F454228

General Info

Members Datasets Scaffolds Average Seq Length
492 227 492 479

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100028877|Ga0070708_1000288772
Length 527
Sequence MRLNCWRTVSPKAALPAVFSSNFVGAVYYMPESLQSASINAPPRLIRGIGLGGATALNMIDMIGVGPFITIPLIVGAMGGPQAMLGWVLGAGFAICDGLVWAELGAAMPGSGGSYRYLREIYGPNRLGRLISFLFIWQLSFSAPLSIASGSIGLAGYASYFWPRLEHQYMARDWNLQIPVLGNLQFRWLVSGATFLAIGIVVLAAMLLYRKITSIGWMSKLLLAGVLLTXXXIIVAGLTHFNAERAFSFPAGAFTLSHNFFLGLGSAMLIAAYDYWGYYNVCFLGDEVKDPGRTIPRALLLSILLVGCLYVVMNISILGVVPWEEMTQSGQSNRGLYVVSIFMQRVYGTWAANLVTAMVMWTAFASVFSLMLGYSRVPYAAALDGNYFKTFARVHPEHRFPYVSLLALGGVALLFCFFSLADVIAALVVIRITLQFLVQAIGVIVLRIRRPDLPRPFRMWLYPLPALIASVGFVFILIYRTNSLTQIRYAVVILITGMIIYMIRAWRNREWPFGVGAPASVEEVPSN

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 6.3
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000039 3300002074 Bacteria 67539
2 JGI24034J26672_10000042 3300002239 Bacteria 67592
3 JGI24034J26672_10000043 3300002239 Bacteria 67568
4 Ga0065712_10000582 3300005290 Bacteria 15199
5 Ga0065715_10000895 3300005293 Bacteria 8743
6 Ga0065715_10123801 3300005293 Bacteria 2169
7 Ga0065707_10144098 3300005295 Unclassified 1735
8 Ga0070658_10063076 3300005327 Bacteria 3021
9 Ga0070658_10065370 3300005327 Bacteria 2968
10 Ga0070676_10018705 3300005328 Bacteria 3843
11 Ga0070683_100001614 3300005329 Bacteria 17448
12 Ga0070683_100004431 3300005329 Bacteria 11576
13 Ga0070683_100027587 3300005329 Bacteria 5122
14 Ga0070683_100118240 3300005329 Unclassified 2503
15 Ga0070690_100009425 3300005330 Bacteria 5655
16 Ga0070690_100017487 3300005330 Bacteria 4312
17 Ga0070670_100094852 3300005331 Bacteria 2566
18 Ga0068869_100037294 3300005334 Bacteria 3455
19 Ga0068869_100038238 3300005334 Bacteria 3418
20 Ga0070666_10067504 3300005335 Bacteria 2428
21 Ga0070682_100027674 3300005337 Bacteria 3403
22 Ga0068868_100025472 3300005338 Unclassified 4500
23 Ga0068868_100101970 3300005338 Unclassified 2323
24 Ga0068868_100125194 3300005338 Bacteria 2099
25 Ga0070660_100001433 3300005339 Bacteria 16260
26 Ga0070660_100014089 3300005339 Bacteria 5756
27 Ga0070660_100043380 3300005339 Bacteria 3437
28 Ga0070689_100007637 3300005340 Bacteria 7573
29 Ga0070691_10030841 3300005341 Bacteria 2512
30 Ga0070661_100085518 3300005344 Bacteria 2331
31 Ga0070668_100000548 3300005347 Bacteria 25144
32 Ga0070669_100047830 3300005353 Bacteria 3121
33 Ga0070669_100068453 3300005353 Bacteria 2620
34 Ga0070671_100056471 3300005355 Bacteria 3266
35 Ga0070674_100013462 3300005356 Bacteria 5059
36 Ga0070674_100188286 3300005356 Bacteria 1586
37 Ga0070673_100020614 3300005364 Bacteria 4757
38 Ga0070673_100046750 3300005364 Bacteria 3363
39 Ga0070688_100001509 3300005365 Bacteria 11614
40 Ga0070688_100080605 3300005365 Bacteria 2105
41 Ga0070659_100006966 3300005366 Bacteria 8184
42 Ga0070667_100003922 3300005367 Bacteria 12636
43 Ga0070667_100030896 3300005367 Bacteria 4466
44 Ga0070703_10001299 3300005406 Bacteria 7574
45 Ga0070709_10078755 3300005434 Bacteria 2145
46 Ga0070714_100000293 3300005435 Bacteria 38274
47 Ga0070713_100000543 3300005436 Bacteria 23927
48 Ga0070713_100034926 3300005436 Bacteria 4044
49 Ga0070713_100038613 3300005436 Unclassified 3870
50 Ga0070713_100049575 3300005436 Bacteria 3464
51 Ga0070713_100096973 3300005436 Bacteria 2547
52 Ga0070713_100162839 3300005436 Unclassified 1992
53 Ga0070710_10011377 3300005437 Bacteria 4396
54 Ga0070710_10024507 3300005437 Bacteria 3184
55 Ga0070711_100000146 3300005439 Bacteria 37986
56 Ga0070711_100006952 3300005439 Bacteria 6861
57 Ga0070711_100017672 3300005439 Bacteria 4544
58 Ga0070711_100060857 3300005439 Bacteria 2626
59 Ga0070711_100070536 3300005439 Bacteria 2460
60 Ga0070711_100119827 3300005439 Bacteria 1944
61 Ga0070694_100116199 3300005444 Bacteria 1913
62 Ga0070708_100000161 3300005445 Bacteria 47447
63 Ga0070708_100000521 3300005445 Bacteria 28904
64 Ga0070708_100010169 3300005445 Bacteria 7616
65 Ga0070708_100019944 3300005445 Bacteria 5644
66 Ga0070708_100028877 3300005445 Unclassified 4777
67 Ga0070663_100016048 3300005455 Bacteria 4851
68 Ga0070663_100026335 3300005455 Bacteria 3938
69 Ga0070678_100034090 3300005456 Bacteria 3542
70 Ga0070662_100009315 3300005457 Bacteria 6417
71 Ga0070662_100115578 3300005457 Bacteria 2050
72 Ga0070662_100119480 3300005457 Bacteria 2018
73 Ga0070681_10011403 3300005458 Bacteria 8796
74 Ga0070681_10032283 3300005458 Bacteria 5254
75 Ga0068867_100070335 3300005459 Bacteria 2616
76 Ga0068867_100146061 3300005459 Bacteria 1853
77 Ga0070685_10019601 3300005466 Bacteria 3652
78 Ga0070706_100001828 3300005467 Bacteria 22042
79 Ga0070706_100003249 3300005467 Bacteria 16066
80 Ga0070706_100003401 3300005467 Bacteria 15692
81 Ga0070706_100168984 3300005467 Unclassified 2042
82 Ga0070707_100000474 3300005468 Bacteria 39735
83 Ga0070707_100013522 3300005468 Bacteria 7636
84 Ga0070707_100015523 3300005468 Bacteria 7147
85 Ga0070707_100055163 3300005468 Unclassified 3810
86 Ga0070707_100102943 3300005468 Unclassified 2767
87 Ga0070707_100122437 3300005468 Bacteria 2525
88 Ga0070707_100154407 3300005468 Bacteria 2236
89 Ga0070698_100000084 3300005471 Bacteria 73239
90 Ga0070698_100000522 3300005471 Bacteria 40952
91 Ga0070698_100001177 3300005471 Bacteria 29030
92 Ga0070698_100059121 3300005471 Unclassified 3872
93 Ga0070699_100000493 3300005518 Bacteria 37457
94 Ga0070699_100009533 3300005518 Bacteria 8413
95 Ga0070699_100066198 3300005518 Unclassified 3136
96 Ga0070679_100051917 3300005530 Bacteria 4085
97 Ga0070679_100111388 3300005530 Bacteria 2723
98 Ga0070679_100187186 3300005530 Bacteria 2040
99 Ga0070684_100008798 3300005535 Bacteria 7915
100 Ga0070697_100000049 3300005536 Bacteria 90362
101 Ga0070697_100000419 3300005536 Bacteria 32781
102 Ga0070697_100011648 3300005536 Bacteria 6873
103 Ga0070697_100020286 3300005536 Bacteria 5256
104 Ga0070697_100060078 3300005536 Bacteria 3097
105 Ga0068853_100015924 3300005539 Bacteria 6179
106 Ga0068853_100022410 3300005539 Bacteria 5275
107 Ga0068853_100048582 3300005539 Bacteria 3645
108 Ga0070686_100023527 3300005544 Bacteria 3683
109 Ga0070665_100030519 3300005548 Bacteria 5422
110 Ga0070704_100158203 3300005549 Bacteria 1789
111 Ga0070664_100069268 3300005564 Bacteria 3018
112 Ga0068857_100029099 3300005577 Bacteria 4874
113 Ga0068857_100067647 3300005577 Bacteria 3179
114 Ga0068854_100015185 3300005578 Bacteria 5096
115 Ga0068856_100006503 3300005614 Bacteria 11461
116 Ga0068856_100182050 3300005614 Unclassified 2114
117 Ga0068856_100243234 3300005614 Bacteria 1814
118 Ga0068852_100000762 3300005616 Bacteria 21236
119 Ga0068852_100180699 3300005616 Unclassified 1984
120 Ga0068859_100006169 3300005617 Bacteria 12179
121 Ga0068859_100044441 3300005617 Unclassified 4463
122 Ga0068859_100058561 3300005617 Bacteria 3880
123 Ga0068864_100016383 3300005618 Bacteria 6169
124 Ga0068864_100016536 3300005618 Bacteria 6139
125 Ga0068866_10002703 3300005718 Bacteria 7321
126 Ga0068866_10046472 3300005718 Bacteria 2184
127 Ga0068861_100001060 3300005719 Bacteria 16920
