000205978 184
268 3300005436 Ga0070713_100040424 Ga0070713_1000404243 184
269 3300005437 Ga0070710_10031731 Ga0070710_100317313 184
270 3300005439 Ga0070711_100004237 Ga0070711_1000042371 184
271 3300005439 Ga0070711_100173903 Ga0070711_1001739031 184
272 3300005445 Ga0070708_100257954 Ga0070708_1002579541 184
273 3300005467 Ga0070706_100518584 Ga0070706_1005185841 184
274 3300005468 Ga0070707_100014698 Ga0070707_1000146983 184
275 3300005468 Ga0070707_100024717 Ga0070707_1000247177 184
276 3300005471 Ga0070698_100033363 Ga0070698_1000333631 184
277 3300005536 Ga0070697_100209839 Ga0070697_1002098392 184
278 3300006028 Ga0070717_10022859 Ga0070717_100228593 184
279 3300006028 Ga0070717_10063337 Ga0070717_100633374 184
280 3300006173 Ga0070716_100200223 Ga0070716_1002002232 184
281 3300006871 Ga0075434_100117974 Ga0075434_1001179743 184
282 3300021388 Ga0213875_10001497 Ga0213875_1000149710 184
283 3300025898 Ga0207692_10005900 Ga0207692_100059004 184
284 3300025906 Ga0207699_10000884 Ga0207699_100008843 184
285 3300025910 Ga0207684_10453648 Ga0207684_104536482 184
286 3300025915 Ga0207693_10045670 Ga0207693_100456703 184
287 3300025916 Ga0207663_10124370 Ga0207663_101243703 184
288 3300025928 Ga0207700_10008396 Ga0207700_100083965 184
289 3300025928 Ga0207700_10034725 Ga0207700_100347254 184
290 3300025928 Ga0207700_10734316 Ga0207700_107343161 184
291 3300025929 Ga0207664_10013293 Ga0207664_100132935 184
292 3300025929 Ga0207664_10124499 Ga0207664_101244993 184
293 3300025929 Ga0207664_10447019 Ga0207664_104470191 184
294 3300025939 Ga0207665_10107644 Ga0207665_101076443 184
295 3300026035 Ga0207703_10343017 Ga0207703_103430171 184
296 3300031838 Ga0307518_10221110 Ga0307518_102211102 184
297 3300033179 Ga0307507_10043419 Ga0307507_100434194 184
298 3300037853 Ga0436364_1318244 Ga0436364_1318244_26888_27457 184
299 3300045976 Ga0466967_1143399 Ga0466967_1143399_143_718 184
300 3300046477 Ga0495664_0238792 Ga0495664_0238792_263_817 184
301 3300046516 Ga0495628_0205112 Ga0495628_0205112_552_1133 184
302 3300046675 Ga0495657_0239201 Ga0495657_0239201_216_776 184
303 3300050514 nmdc:mga08x19_318920_c1 nmdc:mga08x19_318920_c1_201_773 184
304 3300002075 JGI24738J21930_10018684 JGI24738J21930_100186842 185
305 3300005329 Ga0070683_100000472 Ga0070683_10000047224 185
306 3300005435 Ga0070714_100755250 Ga0070714_1007552503 185
307 3300005436 Ga0070713_100086195 Ga0070713_1000861953 185
308 3300005436 Ga0070713_100104757 Ga0070713_1001047574 185
309 3300005437 Ga0070710_10007483 Ga0070710_100074833 185
310 3300005439 Ga0070711_100314310 Ga0070711_1003143104 185
311 3300005445 Ga0070708_100172806 Ga0070708_1001728062 185
312 3300005445 Ga0070708_100878478 Ga0070708_1008784781 185
313 3300005458 Ga0070681_10066528 Ga0070681_100665284 185
314 3300005468 Ga0070707_100008251 Ga0070707_1000082515 185
315 3300005468 Ga0070707_100120026 Ga0070707_1001200262 185
316 3300005468 Ga0070707_100129331 Ga0070707_1001293312 185
317 3300005471 Ga0070698_100002427 Ga0070698_1000024275 185
318 3300005471 Ga0070698_100016597 Ga0070698_1000165978 185
