F453797

General Info

Members Datasets Scaffolds Average Seq Length
489 233 978 312

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100082229|Ga0207675_1000822293
Length 358
Sequence MPQSPEATGSTATAMRCSSRKADLVVSRLQPDPGRWFRLSGKRYTTMPFTYDDFDLRDVKTYPLKSRKSKAHVEDFARPAGGAPTVAAFVDALPNILAAADFKAVVAAIRTAARTDAGVVWGLGAHVIKTGLGPVLIDLMERGFVSAIATNGAAIIHDFEIALVGATSEDVDEALGPGRFGMAEETGRLLNAAISDGVAAGLGIGQAVTGFFAGKEPQFARQSVLAAAARLRIPVTVHVAIGTDIIHMHPAASGAALGDGSLRDFRYFVSNVARLERGVFLNCGSAVVLPEVFLKAVALARNKGIALAGLTTVNLDFVRSYRPQTNVVSRPTAGGGRGYSIVGHHEIMIPLLAAALSE

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 5.32
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100082229 3300026118 Bacteria 3020
2 Ga0070658_10317920 3300005327 Bacteria 1329
3 Ga0070676_10040968 3300005328 Bacteria 2684
4 Ga0070676_10210530 3300005328 Bacteria 1279
5 Ga0070683_100001607 3300005329 Bacteria 17479
6 Ga0070683_100039717 3300005329 Bacteria 4322
7 Ga0070690_100015464 3300005330 Bacteria 4553
8 Ga0070690_100020294 3300005330 Bacteria 4048
9 Ga0070670_100032723 3300005331 Bacteria 4479
10 Ga0070670_100036869 3300005331 Bacteria 4207
11 Ga0070670_100046997 3300005331 Bacteria 3714
12 Ga0070677_10058796 3300005333 Bacteria 1580
13 Ga0068869_100144688 3300005334 Bacteria 1839
14 Ga0070666_10034573 3300005335 Bacteria 3350
15 Ga0070666_10041817 3300005335 Bacteria 3064
16 Ga0070680_100284680 3300005336 Bacteria 1401
17 Ga0068868_100112910 3300005338 Bacteria 2209
18 Ga0070660_100033011 3300005339 Bacteria 3899
19 Ga0070689_100488766 3300005340 Bacteria 1053
20 Ga0070691_10001036 3300005341 Bacteria 11430
21 Ga0070661_100034543 3300005344 Bacteria 3667
22 Ga0070668_100084400 3300005347 Bacteria 2494
23 Ga0070669_100004259 3300005353 Bacteria 10331
24 Ga0070669_100013003 3300005353 Bacteria 5911
25 Ga0070669_100026845 3300005353 Bacteria 4144
26 Ga0070675_100000147 3300005354 Bacteria 42295
27 Ga0070675_100021497 3300005354 Bacteria 5158
28 Ga0070675_100039069 3300005354 Bacteria 3871
29 Ga0070675_100185169 3300005354 Bacteria 1802
30 Ga0070675_100284584 3300005354 Bacteria 1454
31 Ga0070671_100001353 3300005355 Bacteria 18364
32 Ga0070671_100038433 3300005355 Bacteria 3973
33 Ga0070671_100043695 3300005355 Bacteria 3724
34 Ga0070674_100004114 3300005356 Bacteria 8261
35 Ga0070674_100075542 3300005356 Bacteria 2393
36 Ga0070674_100080761 3300005356 Bacteria 2322
37 Ga0070673_100036797 3300005364 Bacteria 3725
38 Ga0070673_100050297 3300005364 Unclassified 3258
39 Ga0070673_100088967 3300005364 Bacteria 2520
40 Ga0070688_100006547 3300005365 Bacteria 6231
41 Ga0070688_100021145 3300005365 Bacteria 3797
42 Ga0070688_100062876 3300005365 Bacteria 2351
43 Ga0070688_100151431 3300005365 Bacteria 1586
44 Ga0070667_100021430 3300005367 Bacteria 5366
45 Ga0070667_100030019 3300005367 Bacteria 4534
46 Ga0070714_100064654 3300005435 Bacteria 3150
47 Ga0070705_100027167 3300005440 Bacteria 3123
48 Ga0070700_100007688 3300005441 Bacteria 5834
49 Ga0070700_100169950 3300005441 Bacteria 1509
50 Ga0070694_100037985 3300005444 Bacteria 3196
51 Ga0070708_100035155 3300005445 Bacteria 4364
52 Ga0070708_100065999 3300005445 Bacteria 3247
53 Ga0070663_100300854 3300005455 Unclassified 1284