128 Ga0068861_100033808 3300005719 Bacteria 3775
129 Ga0068861_100113008 3300005719 Bacteria 2178
130 Ga0068870_10005883 3300005840 Bacteria 5386
131 Ga0068863_100037633 3300005841 Bacteria 4606
132 Ga0068863_100047024 3300005841 Bacteria 4095
133 Ga0068863_100085262 3300005841 Unclassified 2994
134 Ga0068863_100126909 3300005841 Bacteria 2434
135 Ga0068863_100186715 3300005841 Bacteria 1991
136 Ga0068863_100230300 3300005841 Bacteria 1787
137 Ga0068858_100000053 3300005842 Bacteria 119869
138 Ga0068858_100000864 3300005842 Bacteria 31391
139 Ga0068858_100072131 3300005842 Bacteria 3204
140 Ga0068858_100199115 3300005842 Bacteria 1893
141 Ga0068860_100055328 3300005843 Unclassified 3772
142 Ga0068862_100004707 3300005844 Bacteria 11495
143 Ga0081540_1003827 3300005983 Bacteria 11779
144 Ga0081539_10001165 3300005985 Bacteria 47581
145 Ga0081539_10006367 3300005985 Bacteria 11366
146 Ga0070717_10002081 3300006028 Bacteria 14020
147 Ga0070717_10009487 3300006028 Bacteria 7317
148 Ga0070717_10020283 3300006028 Bacteria 5224
149 Ga0070715_10000006 3300006163 Bacteria 216296
150 Ga0070716_100000010 3300006173 Bacteria 157261
151 Ga0070716_100001046 3300006173 Bacteria 12143
152 Ga0070716_100005312 3300006173 Bacteria 6228
153 Ga0070712_100000102 3300006175 Bacteria 43637
154 Ga0070712_100003777 3300006175 Bacteria 9325
155 Ga0075367_10077129 3300006178 Bacteria 2012
156 Ga0097621_100001297 3300006237 Bacteria 17193
157 Ga0097621_100052451 3300006237 Bacteria 3323
158 Ga0068871_100001263 3300006358 Bacteria 16916
159 Ga0068871_100005003 3300006358 Bacteria 9262
160 Ga0068871_100040264 3300006358 Unclassified 3742
161 Ga0068871_100070791 3300006358 Bacteria 2867
162 Ga0075428_100155836 3300006844 Unclassified 2481
163 Ga0075430_100010525 3300006846 Bacteria 7831
164 Ga0075431_100010912 3300006847 Bacteria 9140
165 Ga0075431_100027629 3300006847 Bacteria 5823
166 Ga0075433_10026488 3300006852 Unclassified 4908
167 Ga0075434_100000782 3300006871 Bacteria 25168
168 Ga0075434_100001105 3300006871 Bacteria 22116
169 Ga0075434_100037230 3300006871 Unclassified 4816
170 Ga0075434_100130306 3300006871 Bacteria 2533
171 Ga0068865_100104708 3300006881 Bacteria 2077
172 Ga0068865_100171653 3300006881 Bacteria 1663
173 Ga0075436_100000017 3300006914 Bacteria 151066
174 Ga0075436_100011664 3300006914 Bacteria 6030
175 Ga0075436_100040107 3300006914 Unclassified 3231
176 Ga0097620_100006170 3300006931 Bacteria 12179
177 Ga0097620_100044439 3300006931 Unclassified 4463
178 Ga0097620_100058558 3300006931 Bacteria 3880
179 Ga0075435_100012198 3300007076 Bacteria 6357
180 Ga0075435_100026112 3300007076 Bacteria 4553
181 Ga0075435_100047802 3300007076 Unclassified 3436
182 Ga0099794_10009807 3300007265 Bacteria 4044
183 Ga0105240_10014652 3300009093 Bacteria 10699
184 Ga0105240_10052475 3300009093 Bacteria 5125
185 Ga0111539_10008989 3300009094 Bacteria 12646
186 Ga0105245_10001916 3300009098 Bacteria 18896
187 Ga0105245_10010644 3300009098 Bacteria 8001
188 Ga0105247_10000052 3300009101 Bacteria 141465
189 Ga0114129_10028387 3300009147 Bacteria 7929
190 Ga0114129_10091335 3300009147 Bacteria 4219
191 Ga0105243_10000319 3300009148 Bacteria 52947
192 Ga0105243_10001504 3300009148 Bacteria 20405
193 Ga0105243_10019285 3300009148 Bacteria 5169
194 Ga0105243_10047717 3300009148 Bacteria 3373
195 Ga0105241_10066838 3300009174 Bacteria 2781
196 Ga0105241_10079373 3300009174 Unclassified 2566
197 Ga0105241_10088330 3300009174 Bacteria 2441
198 Ga0105242_10000004 3300009176 Bacteria 224767
199 Ga0105242_10001128 3300009176 Bacteria 21045
200 Ga0105242_10025117 3300009176 Unclassified 4710
201 Ga0105242_10120089 3300009176 Bacteria 2254
202 Ga0105248_10010883 3300009177 Bacteria 10040
203 Ga0105248_10011875 3300009177 Bacteria 9609
204 Ga0105248_10192074 3300009177 Bacteria 2301
205 Ga0105237_10036147 3300009545 Bacteria 4997
206 Ga0105238_10159052 3300009551 Bacteria 2235
207 Ga0105249_10216382 3300009553 Bacteria 1883
208 Ga0105249_10349592 3300009553 Bacteria 1497
209 Ga0105249_10388122 3300009553 Bacteria 1424
210 Ga0105239_10008831 3300010375 Bacteria 11406
211 Ga0105239_10049527 3300010375 Bacteria 4607
212 Ga0105246_10001926 3300011119 Bacteria 12510
213 Ga0105246_10026088 3300011119 Bacteria 3813
214 Ga0157373_10064686 3300013100 Bacteria 2589
215 Ga0157373_10134570 3300013100 Bacteria 1738
216 Ga0157371_10006960 3300013102 Bacteria 9209
217 Ga0157370_10010225 3300013104 Bacteria 9906
218 Ga0157369_10005224 3300013105 Bacteria 15150
219 Ga0157369_10010925 3300013105 Bacteria 10339
220 Ga0157369_10036672 3300013105 Bacteria 5371
221 Ga0157369_10058361 3300013105 Unclassified 4163
222 Ga0157374_10004588 3300013296 Bacteria 11585
223 Ga0157374_10005819 3300013296 Bacteria 10417
224 Ga0157374_10010489 3300013296 Bacteria 7971
225 Ga0157378_10000090 3300013297 Bacteria 86085
226 Ga0157378_10000097 3300013297 Bacteria 82132
227 Ga0157378_10022985 3300013297 Bacteria 5489
228 Ga0157378_10023093 3300013297 Bacteria 5474
229 Ga0157378_10066659 3300013297 Bacteria 3225
230 Ga0157378_10074427 3300013297 Unclassified 3056
231 Ga0157378_10100233 3300013297 Bacteria 2644
232 Ga0163162_10029738 3300013306 Bacteria 5407
233 Ga0163162_10039604 3300013306 Bacteria 4711
234 Ga0163162_10040444 3300013306 Bacteria 4662
235 Ga0163162_10052615 3300013306 Bacteria 4090
236 Ga0163162_10324403 3300013306 Bacteria 1672
237 Ga0157372_10004068 3300013307 Bacteria 15679
238 Ga0157372_10005678 3300013307 Bacteria 13273
239 Ga0157372_10161562 3300013307 Bacteria 2589
240 Ga0157375_10005635 3300013308 Bacteria 10904
241 Ga0157375_10021854 3300013308 Bacteria 5879
242 Ga0157375_10207184 3300013308 Bacteria 2117
243 Ga0157375_10276119 3300013308 Bacteria 1843
244 Ga0163163_10020171 3300014325 Bacteria 6274
245 Ga0163163_10022268 3300014325 Bacteria 5996
246 Ga0163163_10143691 3300014325 Bacteria 2429
247 Ga0157380_10010593 3300014326 Bacteria 6633
248 Ga0157380_10194661 3300014326 Bacteria 1793
249 Ga0157377_10000230 3300014745 Bacteria 29235
250 Ga0157379_10001929 3300014968 Bacteria 17155
251 Ga0157379_10144920 3300014968 Bacteria 2142
252 Ga0157376_10015678 3300014969 Bacteria 5732
253 Ga0157376_10035727 3300014969 Bacteria 4021
254 Ga0157376_10038845 3300014969 Bacteria 3876
255 Ga0157376_10100504 3300014969 Bacteria 2526
256 Ga0157376_10200916 3300014969 Bacteria 1834
257 Ga0182006_1019802 3300015261 Unclassified 2828
258 Ga0163161_10003392 3300017792 Bacteria 11185
259 Ga0163161_10019363 3300017792 Bacteria 4775
260 Ga0163161_10033621 3300017792 Bacteria 3664
261 Ga0228598_1000353 3300024227 Bacteria 9075
262 Ga0207672_1000463 3300025223 Bacteria 5129
263 Ga0207653_10000033 3300025885 Bacteria 103535
264 Ga0207692_10037093 3300025898 Bacteria 2382
265 Ga0207642_10022453 3300025899 Bacteria 2503
266 Ga0207710_10000004 3300025900 Bacteria 846540
267 Ga0207688_10034526 3300025901 Bacteria 2801
268 Ga0207647_10011703 3300025904 Bacteria 6141
269 Ga0207647_10015221 3300025904 Bacteria 5282