319 3300005518 Ga0070699_100094511 Ga0070699_1000945113 185
320 3300005518 Ga0070699_100098638 Ga0070699_1000986382 185
321 3300005546 Ga0070696_100077043 Ga0070696_1000770432 185
322 3300005549 Ga0070704_100034029 Ga0070704_1000340293 185
323 3300005563 Ga0068855_100551045 Ga0068855_1005510452 185
324 3300005564 Ga0070664_100193583 Ga0070664_1001935832 185
325 3300005577 Ga0068857_100058814 Ga0068857_1000588144 185
326 3300005614 Ga0068856_100179742 Ga0068856_1001797423 185
327 3300005617 Ga0068859_100986376 Ga0068859_1009863762 185
328 3300005937 Ga0081455_10181529 Ga0081455_101815292 185
329 3300005983 Ga0081540_1052483 Ga0081540_10524832 185
330 3300005985 Ga0081539_10040355 Ga0081539_100403552 185
331 3300006028 Ga0070717_10067875 Ga0070717_100678753 185
332 3300006028 Ga0070717_10101595 Ga0070717_101015951 185
333 3300006028 Ga0070717_10148619 Ga0070717_101486192 185
334 3300006048 Ga0075363_100010338 Ga0075363_1000103384 185
335 3300006173 Ga0070716_100001229 Ga0070716_1000012293 185
336 3300006173 Ga0070716_100417392 Ga0070716_1004173922 185
337 3300006175 Ga0070712_100067654 Ga0070712_1000676542 185
338 3300006175 Ga0070712_100184610 Ga0070712_1001846102 185
339 3300006175 Ga0070712_101068103 Ga0070712_1010681032 185
340 3300006871 Ga0075434_100083035 Ga0075434_1000830354 185
341 3300006914 Ga0075436_100123284 Ga0075436_1001232842 185
342 3300006931 Ga0097620_100986388 Ga0097620_1009863882 185
343 3300007076 Ga0075435_100039712 Ga0075435_1000397123 185
344 3300007265 Ga0099794_10240640 Ga0099794_102406401 185
345 3300013307 Ga0157372_10112456 Ga0157372_101124565 185
346 3300014497 Ga0182008_10002839 Ga0182008_1000283915 185
347 3300015262 Ga0182007_10002995 Ga0182007_100029954 185
348 3300015265 Ga0182005_1018608 Ga0182005_10186081 185
349 3300021388 Ga0213875_10089861 Ga0213875_100898612 185
350 3300025898 Ga0207692_10006103 Ga0207692_100061035 185
351 3300025898 Ga0207692_10090109 Ga0207692_100901093 185
352 3300025904 Ga0207647_10009567 Ga0207647_100095678 185
353 3300025905 Ga0207685_10074140 Ga0207685_100741402 185
354 3300025906 Ga0207699_10009287 Ga0207699_100092875 185
355 3300025906 Ga0207699_10266982 Ga0207699_102669822 185
356 3300025910 Ga0207684_10309119 Ga0207684_103091191 185
357 3300025912 Ga0207707_10358202 Ga0207707_103582022 185
358 3300025915 Ga0207693_10074759 Ga0207693_100747593 185
359 3300025915 Ga0207693_10255283 Ga0207693_102552832 185
360 3300025916 Ga0207663_10157844 Ga0207663_101578442 185
361 3300025916 Ga0207663_10172727 Ga0207663_101727272 185
362 3300025922 Ga0207646_10089932 Ga0207646_100899322 185
363 3300025928 Ga0207700_10062208 Ga0207700_100622083 185
364 3300025928 Ga0207700_10198286 Ga0207700_101982864 185
365 3300025929 Ga0207664_10004550 Ga0207664_100045508 185
366 3300025929 Ga0207664_10024017 Ga0207664_100240172 185
367 3300025929 Ga0207664_10107070 Ga0207664_101070702 185
368 3300025939 Ga0207665_10004358 Ga0207665_100043583 185
369 3300025944 Ga0207661_10001717 Ga0207661_100017173 185
370 3300025945 Ga0207679_10214807 Ga0207679_102148072 185
371 3300026067 Ga0207678_10103022 Ga0207678_101030221 185