54 Ga0070678_100115173 3300005456 Bacteria 2110
55 Ga0070662_100039419 3300005457 Bacteria 3360
56 Ga0070662_100132396 3300005457 Bacteria 1924
57 Ga0070681_10017150 3300005458 Bacteria 7240
58 Ga0070681_10530569 3300005458 Bacteria 1090
59 Ga0068867_100043386 3300005459 Bacteria 3293
60 Ga0068867_100128448 3300005459 Bacteria 1967
61 Ga0068867_100343627 3300005459 Bacteria 1243
62 Ga0070685_10010170 3300005466 Bacteria 4884
63 Ga0070706_100371201 3300005467 Bacteria 1333
64 Ga0070707_100059469 3300005468 Bacteria 3666
65 Ga0070707_100101243 3300005468 Bacteria 2792
66 Ga0070698_100163366 3300005471 Bacteria 2170
67 Ga0070698_100267835 3300005471 Unclassified 1640
68 Ga0070699_100001909 3300005518 Bacteria 18820
69 Ga0070699_100074203 3300005518 Bacteria 2960
70 Ga0070699_100184521 3300005518 Bacteria 1852
71 Ga0070679_100231375 3300005530 Bacteria 1808
72 Ga0070684_100000291 3300005535 Bacteria 34899
73 Ga0070697_100056986 3300005536 Bacteria 3180
74 Ga0070697_100101328 3300005536 Bacteria 2393
75 Ga0070672_100196629 3300005543 Bacteria 1685
76 Ga0070686_100001956 3300005544 Bacteria 11434
77 Ga0070686_100029981 3300005544 Bacteria 3314
78 Ga0070686_100038802 3300005544 Bacteria 2963
79 Ga0070686_100072991 3300005544 Bacteria 2252
80 Ga0070686_100073428 3300005544 Bacteria 2246
81 Ga0070695_100007855 3300005545 Bacteria 6319
82 Ga0070696_100019788 3300005546 Bacteria 4562
83 Ga0070665_100034316 3300005548 Bacteria 5103
84 Ga0070665_100062347 3300005548 Bacteria 3738
85 Ga0070704_100001892 3300005549 Bacteria 11542
86 Ga0070704_100010266 3300005549 Bacteria 5694
87 Ga0070704_100015463 3300005549 Bacteria 4793
88 Ga0070704_100441814 3300005549 Bacteria 1118
89 Ga0068855_100313082 3300005563 Bacteria 1736
90 Ga0070664_100000724 3300005564 Bacteria 25341
91 Ga0070664_100023298 3300005564 Bacteria 5113
92 Ga0070664_100172869 3300005564 Bacteria 1917
93 Ga0068857_100366028 3300005577 Unclassified 1337
94 Ga0068854_100030731 3300005578 Bacteria 3728
95 Ga0068854_100083985 3300005578 Bacteria 2355
96 Ga0070702_100010598 3300005615 Bacteria 4548
97 Ga0068852_100146202 3300005616 Bacteria 2193
98 Ga0068859_100149835 3300005617 Bacteria 2408
99 Ga0068859_100330845 3300005617 Bacteria 1618
100 Ga0068864_100026062 3300005618 Bacteria 4928
101 Ga0068864_100273979 3300005618 Bacteria 1573
102 Ga0068864_100442841 3300005618 Bacteria 1241
103 Ga0068866_10061230 3300005718 Bacteria 1954
104 Ga0068861_100002556 3300005719 Bacteria 11896
105 Ga0068861_100097752 3300005719 Bacteria 2329
106 Ga0068861_100120624 3300005719 Bacteria 2115
107 Ga0068861_100358908 3300005719 Bacteria 1281
108 Ga0068863_100002769 3300005841 Bacteria 17372
109 Ga0068858_100004497 3300005842 Bacteria 13660
110 Ga0068858_100144637 3300005842 Bacteria 2232
111 Ga0068858_100165935 3300005842 Bacteria 2081
112 Ga0068860_100122477 3300005843 Bacteria 2491
113 Ga0068860_100699913 3300005843 Bacteria 1023
114 Ga0068862_100038879 3300005844 Bacteria 4038
115 Ga0068862_100128398 3300005844 Bacteria 2240
116 Ga0068862_100273530 3300005844 Bacteria 1546
117 Ga0081539_10005405 3300005985 Bacteria 13071
118 Ga0081539_10124830 3300005985 Bacteria 1273
119 Ga0075365_10021668 3300006038 Bacteria 4012