270 Ga0207647_10059259 3300025904 Unclassified 2343
271 Ga0207685_10000010 3300025905 Bacteria 216792
272 Ga0207699_10000815 3300025906 Bacteria 14849
273 Ga0207645_10000376 3300025907 Bacteria 36934
274 Ga0207643_10000194 3300025908 Bacteria 41979
275 Ga0207643_10013470 3300025908 Bacteria 4430
276 Ga0207705_10001268 3300025909 Bacteria 20276
277 Ga0207705_10049209 3300025909 Bacteria 3034
278 Ga0207705_10075139 3300025909 Bacteria 2454
279 Ga0207684_10000132 3300025910 Bacteria 134931
280 Ga0207684_10002846 3300025910 Bacteria 17183
281 Ga0207684_10005482 3300025910 Bacteria 11686
282 Ga0207684_10007035 3300025910 Bacteria 10176
283 Ga0207654_10045264 3300025911 Bacteria 2503
284 Ga0207707_10002069 3300025912 Bacteria 18184
285 Ga0207707_10027696 3300025912 Bacteria 4955
286 Ga0207707_10028740 3300025912 Bacteria 4858
287 Ga0207695_10011348 3300025913 Bacteria 10799
288 Ga0207671_10024397 3300025914 Bacteria 4548
289 Ga0207693_10000090 3300025915 Bacteria 81069
290 Ga0207693_10000937 3300025915 Bacteria 26188
291 Ga0207693_10002574 3300025915 Bacteria 15766
292 Ga0207693_10006805 3300025915 Bacteria 9440
293 Ga0207693_10124867 3300025915 Bacteria 2022
294 Ga0207663_10007167 3300025916 Bacteria 5766
295 Ga0207663_10012634 3300025916 Bacteria 4571
296 Ga0207657_10000215 3300025919 Bacteria 60239
297 Ga0207657_10002654 3300025919 Bacteria 19308
298 Ga0207657_10003651 3300025919 Bacteria 16380
299 Ga0207649_10019267 3300025920 Bacteria 3897
300 Ga0207646_10000554 3300025922 Bacteria 49222
301 Ga0207646_10014574 3300025922 Bacteria 7455
302 Ga0207646_10032672 3300025922 Bacteria 4709
303 Ga0207646_10055936 3300025922 Unclassified 3527
304 Ga0207646_10064012 3300025922 Unclassified 3283
305 Ga0207646_10078806 3300025922 Unclassified 2945
306 Ga0207681_10054089 3300025923 Bacteria 2728
307 Ga0207681_10105578 3300025923 Bacteria 2040
308 Ga0207694_10144820 3300025924 Bacteria 1912
309 Ga0207650_10000216 3300025925 Bacteria 65683
310 Ga0207650_10110155 3300025925 Bacteria 2130
311 Ga0207687_10004658 3300025927 Bacteria 9124
312 Ga0207687_10062758 3300025927 Bacteria 2629
313 Ga0207687_10142925 3300025927 Bacteria 1817
314 Ga0207700_10001662 3300025928 Bacteria 12623
315 Ga0207700_10002203 3300025928 Bacteria 11180
316 Ga0207700_10016552 3300025928 Bacteria 4902
317 Ga0207700_10037418 3300025928 Bacteria 3514
318 Ga0207700_10066992 3300025928 Unclassified 2746
319 Ga0207700_10108164 3300025928 Unclassified 2232
320 Ga0207700_10118881 3300025928 Bacteria 2139
321 Ga0207664_10000346 3300025929 Bacteria 34140
322 Ga0207664_10012462 3300025929 Bacteria 6080
323 Ga0207664_10120920 3300025929 Bacteria 2191
324 Ga0207644_10000206 3300025931 Bacteria 41161
325 Ga0207690_10021000 3300025932 Bacteria 4044
326 Ga0207706_10000958 3300025933 Bacteria 29517
327 Ga0207706_10001394 3300025933 Bacteria 24143
328 Ga0207706_10128443 3300025933 Bacteria 2229
329 Ga0207706_10156027 3300025933 Bacteria 2007
330 Ga0207686_10000005 3300025934 Bacteria 260873
331 Ga0207686_10000676 3300025934 Bacteria 21121
332 Ga0207686_10104998 3300025934 Bacteria 1894
333 Ga0207709_10000133 3300025935 Bacteria 108698
334 Ga0207709_10000754 3300025935 Bacteria 25567
335 Ga0207709_10046629 3300025935 Bacteria 2631
336 Ga0207709_10047459 3300025935 Bacteria 2611
337 Ga0207665_10000010 3300025939 Bacteria 157219
338 Ga0207665_10000329 3300025939 Bacteria 32870
339 Ga0207665_10036816 3300025939 Bacteria 3255
340 Ga0207691_10000459 3300025940 Bacteria 40352
341 Ga0207691_10016312 3300025940 Bacteria 7053
342 Ga0207711_10003261 3300025941 Bacteria 14127
343 Ga0207711_10062086 3300025941 Bacteria 3223
344 Ga0207711_10073343 3300025941 Bacteria 2975
345 Ga0207711_10104895 3300025941 Bacteria 2506
346 Ga0207689_10001299 3300025942 Bacteria 24073
347 Ga0207689_10001458 3300025942 Bacteria 22635
348 Ga0207689_10006218 3300025942 Bacteria 10575
349 Ga0207689_10006579 3300025942 Bacteria 10244
350 Ga0207661_10000423 3300025944 Bacteria 27313
351 Ga0207661_10048235 3300025944 Bacteria 3383
352 Ga0207661_10065618 3300025944 Bacteria 2947
353 Ga0207667_10005351 3300025949 Bacteria 15644
354 Ga0207667_10072640 3300025949 Unclassified 3575
355 Ga0207651_10052509 3300025960 Bacteria 2780
356 Ga0207658_10087886 3300025986 Bacteria 2401
357 Ga0207677_10045833 3300026023 Bacteria 2922
358 Ga0207677_10080603 3300026023 Bacteria 2333
359 Ga0207703_10000093 3300026035 Bacteria 104313
360 Ga0207703_10014131 3300026035 Bacteria 6224
361 Ga0207703_10047717 3300026035 Bacteria 3454
362 Ga0207639_10037218 3300026041 Bacteria 3613
363 Ga0207678_10000328 3300026067 Bacteria 42509
364 Ga0207678_10005021 3300026067 Bacteria 11873
365 Ga0207678_10012112 3300026067 Bacteria 7573
366 Ga0207702_10031999 3300026078 Bacteria 4387
367 Ga0207641_10000309 3300026088 Bacteria 60888
368 Ga0207641_10041938 3300026088 Unclassified 3838
369 Ga0207641_10157786 3300026088 Bacteria 2060
370 Ga0207641_10250731 3300026088 Bacteria 1653
371 Ga0207648_10000826 3300026089 Bacteria 34905
372 Ga0207648_10005979 3300026089 Bacteria 12165
373 Ga0207648_10104683 3300026089 Unclassified 2482
374 Ga0207648_10154548 3300026089 Bacteria 2025
375 Ga0207676_10000058 3300026095 Bacteria 120315
376 Ga0207676_10008362 3300026095 Bacteria 7357
377 Ga0207676_10100316 3300026095 Bacteria 2398
378 Ga0207674_10000148 3300026116 Bacteria 82478
379 Ga0207674_10000798 3300026116 Bacteria 40990
380 Ga0207674_10015331 3300026116 Bacteria 8423
381 Ga0207675_100007175 3300026118 Bacteria 10534
382 Ga0207675_100035992 3300026118 Bacteria 4617
383 Ga0207675_100041341 3300026118 Bacteria 4305
384 Ga0207683_10000913 3300026121 Bacteria 27167
385 Ga0207683_10153408 3300026121 Bacteria 2080
386 Ga0207428_10006921 3300027907 Bacteria 10394
387 Ga0207428_10016061 3300027907 Bacteria 6452
388 Ga0268266_10065758 3300028379 Bacteria 3134
389 Ga0268265_10030362 3300028380 Bacteria 3891
390 Ga0268265_10161432 3300028380 Bacteria 1904
391 Ga0268264_10006489 3300028381 Bacteria 9850
392 Ga0268264_10052109 3300028381 Bacteria 3412
393 Ga0265338_10051280 3300028800 Bacteria 3717
394 Ga0265338_10183762 3300028800 Bacteria 1591
395 Ga0265762_1000349 3300030760 Bacteria 7846
396 Ga0265760_10003966 3300031090 Unclassified 4271
397 Ga0265760_10007715 3300031090 Bacteria 3075
398 Ga0265760_10013025 3300031090 Bacteria 2381
399 Ga0265339_10051706 3300031249 Unclassified 2241
400 Ga0307408_100111748 3300031548 Bacteria 2100
401 Ga0265314_10027717 3300031711 Bacteria 4239
402 Ga0373936_0000505 3300035113 Bacteria 13258
403 Ga0373945_0005358 3300035116 Bacteria 4107
404 Ga0373953_0034721 3300035117 Bacteria 1978
405 Ga0373954_0020001 3300035118 Bacteria 3023
406 Ga0373943_0000817 3300035170 Bacteria 13678
407 Ga0373943_0002097 3300035170 Bacteria 9057
408 Ga0373955_0007323 3300035172 Bacteria 5069
409 Ga0373942_0007544 3300035207 Bacteria 2525
410 Ga0373924_0000145 3300035410 Bacteria 20877
411 Ga0373924_0012959 3300035410 Unclassified 3125
412 Ga0373924_0014134 3300035410 Bacteria 3012
413 Ga0373935_0008305 3300035692 Bacteria 6213