372 3300026078 Ga0207702_10131051 Ga0207702_101310512 185
373 3300030522 Ga0307512_10004693 Ga0307512_100046937 185
374 3300031507 Ga0307509_10127492 Ga0307509_101274922 185
375 3300031616 Ga0307508_10019560 Ga0307508_100195607 185
376 3300032126 Ga0307415_100853431 Ga0307415_1008534311 185
377 3300034817 Ga0373948_0012908 Ga0373948_0012908_174_731 185
378 3300035083 Ga0373926_0167969 Ga0373926_0167969_204_764 185
379 3300035086 Ga0373934_0071301 Ga0373934_0071301_649_1206 185
380 3300035086 Ga0373934_0134235 Ga0373934_0134235_390_947 185
381 3300035089 Ga0373944_0055057 Ga0373944_0055057_24_581 185
382 3300035113 Ga0373936_0150969 Ga0373936_0150969_35_619 185
383 3300035115 Ga0373941_0080297 Ga0373941_0080297_530_1087 185
384 3300035119 Ga0373956_0262949 Ga0373956_0262949_11_568 185
385 3300035120 Ga0373957_0035190 Ga0373957_0035190_473_1030 185
386 3300035170 Ga0373943_0397027 Ga0373943_0397027_104_667 185
387 3300035171 Ga0373946_0210776 Ga0373946_0210776_327_887 185
388 3300035172 Ga0373955_0324447 Ga0373955_0324447_257_814 185
389 3300035242 Ga0373962_0025897 Ga0373962_0025897_572_1129 185
390 3300035410 Ga0373924_0026928 Ga0373924_0026928_1269_1826 185
391 3300035692 Ga0373935_0149135 Ga0373935_0149135_850_1407 185
392 3300035724 Ga0373933_0019346 Ga0373933_0019346_787_1344 185
393 3300035724 Ga0373933_0404630 Ga0373933_0404630_206_772 185
394 3300036401 Ga0373937_0009186 Ga0373937_0009186_3972_4529 185
395 3300037068 Ga0373925_0025579 Ga0373925_0025579_2076_2633 185
396 3300037068 Ga0373925_0031345 Ga0373925_0031345_723_1280 185
397 3300037068 Ga0373925_0194753 Ga0373925_0194753_524_1081 185
398 3300037312 Ga0395899_0035055 Ga0395899_0035055_730_1287 185
399 3300037418 Ga0395900_0051252 Ga0395900_0051252_504_1061 185
400 3300037466 Ga0395898_0045792 Ga0395898_0045792_1765_2322 185
401 3300037471 Ga0395905_0088640 Ga0395905_0088640_704_1261 185
402 3300037853 Ga0436364_0600139 Ga0436364_0600139_1738_2295 185
403 3300037853 Ga0436364_0985210 Ga0436364_0985210_3926_4483 185
404 3300037853 Ga0436364_1165846 Ga0436364_1165846_497_1063 185
405 3300039453 Ga0436362_1265052 Ga0436362_1265052_45_602 185
406 3300044658 Ga0466972_0368606 Ga0466972_0368606_13_579 185
407 3300044694 Ga0466963_0047133 Ga0466963_0047133_789_1355 185
408 3300044842 Ga0466957_0518173 Ga0466957_0518173_76_633 185
409 3300045976 Ga0466967_0636212 Ga0466967_0636212_217_792 185
410 3300045976 Ga0466967_0821235 Ga0466967_0821235_110_676 185
411 3300046454 Ga0495592_0034171 Ga0495592_0034171_559_1116 185
412 3300046454 Ga0495592_0062350 Ga0495592_0062350_1188_1745 185
413 3300046459 Ga0495629_0051215 Ga0495629_0051215_1660_2217 185
414 3300046459 Ga0495629_0193602 Ga0495629_0193602_528_1085 185
415 3300046460 Ga0495638_0065884 Ga0495638_0065884_184_741 185
416 3300046461 Ga0495641_0014683 Ga0495641_0014683_2939_3496 185
417 3300046462 Ga0495651_0002326 Ga0495651_0002326_12675_13232 185
418 3300046462 Ga0495651_0016317 Ga0495651_0016317_1727_2284 185
419 3300046463 Ga0495653_0018867 Ga0495653_0018867_1290_1847 185
420 3300046463 Ga0495653_0105887 Ga0495653_0105887_802_1359 185