414 Ga0373935_0104698 3300035692 Bacteria 1870
415 Ga0373927_0024966 3300035695 Unclassified 3907
416 Ga0373927_0040957 3300035695 Unclassified 3004
417 Ga0373933_0040683 3300035724 Bacteria 2740
418 Ga0373933_0047311 3300035724 Unclassified 2557
419 Ga0373933_0071098 3300035724 Bacteria 2118
420 Ga0373937_0001106 3300036401 Bacteria 22707
421 Ga0373937_0042141 3300036401 Bacteria 4165
422 Ga0373937_0112061 3300036401 Bacteria 2538
423 Ga0373925_0001893 3300037068 Bacteria 17370
424 Ga0395898_0138516 3300037466 Bacteria 2330
425 Ga0395905_0041439 3300037471 Bacteria 4321
426 Ga0395905_0079554 3300037471 Bacteria 3073
427 Ga0436363_0650696 3300039450 Unclassified 2756
428 Ga0451577_0234416 3300042876 Bacteria 1660
429 Ga0451576_0038878 3300045051 Bacteria 5036
430 Ga0495580_0010761 3300046472 Bacteria 7105
431 Ga0495580_0039939 3300046472 Bacteria 3356
432 Ga0495580_0042621 3300046472 Bacteria 3232
433 Ga0495580_0103664 3300046472 Bacteria 1977
434 Ga0495580_0118502 3300046472 Bacteria 1838
435 Ga0495582_0017869 3300046473 Bacteria 3877
436 Ga0495608_0037469 3300046511 Bacteria 3261
437 Ga0495623_0049592 3300046679 Unclassified 2660
438 Ga0495623_0058092 3300046679 Unclassified 2433
439 Ga0495669_0009185 3300046684 Bacteria 4165
440 Ga0495686_0000064 3300047472 Bacteria 226284
441 Ga0495686_0004450 3300047472 Bacteria 11540
442 Ga0496100_0022375 3300048903 Bacteria 3825
443 Ga0496101_0040429 3300048904 Bacteria 3321
444 Ga0496102_0008897 3300048905 Bacteria 8617
445 Ga0496102_0029142 3300048905 Bacteria 4937
446 Ga0496102_0079560 3300048905 Bacteria 3019
447 Ga0496102_0100793 3300048905 Unclassified 2683
448 Ga0496104_0000027 3300048907 Bacteria 203475
449 Ga0496104_0024786 3300048907 Bacteria 5523
450 Ga0496104_0026536 3300048907 Bacteria 5351
451 Ga0496104_0244075 3300048907 Unclassified 1708
452 Ga0496105_0002243 3300048908 Bacteria 14004
453 Ga0496105_0020249 3300048908 Bacteria 5375
454 Ga0496105_0079182 3300048908 Bacteria 2714
455 Ga0496106_0120149 3300048909 Bacteria 2053
456 Ga0496108_0000170 3300048911 Bacteria 61234
457 Ga0496108_0012200 3300048911 Bacteria 6989
458 Ga0496109_0000055 3300048912 Bacteria 121528
459 Ga0496109_0005774 3300048912 Bacteria 10358
460 Ga0496109_0168081 3300048912 Bacteria 2057
461 Ga0496110_0001519 3300048913 Bacteria 16850
462 Ga0496110_0161145 3300048913 Bacteria 2033
463 Ga0496111_0006648 3300048914 Bacteria 7523
464 Ga0496111_0025289 3300048914 Bacteria 4189
465 Ga0496112_0002840 3300048915 Bacteria 14064
466 Ga0496112_0010919 3300048915 Bacteria 8268
467 Ga0496112_0011083 3300048915 Bacteria 8216
468 Ga0496112_0011186 3300048915 Bacteria 8183
469 Ga0496112_0013566 3300048915 Bacteria 7528
470 Ga0496112_0057420 3300048915 Bacteria 3832
471 Ga0496113_0001401 3300048916 Bacteria 13412
472 Ga0496114_0049003 3300048917 Bacteria 3514
473 Ga0496124_0108148 3300048927 Bacteria 2243
474 Ga0496126_0000029 3300048929 Bacteria 389370
475 Ga0501033_0151168 3300049570 Bacteria 1675
476 Ga0501037_0061469 3300049573 Bacteria 2739
477 nmdc:mga05p37_182564_c1 3300050507 Bacteria 2552
478 nmdc:mga0qj67_13216_c1 3300050509 Bacteria 6230
479 nmdc:mga06r32_39102_c1 3300050510 Unclassified 4500
480 nmdc:mga06r32_85642_c1 3300050510 Bacteria 3073
481 nmdc:mga08y16_12689_c1 3300050511 Bacteria 8865
482 nmdc:mga08y16_146418_c1 3300050511 Bacteria 2456
483 nmdc:mga0n895_1225_c1 3300050512 Bacteria 18962
484 nmdc:mga0n895_165276_c1 3300050512 Bacteria 2245
485 nmdc:mga0n895_2891_c1 3300050512 Bacteria 13628
486 nmdc:mga0rr50_19796_c1 3300050513 Bacteria 4553
487 nmdc:mga0rr50_3612_c1 3300050513 Bacteria 8941
488 nmdc:mga08x19_40_c1 3300050514 Bacteria 154170
489 nmdc:mga08x19_4609_c1 3300050514 Bacteria 8185
490 nmdc:mga0a205_1296_c1 3300050515 Bacteria 21017
491 nmdc:mga0a205_26205_c1 3300050515 Bacteria 5556
492 Ga0500590_033370 3300053148 Bacteria 2668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0151168 Ga0501033_0151168_23_1183 375
2 3300009553 Ga0105249_10349592 Ga0105249_103495922 381
3 3300009553 Ga0105249_10388122 Ga0105249_103881222 381
4 3300005544 Ga0070686_100023527 Ga0070686_1000235271 390
5 3300050512 nmdc:mga0n895_165276_c1 nmdc:mga0n895_165276_c1_34_1368 401
6 3300006847 Ga0075431_100027629 Ga0075431_1000276294 416
7 3300005290 Ga0065712_10000582 Ga0065712_100005825 417
8 3300005293 Ga0065715_10000895 Ga0065715_100008958 417
9 3300005331 Ga0070670_100094852 Ga0070670_1000948522 417
10 3300005353 Ga0070669_100047830 Ga0070669_1000478302 417
11 3300005365 Ga0070688_100001509 Ga0070688_1000015098 417
12 3300005457 Ga0070662_100115578 Ga0070662_1001155782 417
13 3300005548 Ga0070665_100030519 Ga0070665_1000305195 417
14 3300005549 Ga0070704_100158203 Ga0070704_1001582031 417
15 3300005618 Ga0068864_100016536 Ga0068864_1000165365 417
16 3300005841 Ga0068863_100047024 Ga0068863_1000470242 417
17 3300013306 Ga0163162_10052615 Ga0163162_100526155 417
18 3300025923 Ga0207681_10054089 Ga0207681_100540892 417
19 3300025925 Ga0207650_10110155 Ga0207650_101101551 417
20 3300025933 Ga0207706_10128443 Ga0207706_101284432 417
21 3300025940 Ga0207691_10016312 Ga0207691_100163125 417
22 3300025941 Ga0207711_10104895 Ga0207711_101048952 417
23 3300026088 Ga0207641_10157786 Ga0207641_101577862 417
24 3300026095 Ga0207676_10008362 Ga0207676_100083625 417
25 3300026121 Ga0207683_10153408 Ga0207683_101534082 417
26 3300028380 Ga0268265_10161432 Ga0268265_101614322 417
27 3300048907 Ga0496104_0026536 Ga0496104_0026536_3342_4691 417
28 3300048908 Ga0496105_0079182 Ga0496105_0079182_365_1714 417
29 3300048911 Ga0496108_0012200 Ga0496108_0012200_1912_3261 417
30 3300048912 Ga0496109_0005774 Ga0496109_0005774_4402_5751 417
31 3300048913 Ga0496110_0161145 Ga0496110_0161145_18_1367 417
32 3300048915 Ga0496112_0013566 Ga0496112_0013566_1951_3300 417
33 3300005459 Ga0068867_100070335 Ga0068867_1000703353 420
34 3300006871 Ga0075434_100130306 Ga0075434_1001303062 422
35 3300025929 Ga0207664_10120920 Ga0207664_101209202 422
36 3300050510 nmdc:mga06r32_85642_c1 nmdc:mga06r32_85642_c1_724_2124 422
37 3300005356 Ga0070674_100188286 Ga0070674_1001882861 426
38 3300037466 Ga0395898_0138516 Ga0395898_0138516_850_2244 426
39 3300005985 Ga0081539_10006367 Ga0081539_100063679 428
40 3300009177 Ga0105248_10011875 Ga0105248_100118756 428
41 3300048929 Ga0496126_0000029 Ga0496126_0000029_37292_38659 428
42 3300037471 Ga0395905_0079554 Ga0395905_0079554_1323_2696 431
43 3300026089 Ga0207648_10154548 Ga0207648_101545482 432
44 3300009094 Ga0111539_10008989 Ga0111539_100089895 436
45 3300027907 Ga0207428_10016061 Ga0207428_100160615 436
46 3300050511 nmdc:mga08y16_12689_c1 nmdc:mga08y16_12689_c1_4467_5879 436
47 3300013105 Ga0157369_10005224 Ga0157369_100052247 437
48 3300015261 Ga0182006_1019802 Ga0182006_10198022 437
49 3300009147 Ga0114129_10091335 Ga0114129_100913351 439
50 3300005329 Ga0070683_100004431 Ga0070683_1000044316 441
51 3300005339 Ga0070660_100014089 Ga0070660_1000140892 441
52 3300005366 Ga0070659_100006966 Ga0070659_1000069662 441
53 3300005458 Ga0070681_10011403 Ga0070681_100114035 441
54 3300005530 Ga0070679_100187186 Ga0070679_1001871862 441
55 3300005535 Ga0070684_100008798 Ga0070684_1000087983 441
56 3300005577 Ga0068857_100029099 Ga0068857_1000290993 441
57 3300005578 Ga0068854_100015185 Ga0068854_1000151853 441
58 3300006178 Ga0075367_10077129 Ga0075367_100771292 441
59 3300009093 Ga0105240_10014652 Ga0105240_100146525 441
60 3300009545 Ga0105237_10036147 Ga0105237_100361473 441
61 3300013100 Ga0157373_10064686 Ga0157373_100646862 441
62 3300013104 Ga0157370_10010225 Ga0157370_100102255 441
63 3300013105 Ga0157369_10010925 Ga0157369_100109252 441
64 3300013307 Ga0157372_10005678 Ga0157372_100056785 441
65 3300025909 Ga0207705_10001268 Ga0207705_100012686 441
66 3300025914 Ga0207671_10024397 Ga0207671_100243973 441
67 3300025919 Ga0207657_10002654 Ga0207657_100026544 441
68 3300025944 Ga0207661_10048235 Ga0207661_100482352 441
69 3300026067 Ga0207678_10005021 Ga0207678_100050216 441
70 3300026116 Ga0207674_10000798 Ga0207674_100007982 441
71 3300005327 Ga0070658_10063076 Ga0070658_100630762 442
72 3300049573 Ga0501037_0061469 Ga0501037_0061469_872_2284 442
73 3300048915 Ga0496112_0011083 Ga0496112_0011083_2461_3912 446
74 3300005327 Ga0070658_10065370 Ga0070658_100653702 448
75 3300005328 Ga0070676_10018705 Ga0070676_100187054 448
76 3300005329 Ga0070683_100001614 Ga0070683_1000016143 448
77 3300005330 Ga0070690_100017487 Ga0070690_1000174874 448
78 3300005340 Ga0070689_100007637 Ga0070689_1000076372 448
79 3300005347 Ga0070668_100000548 Ga0070668_1000005484 448
80 3300005353 Ga0070669_100068453 Ga0070669_1000684532 448
81 3300005356 Ga0070674_100013462 Ga0070674_1000134621 448
82 3300005456 Ga0070678_100034090 Ga0070678_1000340903 448
83 3300005457 Ga0070662_100009315 Ga0070662_1000093153 448
84 3300005466 Ga0070685_10019601 Ga0070685_100196013 448
85 3300005539 Ga0068853_100015924 Ga0068853_1000159242 448
86 3300005614 Ga0068856_100243234 Ga0068856_1002432342 448
87 3300005616 Ga0068852_100000762 Ga0068852_10000076213 448
88 3300005718 Ga0068866_10002703 Ga0068866_100027032 448
89 3300005719 Ga0068861_100001060 Ga0068861_1000010605 448
90 3300005840 Ga0068870_10005883 Ga0068870_100058832 448
91 3300006881 Ga0068865_100104708 Ga0068865_1001047081 448
92 3300009148 Ga0105243_10047717 Ga0105243_100477172 448
93 3300009176 Ga0105242_10025117 Ga0105242_100251173 448
94 3300009553 Ga0105249_10216382 Ga0105249_102163821 448
95 3300010375 Ga0105239_10008831 Ga0105239_100088312 448
96 3300011119 Ga0105246_10001926 Ga0105246_100019262 448
97 3300014326 Ga0157380_10010593 Ga0157380_100105933 448
98 3300017792 Ga0163161_10003392 Ga0163161_100033922 448
99 3300025899 Ga0207642_10022453 Ga0207642_100224532 448
100 3300025901 Ga0207688_10034526 Ga0207688_100345261 448
101 3300025904 Ga0207647_10011703 Ga0207647_100117034 448
102 3300025907 Ga0207645_10000376 Ga0207645_100003764 448
103 3300025908 Ga0207643_10000194 Ga0207643_1000019413 448
104 3300025909 Ga0207705_10075139 Ga0207705_100751392 448
105 3300025932 Ga0207690_10021000 Ga0207690_100210002 448
106 3300025933 Ga0207706_10000958 Ga0207706_100009583 448
107 3300025942 Ga0207689_10001458 Ga0207689_100014589 448
108 3300026089 Ga0207648_10000826 Ga0207648_1000082614 448
109 3300026118 Ga0207675_100041341 Ga0207675_1000413412 448
110 3300026121 Ga0207683_10000913 Ga0207683_1000091314 448
111 3300028379 Ga0268266_10065758 Ga0268266_100657582 448
112 3300037471 Ga0395905_0041439 Ga0395905_0041439_2643_4079 449
113 3300006881 Ga0068865_100171653 Ga0068865_1001716532 453
114 3300047472 Ga0495686_0000064 Ga0495686_0000064_32712_34106 453
115 3300048907 Ga0496104_0000027 Ga0496104_0000027_161402_162796 453
116 3300005455 Ga0070663_100016048 Ga0070663_1000160483 454
117 3300006846 Ga0075430_100010525 Ga0075430_1000105254 454
118 3300006847 Ga0075431_100010912 Ga0075431_1000109126 454
119 3300050509 nmdc:mga0qj67_13216_c1 nmdc:mga0qj67_13216_c1_1402_2796 454
120 3300050510 nmdc:mga06r32_39102_c1 nmdc:mga06r32_39102_c1_1041_2435 454
121 3300048927 Ga0496124_0108148 Ga0496124_0108148_745_2196 456
122 3300005983 Ga0081540_1003827 Ga0081540_10038278 457
123 3300005458 Ga0070681_10032283 Ga0070681_100322832 458
124 3300005530 Ga0070679_100051917 Ga0070679_1000519172 458
125 3300005616 Ga0068852_100180699 Ga0068852_1001806992 458
126 3300025912 Ga0207707_10002069 Ga0207707_100020694 458
127 3300006914 Ga0075436_100011664 Ga0075436_1000116642 459
128 3300006914 Ga0075436_100040107 Ga0075436_1000401072 459
129 3300007076 Ga0075435_100012198 Ga0075435_1000121984 459
130 3300025927 Ga0207687_10062758 Ga0207687_100627581 459
131 3300014969 Ga0157376_10100504 Ga0157376_101005041 460
132 3300047472 Ga0495686_0004450 Ga0495686_0004450_327_1769 460
133 3300005842 Ga0068858_100072131 Ga0068858_1000721312 461
134 3300005364 Ga0070673_100020614 Ga0070673_1000206142 462
135 3300005617 Ga0068859_100044441 Ga0068859_1000444412 462
136 3300006931 Ga0097620_100044439 Ga0097620_1000444392 462
137 3300009177 Ga0105248_10192074 Ga0105248_101920743 462
138 3300025908 Ga0207643_10013470 Ga0207643_100134702 462
139 3300025941 Ga0207711_10062086 Ga0207711_100620862 462
140 3300025960 Ga0207651_10052509 Ga0207651_100525092 462
141 3300026089 Ga0207648_10104683 Ga0207648_101046832 462
142 3300042876 Ga0451577_0234416 Ga0451577_0234416_87_1577 462
143 3300005468 Ga0070707_100013522 Ga0070707_1000135223 463
144 3300025922 Ga0207646_10014574 Ga0207646_100145743 463
145 3300025935 Ga0207709_10047459 Ga0207709_100474592 463
146 3300005329 Ga0070683_100118240 Ga0070683_1001182401 464
147 3300031090 Ga0265760_10013025 Ga0265760_100130252 464
148 3300005435 Ga0070714_100000293 Ga0070714_1000002938 465
149 3300005530 Ga0070679_100111388 Ga0070679_1001113882 465
150 3300025929 Ga0207664_10000346 Ga0207664_100003462 465
151 3300035113 Ga0373936_0000505 Ga0373936_0000505_2023_3444 465
152 3300035116 Ga0373945_0005358 Ga0373945_0005358_2343_3764 465
153 3300035118 Ga0373954_0020001 Ga0373954_0020001_371_1792 465
154 3300035170 Ga0373943_0000817 Ga0373943_0000817_9278_10699 465
155 3300035172 Ga0373955_0007323 Ga0373955_0007323_1401_2822 465
156 3300035410 Ga0373924_0012959 Ga0373924_0012959_77_1498 465
157 3300035692 Ga0373935_0008305 Ga0373935_0008305_2456_3877 465
158 3300035695 Ga0373927_0024966 Ga0373927_0024966_994_2415 465
159 3300035724 Ga0373933_0047311 Ga0373933_0047311_1039_2460 465
160 3300037068 Ga0373925_0001893 Ga0373925_0001893_8644_10065 465
161 3300046679 Ga0495623_0058092 Ga0495623_0058092_342_1763 465
162 3300046684 Ga0495669_0009185 Ga0495669_0009185_696_2159 465
163 3300005436 Ga0070713_100000543 Ga0070713_10000054316 466
164 3300005436 Ga0070713_100049575 Ga0070713_1000495752 466
165 3300005437 Ga0070710_10011377 Ga0070710_100113772 466
166 3300009174 Ga0105241_10079373 Ga0105241_100793732 466
167 3300014968 Ga0157379_10001929 Ga0157379_100019293 466
168 3300030760 Ga0265762_1000349 Ga0265762_10003495 467
169 3300006852 Ga0075433_10026488 Ga0075433_100264883 469
170 3300006871 Ga0075434_100000782 Ga0075434_10000078212 469