421 3300046472 Ga0495580_0340555 Ga0495580_0340555_350_907 185
422 3300046473 Ga0495582_0108393 Ga0495582_0108393_337_894 185
423 3300046474 Ga0495605_0194646 Ga0495605_0194646_123_680 185
424 3300046476 Ga0495662_0203902 Ga0495662_0203902_210_767 185
425 3300046477 Ga0495664_0017444 Ga0495664_0017444_1607_2164 185
426 3300046477 Ga0495664_0187604 Ga0495664_0187604_228_785 185
427 3300046492 Ga0495585_0075244 Ga0495585_0075244_1142_1699 185
428 3300046511 Ga0495608_0008537 Ga0495608_0008537_4330_4887 185
429 3300046511 Ga0495608_0042990 Ga0495608_0042990_1526_2083 185
430 3300046514 Ga0495618_0034640 Ga0495618_0034640_393_950 185
431 3300046514 Ga0495618_0304047 Ga0495618_0304047_122_679 185
432 3300046516 Ga0495628_0010393 Ga0495628_0010393_6164_6721 185
433 3300046516 Ga0495628_0033335 Ga0495628_0033335_2182_2739 185
434 3300046529 Ga0495652_0013055 Ga0495652_0013055_1953_2510 185
435 3300046529 Ga0495652_0040601 Ga0495652_0040601_1422_1979 185
436 3300046533 Ga0495640_0082590 Ga0495640_0082590_1377_1943 185
437 3300046533 Ga0495640_0100217 Ga0495640_0100217_792_1349 185
438 3300046536 Ga0495587_0015291 Ga0495587_0015291_1381_1938 185
439 3300046536 Ga0495587_0023973 Ga0495587_0023973_2044_2601 185
440 3300046543 Ga0495645_0053936 Ga0495645_0053936_1567_2124 185
441 3300046543 Ga0495645_0054089 Ga0495645_0054089_390_947 185
442 3300046559 Ga0495667_0001987 Ga0495667_0001987_11477_12034 185
443 3300046559 Ga0495667_0118019 Ga0495667_0118019_51_608 185
444 3300046642 Ga0495634_0490184 Ga0495634_0490184_16_573 185
445 3300046648 Ga0495611_0022878 Ga0495611_0022878_1099_1656 185
446 3300046663 Ga0495635_0043438 Ga0495635_0043438_546_1103 185
447 3300046675 Ga0495657_0000601 Ga0495657_0000601_20849_21406 185
448 3300046675 Ga0495657_0032522 Ga0495657_0032522_1313_1870 185
449 3300046678 Ga0495599_0028364 Ga0495599_0028364_505_1062 185
450 3300046678 Ga0495599_0036502 Ga0495599_0036502_1725_2282 185
451 3300046679 Ga0495623_0145244 Ga0495623_0145244_673_1230 185
452 3300046679 Ga0495623_0159799 Ga0495623_0159799_501_1058 185
453 3300046680 Ga0495646_0037505 Ga0495646_0037505_1726_2283 185
454 3300046680 Ga0495646_0184710 Ga0495646_0184710_91_648 185
455 3300046689 Ga0495613_0087439 Ga0495613_0087439_390_953 185
456 3300046689 Ga0495613_0118919 Ga0495613_0118919_624_1181 185
457 3300046689 Ga0495613_0244799 Ga0495613_0244799_206_763 185
458 3300046794 Ga0495589_0071352 Ga0495589_0071352_619_1176 185
459 3300046809 Ga0495600_0001561 Ga0495600_0001561_188_745 185
460 3300046809 Ga0495600_0078401 Ga0495600_0078401_255_812 185
461 3300046809 Ga0495600_0472140 Ga0495600_0472140_13_579 185
462 3300047315 Ga0495581_0062295 Ga0495581_0062295_1199_1756 185
463 3300047317 Ga0495604_0002830 Ga0495604_0002830_13012_13569 185
464 3300047317 Ga0495604_0051676 Ga0495604_0051676_1009_1566 185
465 3300047318 Ga0495636_0056342 Ga0495636_0056342_571_1128 185
466 3300047319 Ga0495674_0076761 Ga0495674_0076761_1508_2065 185
467 3300047319 Ga0495674_0134055 Ga0495674_0134055_259_816 185
468 3300047319 Ga0495674_0707199 Ga0495674_0707199_191_748 185
469 3300047322 Ga0495680_0007733 Ga0495680_0007733_6944_7501 185