171 3300007076 Ga0075435_100047802 Ga0075435_1000478022 469
172 3300017792 Ga0163161_10019363 Ga0163161_100193633 469
173 3300050512 nmdc:mga0n895_1225_c1 nmdc:mga0n895_1225_c1_15754_17304 469
174 3300050513 nmdc:mga0rr50_3612_c1 nmdc:mga0rr50_3612_c1_5687_7237 469
175 3300050514 nmdc:mga08x19_4609_c1 nmdc:mga08x19_4609_c1_5611_7161 469
176 3300050515 nmdc:mga0a205_1296_c1 nmdc:mga0a205_1296_c1_17894_19444 469
177 3300005985 Ga0081539_10001165 Ga0081539_1000116520 470
178 3300009174 Ga0105241_10088330 Ga0105241_100883302 470
179 3300013297 Ga0157378_10022985 Ga0157378_100229852 470
180 3300035724 Ga0373933_0071098 Ga0373933_0071098_536_1978 470
181 3300048903 Ga0496100_0022375 Ga0496100_0022375_1617_3059 470
182 3300048904 Ga0496101_0040429 Ga0496101_0040429_1743_3185 470
183 3300048905 Ga0496102_0079560 Ga0496102_0079560_416_1858 470
184 3300048917 Ga0496114_0049003 Ga0496114_0049003_990_2432 470
185 3300005436 Ga0070713_100096973 Ga0070713_1000969732 471
186 3300009093 Ga0105240_10052475 Ga0105240_100524752 471
187 3300005436 Ga0070713_100038613 Ga0070713_1000386132 472
188 3300005439 Ga0070711_100006952 Ga0070711_1000069526 472
189 3300025916 Ga0207663_10012634 Ga0207663_100126344 472
190 3300046472 Ga0495580_0103664 Ga0495580_0103664_306_1757 472
191 3300005355 Ga0070671_100056471 Ga0070671_1000564712 474
192 3300005367 Ga0070667_100030896 Ga0070667_1000308963 474
193 3300005618 Ga0068864_100016383 Ga0068864_1000163832 474
194 3300005841 Ga0068863_100186715 Ga0068863_1001867152 474
195 3300006237 Ga0097621_100052451 Ga0097621_1000524512 474
196 3300006358 Ga0068871_100040264 Ga0068871_1000402642 474
197 3300009148 Ga0105243_10000319 Ga0105243_1000031933 474
198 3300013297 Ga0157378_10100233 Ga0157378_101002332 474
199 3300013306 Ga0163162_10324403 Ga0163162_103244031 474
200 3300013308 Ga0157375_10276119 Ga0157375_102761191 474
201 3300014325 Ga0163163_10143691 Ga0163163_101436911 474
202 3300014969 Ga0157376_10200916 Ga0157376_102009161 474
203 3300026095 Ga0207676_10100316 Ga0207676_101003162 474
204 3300031548 Ga0307408_100111748 Ga0307408_1001117482 474
205 3300014325 Ga0163163_10020171 Ga0163163_100201712 475
206 3300005436 Ga0070713_100034926 Ga0070713_1000349262 476
207 3300006028 Ga0070717_10009487 Ga0070717_100094877 476
208 3300006914 Ga0075436_100000017 Ga0075436_10000001777 476
209 3300007076 Ga0075435_100026112 Ga0075435_1000261124 476
210 3300013308 Ga0157375_10207184 Ga0157375_102071842 476
211 3300025928 Ga0207700_10016552 Ga0207700_100165524 476
212 3300046472 Ga0495580_0039939 Ga0495580_0039939_1637_3130 476
213 3300050507 nmdc:mga05p37_182564_c1 nmdc:mga05p37_182564_c1_974_2443 476
214 3300050513 nmdc:mga0rr50_19796_c1 nmdc:mga0rr50_19796_c1_1116_2591 476
215 3300050514 nmdc:mga08x19_40_c1 nmdc:mga08x19_40_c1_79791_81266 476
216 3300053148 Ga0500590_033370 Ga0500590_033370_1070_2527 476
217 3300006175 Ga0070712_100003777 Ga0070712_1000037776 477
218 3300005293 Ga0065715_10123801 Ga0065715_101238012 478
219 3300005334 Ga0068869_100038238 Ga0068869_1000382382 478
220 3300005406 Ga0070703_10001299 Ga0070703_100012993 478
221 3300005439 Ga0070711_100017672 Ga0070711_1000176723 478
222 3300005614 Ga0068856_100182050 Ga0068856_1001820503 478
223 3300005617 Ga0068859_100006169 Ga0068859_10000616910 478
224 3300005842 Ga0068858_100000864 Ga0068858_10000086412 478
225 3300006028 Ga0070717_10002081 Ga0070717_100020818 478
226 3300006173 Ga0070716_100001046 Ga0070716_1000010465 478
227 3300006931 Ga0097620_100006170 Ga0097620_10000617010 478
228 3300010375 Ga0105239_10049527 Ga0105239_100495272 478
229 3300013296 Ga0157374_10004588 Ga0157374_100045889 478
230 3300013296 Ga0157374_10005819 Ga0157374_100058192 478
231 3300013297 Ga0157378_10023093 Ga0157378_100230933 478
232 3300013297 Ga0157378_10074427 Ga0157378_100744273 478
233 3300013306 Ga0163162_10029738 Ga0163162_100297382 478
234 3300013306 Ga0163162_10040444 Ga0163162_100404442 478
235 3300013308 Ga0157375_10021854 Ga0157375_100218542 478
236 3300014326 Ga0157380_10194661 Ga0157380_101946612 478
237 3300014968 Ga0157379_10144920 Ga0157379_101449202 478
238 3300014969 Ga0157376_10015678 Ga0157376_100156782 478
239 3300025885 Ga0207653_10000033 Ga0207653_1000003370 478
240 3300025904 Ga0207647_10015221 Ga0207647_100152212 478
241 3300025909 Ga0207705_10049209 Ga0207705_100492092 478
242 3300025915 Ga0207693_10002574 Ga0207693_100025742 478
243 3300025933 Ga0207706_10156027 Ga0207706_101560271 478
244 3300025939 Ga0207665_10000329 Ga0207665_100003295 478
245 3300025942 Ga0207689_10001299 Ga0207689_1000129918 478
246 3300026023 Ga0207677_10045833 Ga0207677_100458332 478
247 3300026035 Ga0207703_10014131 Ga0207703_100141312 478
248 3300026089 Ga0207648_10005979 Ga0207648_1000597911 478
249 3300031711 Ga0265314_10027717 Ga0265314_100277172 478
250 3300048915 Ga0496112_0010919 Ga0496112_0010919_5830_7293 478
251 3300005295 Ga0065707_10144098 Ga0065707_101440981 479
252 3300005329 Ga0070683_100027587 Ga0070683_1000275873 479
253 3300005439 Ga0070711_100119827 Ga0070711_1001198271 479
254 3300006844 Ga0075428_100155836 Ga0075428_1001558362 479
255 3300009148 Ga0105243_10001504 Ga0105243_1000150413 479
256 3300009176 Ga0105242_10001128 Ga0105242_100011283 479
257 3300009551 Ga0105238_10159052 Ga0105238_101590523 479
258 3300013297 Ga0157378_10000090 Ga0157378_1000009036 479
259 3300013308 Ga0157375_10005635 Ga0157375_100056359 479
260 3300025912 Ga0207707_10027696 Ga0207707_100276962 479
261 3300025915 Ga0207693_10006805 Ga0207693_100068057 479
262 3300025928 Ga0207700_10118881 Ga0207700_101188812 479
263 3300025939 Ga0207665_10036816 Ga0207665_100368163 479
264 3300025949 Ga0207667_10072640 Ga0207667_100726403 479
265 3300027907 Ga0207428_10006921 Ga0207428_100069216 479
266 3300035724 Ga0373933_0040683 Ga0373933_0040683_516_1991 479
267 3300036401 Ga0373937_0001106 Ga0373937_0001106_6005_7480 479
268 3300036401 Ga0373937_0112061 Ga0373937_0112061_480_1955 479
269 3300046679 Ga0495623_0049592 Ga0495623_0049592_463_1938 479
270 3300048915 Ga0496112_0057420 Ga0496112_0057420_216_1691 479
271 3300050511 nmdc:mga08y16_146418_c1 nmdc:mga08y16_146418_c1_487_1956 479
272 3300006358 Ga0068871_100005003 Ga0068871_1000050033 480
273 3300017792 Ga0163161_10033621 Ga0163161_100336212 480
274 3300035692 Ga0373935_0104698 Ga0373935_0104698_247_1716 480
275 3300036401 Ga0373937_0042141 Ga0373937_0042141_1453_2931 480
276 3300005338 Ga0068868_100025472 Ga0068868_1000254721 481
277 3300005434 Ga0070709_10078755 Ga0070709_100787552 481
278 3300005437 Ga0070710_10024507 Ga0070710_100245072 481
279 3300005439 Ga0070711_100060857 Ga0070711_1000608572 481
280 3300005439 Ga0070711_100070536 Ga0070711_1000705362 481
281 3300005445 Ga0070708_100000161 Ga0070708_10000016115 481
282 3300005445 Ga0070708_100010169 Ga0070708_1000101695 481
283 3300005467 Ga0070706_100001828 Ga0070706_10000182815 481
284 3300005468 Ga0070707_100000474 Ga0070707_10000047415 481
285 3300005471 Ga0070698_100000522 Ga0070698_10000052216 481
286 3300005518 Ga0070699_100000493 Ga0070699_10000049313 481
287 3300005536 Ga0070697_100000419 Ga0070697_1000004192 481
288 3300005539 Ga0068853_100022410 Ga0068853_1000224102 481
289 3300006028 Ga0070717_10020283 Ga0070717_100202835 481
290 3300006173 Ga0070716_100005312 Ga0070716_1000053123 481
291 3300006237 Ga0097621_100001297 Ga0097621_10000129711 481
292 3300006358 Ga0068871_100001263 Ga0068871_1000012632 481
293 3300009098 Ga0105245_10001916 Ga0105245_100019169 481
294 3300009098 Ga0105245_10010644 Ga0105245_100106443 481
295 3300009176 Ga0105242_10120089 Ga0105242_101200892 481
296 3300013105 Ga0157369_10058361 Ga0157369_100583612 481
297 3300013297 Ga0157378_10000097 Ga0157378_1000009761 481
298 3300014969 Ga0157376_10035727 Ga0157376_100357272 481
299 3300025898 Ga0207692_10037093 Ga0207692_100370932 481
300 3300025906 Ga0207699_10000815 Ga0207699_100008159 481
301 3300025910 Ga0207684_10000132 Ga0207684_1000013280 481
302 3300025915 Ga0207693_10000090 Ga0207693_1000009023 481
303 3300025915 Ga0207693_10124867 Ga0207693_101248672 481
304 3300025922 Ga0207646_10000554 Ga0207646_1000055415 481
305 3300025922 Ga0207646_10032672 Ga0207646_100326724 481
306 3300025928 Ga0207700_10001662 Ga0207700_100016627 481
307 3300025928 Ga0207700_10002203 Ga0207700_100022035 481
308 3300025929 Ga0207664_10012462 Ga0207664_100124623 481
309 3300025941 Ga0207711_10073343 Ga0207711_100733432 481
310 3300026041 Ga0207639_10037218 Ga0207639_100372182 481
311 3300028800 Ga0265338_10051280 Ga0265338_100512802 481
312 3300028800 Ga0265338_10183762 Ga0265338_101837621 481
313 3300031249 Ga0265339_10051706 Ga0265339_100517062 481
314 3300035117 Ga0373953_0034721 Ga0373953_0034721_371_1852 481
315 3300035170 Ga0373943_0002097 Ga0373943_0002097_5032_6513 481
316 3300035410 Ga0373924_0000145 Ga0373924_0000145_14468_15949 481
317 3300035410 Ga0373924_0014134 Ga0373924_0014134_1208_2689 481
318 3300035695 Ga0373927_0040957 Ga0373927_0040957_310_1791 481
319 3300046472 Ga0495580_0010761 Ga0495580_0010761_2383_3882 481
320 3300046511 Ga0495608_0037469 Ga0495608_0037469_22_1503 481
321 3300048905 Ga0496102_0029142 Ga0496102_0029142_2790_4271 481
322 3300048907 Ga0496104_0244075 Ga0496104_0244075_113_1594 481
323 3300048908 Ga0496105_0002243 Ga0496105_0002243_9320_10801 481
324 3300048908 Ga0496105_0020249 Ga0496105_0020249_2024_3505 481
325 3300048914 Ga0496111_0025289 Ga0496111_0025289_1253_2734 481
326 3300048915 Ga0496112_0002840 Ga0496112_0002840_9556_11037 481
327 3300005338 Ga0068868_100101970 Ga0068868_1001019702 482
328 3300005339 Ga0070660_100001433 Ga0070660_10000143310 482
329 3300005455 Ga0070663_100026335 Ga0070663_1000263354 482
330 3300005468 Ga0070707_100122437 Ga0070707_1001224372 482
331 3300005536 Ga0070697_100060078 Ga0070697_1000600782 482
332 3300005841 Ga0068863_100085262 Ga0068863_1000852622 482
333 3300005841 Ga0068863_100126909 Ga0068863_1001269092 482
334 3300005843 Ga0068860_100055328 Ga0068860_1000553283 482
335 3300006173 Ga0070716_100000010 Ga0070716_10000001031 482
336 3300009174 Ga0105241_10066838 Ga0105241_100668381 482
337 3300013307 Ga0157372_10004068 Ga0157372_100040685 482
338 3300014325 Ga0163163_10022268 Ga0163163_100222682 482
339 3300014745 Ga0157377_10000230 Ga0157377_1000023018 482
340 3300025919 Ga0207657_10003651 Ga0207657_100036514 482
341 3300025920 Ga0207649_10019267 Ga0207649_100192672 482
342 3300025925 Ga0207650_10000216 Ga0207650_1000021637 482
343 3300025928 Ga0207700_10066992 Ga0207700_100669922 482
344 3300025939 Ga0207665_10000010 Ga0207665_1000001029 482
345 3300025940 Ga0207691_10000459 Ga0207691_1000045920 482
346 3300025944 Ga0207661_10000423 Ga0207661_1000042316 482
347 3300026067 Ga0207678_10000328 Ga0207678_1000032831 482
348 3300026088 Ga0207641_10000309 Ga0207641_100003096 482
349 3300026088 Ga0207641_10041938 Ga0207641_100419382 482
350 3300026095 Ga0207676_10000058 Ga0207676_1000005882 482
351 3300026116 Ga0207674_10000148 Ga0207674_1000014819 482
352 3300028381 Ga0268264_10006489 Ga0268264_100064898 482
353 3300048905 Ga0496102_0100793 Ga0496102_0100793_390_1865 482
354 3300048911 Ga0496108_0000170 Ga0496108_0000170_33688_35163 482
355 3300048912 Ga0496109_0000055 Ga0496109_0000055_6669_8144 482
356 3300048913 Ga0496110_0001519 Ga0496110_0001519_7226_8701 482
357 3300048914 Ga0496111_0006648 Ga0496111_0006648_3786_5261 482
358 3300048915 Ga0496112_0011186 Ga0496112_0011186_5047_6522 482
359 3300048916 Ga0496113_0001401 Ga0496113_0001401_16_1491 482
360 3300005330 Ga0070690_100009425 Ga0070690_1000094252 483
361 3300005334 Ga0068869_100037294 Ga0068869_1000372942 483
362 3300005335 Ga0070666_10067504 Ga0070666_100675041 483
363 3300005337 Ga0070682_100027674 Ga0070682_1000276742 483
364 3300005338 Ga0068868_100125194 Ga0068868_1001251941 483
365 3300005339 Ga0070660_100043380 Ga0070660_1000433802 483
366 3300005341 Ga0070691_10030841 Ga0070691_100308412 483
367 3300005344 Ga0070661_100085518 Ga0070661_1000855182 483
368 3300005365 Ga0070688_100080605 Ga0070688_1000806051 483
369 3300005367 Ga0070667_100003922 Ga0070667_1000039222 483
370 3300005444 Ga0070694_100116199 Ga0070694_1001161991 483
371 3300005445 Ga0070708_100000521 Ga0070708_10000052111 483
372 3300005457 Ga0070662_100119480 Ga0070662_1001194802 483
373 3300005459 Ga0068867_100146061 Ga0068867_1001460612 483
374 3300005467 Ga0070706_100003401 Ga0070706_1000034013 483
375 3300005471 Ga0070698_100000084 Ga0070698_1000000849 483
376 3300005536 Ga0070697_100000049 Ga0070697_10000004961 483
377 3300005539 Ga0068853_100048582 Ga0068853_1000485823 483
378 3300005564 Ga0070664_100069268 Ga0070664_1000692682 483
379 3300005577 Ga0068857_100067647 Ga0068857_1000676472 483
380 3300005614 Ga0068856_100006503 Ga0068856_10000650311 483
381 3300005617 Ga0068859_100058561 Ga0068859_1000585613 483
382 3300005718 Ga0068866_10046472 Ga0068866_100464722 483
383 3300005719 Ga0068861_100033808 Ga0068861_1000338081 483
384 3300005841 Ga0068863_100037633 Ga0068863_1000376334 483
385 3300005842 Ga0068858_100199115 Ga0068858_1001991151 483
386 3300005844 Ga0068862_100004707 Ga0068862_1000047074 483
387 3300006931 Ga0097620_100058558 Ga0097620_1000585583 483
388 3300009148 Ga0105243_10019285 Ga0105243_100192852 483
389 3300009177 Ga0105248_10010883 Ga0105248_100108832 483
390 3300011119 Ga0105246_10026088 Ga0105246_100260881 483
391 3300013100 Ga0157373_10134570 Ga0157373_101345702 483
392 3300013102 Ga0157371_10006960 Ga0157371_100069608 483
393 3300013105 Ga0157369_10036672 Ga0157369_100366725 483
394 3300013296 Ga0157374_10010489 Ga0157374_100104897 483
395 3300013297 Ga0157378_10066659 Ga0157378_100666593 483
396 3300013307 Ga0157372_10161562 Ga0157372_101615622 483
397 3300014969 Ga0157376_10038845 Ga0157376_100388453 483
398 3300024227 Ga0228598_1000353 Ga0228598_10003532 483
399 3300025904 Ga0207647_10059259 Ga0207647_100592592 483
400 3300025910 Ga0207684_10002846 Ga0207684_100028468 483
401 3300025912 Ga0207707_10028740 Ga0207707_100287402 483
402 3300025913 Ga0207695_10011348 Ga0207695_100113485 483