470 3300047323 Ga0495683_0060555 Ga0495683_0060555_1038_1595 185
471 3300047443 Ga0495687_062048 Ga0495687_062048_935_1492 185
472 3300047444 Ga0495675_0057067 Ga0495675_0057067_757_1314 185
473 3300047444 Ga0495675_0089009 Ga0495675_0089009_880_1437 185
474 3300047471 Ga0495684_0003471 Ga0495684_0003471_237_794 185
475 3300047471 Ga0495684_0098584 Ga0495684_0098584_231_788 185
476 3300047673 Ga0495593_0134984 Ga0495593_0134984_469_1026 185
477 3300048088 Ga0495602_0027678 Ga0495602_0027678_828_1385 185
478 3300048088 Ga0495602_0047598 Ga0495602_0047598_2722_3279 185
479 3300048903 Ga0496100_0383908 Ga0496100_0383908_264_821 185
480 3300048907 Ga0496104_0066884 Ga0496104_0066884_2279_2836 185
481 3300049571 Ga0501034_0583270 Ga0501034_0583270_407_964 185
482 3300049823 Ga0501044_0415391 Ga0501044_0415391_69_626 185
483 3300050490 nmdc:mga03n38_5824_c1 nmdc:mga03n38_5824_c1_3198_3761 185
484 3300050496 nmdc:mga07m45_177289_c1 nmdc:mga07m45_177289_c1_149_712 185
485 3300050514 nmdc:mga08x19_46779_c1 nmdc:mga08x19_46779_c1_817_1419 185
486 3300050515 nmdc:mga0a205_746400_c1 nmdc:mga0a205_746400_c1_42_644 185
487 3300053077 Ga0495601_0033297 Ga0495601_0033297_256_813 185
488 3300053077 Ga0495601_0319803 Ga0495601_0319803_86_649 185
489 3300053084 Ga0495595_0016140 Ga0495595_0016140_2456_3013 185
490 3300053085 Ga0495619_0072391 Ga0495619_0072391_153_710 185
491 3300053090 Ga0500646_0004261 Ga0500646_0004261_2815_3372 185
492 3300053096 Ga0500641_0250905 Ga0500641_0250905_160_717 185
493 3300053146 Ga0500588_0001855 Ga0500588_0001855_304_861 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

21

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z80-assembly1.cif.gz_L stimulatory human gtp cyclohydrolase i - gfrp complex 0.7839 164 182
5jbl-assembly1.cif.gz_B structure of the bacteriophage t4 capsid assembly protease, gp21. 0.7464 164 185
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.746 1 182
2z7q-assembly1.cif.gz_A crystal structure of the n-terminal kinase domain of human rsk-1 bound to amp-pcp 0.74 159 181
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7396 2 183
ID Description Score Start End Superfamily
af_A4HZB4_16_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7839 164 181 3.30.200.20
af_Q960A2_1124_1417_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7554 164 181 1.10.510.10
af_Q86C56_1_188_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.7516 162 181 3.90.1520.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.746 1 182 3.40.430.10
af_Q9UTQ4_42_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7448 162 183 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2P9I524-F1-model_v4 deleted 0.9539 1 184
AF-A0A2P9I524-F1-model_v4 deleted 0.9439 1 184
AF-A0A3R9DPQ7-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9323 1 182 GO:0008703
GO:0009231
AF-A0A101J8U6-F1-model_v4 Riboflavin biosynthesis protein RibD 0.932 2 183 GO:0008703
GO:0009231
AF-A0A1M3AXT6-F1-model_v4 deleted 0.9303 23 182

Feature Viewer

pLDDT pTM Quality
89.75 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map