403 3300025919 Ga0207657_10000215 Ga0207657_100002158 483
404 3300025923 Ga0207681_10105578 Ga0207681_101055781 483
405 3300025924 Ga0207694_10144820 Ga0207694_101448201 483
406 3300025927 Ga0207687_10004658 Ga0207687_100046582 483
407 3300025933 Ga0207706_10001394 Ga0207706_100013943 483
408 3300025935 Ga0207709_10046629 Ga0207709_100466291 483
409 3300025941 Ga0207711_10003261 Ga0207711_1000326111 483
410 3300025942 Ga0207689_10006218 Ga0207689_100062182 483
411 3300025944 Ga0207661_10065618 Ga0207661_100656182 483
412 3300025949 Ga0207667_10005351 Ga0207667_100053512 483
413 3300025986 Ga0207658_10087886 Ga0207658_100878861 483
414 3300026023 Ga0207677_10080603 Ga0207677_100806032 483
415 3300026035 Ga0207703_10047717 Ga0207703_100477171 483
416 3300026067 Ga0207678_10012112 Ga0207678_100121126 483
417 3300026078 Ga0207702_10031999 Ga0207702_100319992 483
418 3300026088 Ga0207641_10250731 Ga0207641_102507311 483
419 3300026116 Ga0207674_10015331 Ga0207674_100153312 483
420 3300026118 Ga0207675_100035992 Ga0207675_1000359922 483
421 3300028380 Ga0268265_10030362 Ga0268265_100303621 483
422 3300028381 Ga0268264_10052109 Ga0268264_100521092 483
423 3300031090 Ga0265760_10003966 Ga0265760_100039662 483
424 3300031090 Ga0265760_10007715 Ga0265760_100077152 483
425 3300035207 Ga0373942_0007544 Ga0373942_0007544_434_1933 483
426 3300046472 Ga0495580_0042621 Ga0495580_0042621_206_1720 483
427 3300048912 Ga0496109_0168081 Ga0496109_0168081_528_2027 483
428 3300005445 Ga0070708_100019944 Ga0070708_1000199445 484
429 3300005467 Ga0070706_100168984 Ga0070706_1001689841 484
430 3300005468 Ga0070707_100055163 Ga0070707_1000551632 484
431 3300005468 Ga0070707_100154407 Ga0070707_1001544072 484
432 3300005471 Ga0070698_100059121 Ga0070698_1000591212 484
433 3300005518 Ga0070699_100009533 Ga0070699_1000095332 484
434 3300005518 Ga0070699_100066198 Ga0070699_1000661981 484
435 3300005536 Ga0070697_100011648 Ga0070697_1000116485 484
436 3300006163 Ga0070715_10000006 Ga0070715_1000000675 484
437 3300006871 Ga0075434_100037230 Ga0075434_1000372302 484
438 3300007265 Ga0099794_10009807 Ga0099794_100098072 484
439 3300009176 Ga0105242_10000004 Ga0105242_10000004158 484
440 3300025905 Ga0207685_10000010 Ga0207685_10000010115 484
441 3300025910 Ga0207684_10007035 Ga0207684_100070352 484
442 3300025922 Ga0207646_10064012 Ga0207646_100640122 484
443 3300025922 Ga0207646_10078806 Ga0207646_100788062 484
444 3300025928 Ga0207700_10108164 Ga0207700_101081641 484
445 3300025934 Ga0207686_10000005 Ga0207686_1000000579 484
446 3300025934 Ga0207686_10104998 Ga0207686_101049981 484
447 3300025935 Ga0207709_10000133 Ga0207709_1000013378 484
448 3300005439 Ga0070711_100000146 Ga0070711_1000001462 485
449 3300006175 Ga0070712_100000102 Ga0070712_10000010221 485
450 3300006871 Ga0075434_100001105 Ga0075434_10000110510 485
451 3300025915 Ga0207693_10000937 Ga0207693_100009373 485
452 3300025916 Ga0207663_10007167 Ga0207663_100071674 485
453 3300046472 Ga0495580_0118502 Ga0495580_0118502_114_1607 485
454 3300050512 nmdc:mga0n895_2891_c1 nmdc:mga0n895_2891_c1_3000_4505 485
455 3300050515 nmdc:mga0a205_26205_c1 nmdc:mga0a205_26205_c1_2929_4434 485
456 3300005364 Ga0070673_100046750 Ga0070673_1000467503 486
457 3300005445 Ga0070708_100028877 Ga0070708_1000288772 486
458 3300005467 Ga0070706_100003249 Ga0070706_10000324915 486
459 3300005468 Ga0070707_100015523 Ga0070707_1000155232 486
460 3300005468 Ga0070707_100102943 Ga0070707_1001029432 486
461 3300005471 Ga0070698_100001177 Ga0070698_10000117728 486
462 3300005536 Ga0070697_100020286 Ga0070697_1000202864 486
463 3300005841 Ga0068863_100230300 Ga0068863_1002303001 486
464 3300009147 Ga0114129_10028387 Ga0114129_100283872 486
465 3300025910 Ga0207684_10005482 Ga0207684_100054829 486
466 3300025922 Ga0207646_10055936 Ga0207646_100559362 486
467 3300025934 Ga0207686_10000676 Ga0207686_1000067618 486
468 3300025935 Ga0207709_10000754 Ga0207709_100007546 486
469 3300039450 Ga0436363_0650696 Ga0436363_0650696_342_1832 486
470 3300005436 Ga0070713_100162839 Ga0070713_1001628392 487
471 3300025928 Ga0207700_10037418 Ga0207700_100374182 487
472 3300005719 Ga0068861_100113008 Ga0068861_1001130082 489
473 3300006358 Ga0068871_100070791 Ga0068871_1000707912 489
474 3300013306 Ga0163162_10039604 Ga0163162_100396043 489
475 3300025911 Ga0207654_10045264 Ga0207654_100452642 489
476 3300025927 Ga0207687_10142925 Ga0207687_101429251 489
477 3300025942 Ga0207689_10006579 Ga0207689_100065797 489
478 3300026118 Ga0207675_100007175 Ga0207675_1000071757 489
479 3300045051 Ga0451576_0038878 Ga0451576_0038878_2583_4064 489
480 3300048905 Ga0496102_0008897 Ga0496102_0008897_4634_6169 489
481 3300048907 Ga0496104_0024786 Ga0496104_0024786_3531_5066 489
482 3300048909 Ga0496106_0120149 Ga0496106_0120149_173_1708 489
483 3300025931 Ga0207644_10000206 Ga0207644_1000020623 490
484 3300046473 Ga0495582_0017869 Ga0495582_0017869_655_2199 490
485 3300002074 JGI24748J21848_1000039 JGI24748J21848_10000398 493
486 3300002239 JGI24034J26672_10000042 JGI24034J26672_100000428 493
487 3300002239 JGI24034J26672_10000043 JGI24034J26672_100000438 493
488 3300005842 Ga0068858_100000053 Ga0068858_10000005338 493
489 3300009101 Ga0105247_10000052 Ga0105247_1000005278 493
490 3300025223 Ga0207672_1000463 Ga0207672_10004632 493
491 3300025900 Ga0207710_10000004 Ga0207710_10000004429 493
492 3300026035 Ga0207703_10000093 Ga0207703_1000009362 493

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

53

511

0.8

PF13520

AA_permease_2

Amino acid permease

49

501

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a6l-assembly1.cif.gz_B human 4f2hc-lat2 heterodimeric amino acid transporter in complex with anticalin d11vs 0.882 23 469
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8754 24 481
7p9v-assembly1.cif.gz_B cryo em structure of system xc- 0.875 24 470
7nf6-assembly1.cif.gz_B ovine b0,+at-rbat heterodimer 0.8737 23 469
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8696 24 481
ID Description Score Start End Superfamily
af_Q8IR48_79_518_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.917 17 474 1.20.1740.10
af_Q50E62_26_473_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9121 17 474 1.20.1740.10
af_Q8IR48_79_518_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9029 17 474 1.20.1740.10
af_A0A0B4KHK8_45_488_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9014 19 488 1.20.1740.10
af_Q9Y1A7_38_480_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9009 17 469 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A838NY37-F1-model_v4 Amino acid permease 0.9241 49 474 GO:0005886
GO:0022857
AF-A0A7Z9GBJ4-F1-model_v4 Amino acid permease 0.9221 59 475 GO:0005886
GO:0022857
AF-A0A069CSB7-F1-model_v4 Amino acid transporter 0.9183 24 474 GO:0005886
GO:0022857
AF-A0A428IXK5-F1-model_v4 Amino acid permease 0.9095 22 474 GO:0005886
GO:0015179
AF-A0A7J4KSN1-F1-model_v4 Amino acid permease 0.9095 23 469 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map