120 Ga0075368_10015203 3300006042 Bacteria 2851
121 Ga0075368_10018939 3300006042 Bacteria 2594
122 Ga0075364_10035942 3300006051 Bacteria 3201
123 Ga0070716_100000014 3300006173 Bacteria 92762
124 Ga0075367_10059046 3300006178 Bacteria 2283
125 Ga0097621_100003404 3300006237 Bacteria 10953
126 Ga0075370_10007352 3300006353 Bacteria 5605
127 Ga0068871_100001727 3300006358 Bacteria 14708
128 Ga0068871_100282746 3300006358 Bacteria 1452
129 Ga0075428_100049494 3300006844 Bacteria 4610
130 Ga0075428_100051920 3300006844 Bacteria 4496
131 Ga0075430_100000735 3300006846 Bacteria 25106
132 Ga0075431_100034071 3300006847 Bacteria 5248
133 Ga0075433_10024234 3300006852 Bacteria 5119
134 Ga0075433_10038816 3300006852 Bacteria 4114
135 Ga0075433_10042066 3300006852 Bacteria 3963
136 Ga0075433_10046445 3300006852 Unclassified 3777
137 Ga0075433_10372814 3300006852 Bacteria 1260
138 Ga0075434_100000097 3300006871 Bacteria 48724
139 Ga0075434_100016754 3300006871 Bacteria 7050
140 Ga0075434_100080958 3300006871 Bacteria 3244
141 Ga0075434_100108453 3300006871 Bacteria 2787
142 Ga0075434_100176783 3300006871 Bacteria 2154
143 Ga0075434_100319558 3300006871 Unclassified 1573
144 Ga0075429_100032817 3300006880 Bacteria 4512
145 Ga0068865_100002725 3300006881 Bacteria 10488
146 Ga0068865_100253252 3300006881 Bacteria 1390
147 Ga0075436_100000341 3300006914 Bacteria 29776
148 Ga0075436_100011103 3300006914 Bacteria 6177
149 Ga0075436_100012951 3300006914 Bacteria 5718
150 Ga0075436_100020540 3300006914 Bacteria 4533
151 Ga0075436_100030832 3300006914 Bacteria 3690
152 Ga0075436_100084453 3300006914 Bacteria 2203
153 Ga0075436_100189972 3300006914 Bacteria 1453
154 Ga0075436_100201667 3300006914 Bacteria 1409
155 Ga0097620_100149842 3300006931 Bacteria 2408
156 Ga0097620_100330852 3300006931 Bacteria 1618
157 Ga0075435_100000149 3300007076 Bacteria 39747
158 Ga0075435_100000353 3300007076 Bacteria 28240
159 Ga0075435_100004330 3300007076 Bacteria 9762
160 Ga0075435_100016083 3300007076 Bacteria 5635
161 Ga0075435_100041679 3300007076 Bacteria 3671
162 Ga0075435_100075065 3300007076 Bacteria 2767
163 Ga0075435_100108398 3300007076 Bacteria 2307
164 Ga0075435_100309917 3300007076 Bacteria 1351
165 Ga0075435_100341611 3300007076 Bacteria 1283
166 Ga0105240_10033201 3300009093 Bacteria 6671
167 Ga0105240_10057740 3300009093 Bacteria 4846
168 Ga0105240_10215252 3300009093 Bacteria 2242
169 Ga0111539_10000870 3300009094 Bacteria 39436
170 Ga0111539_10002313 3300009094 Bacteria 25348
171 Ga0111539_10015720 3300009094 Bacteria 9404
172 Ga0111539_10020895 3300009094 Bacteria 8061
173 Ga0111539_10134239 3300009094 Bacteria 2898
174 Ga0111539_10204358 3300009094 Bacteria 2303
175 Ga0111539_10362188 3300009094 Bacteria 1688
176 Ga0111539_10371999 3300009094 Bacteria 1663
177 Ga0105245_10018703 3300009098 Bacteria 6061
178 Ga0105245_10187449 3300009098 Bacteria 1980
179 Ga0105247_10068374 3300009101 Bacteria 2215
180 Ga0114129_10001588 3300009147 Bacteria 30837
181 Ga0114129_10003979 3300009147 Bacteria 20871
182 Ga0114129_10007344 3300009147 Bacteria 15689
183 Ga0114129_10013168 3300009147 Bacteria 11783
184 Ga0114129_10014381 3300009147 Bacteria 11281
185 Ga0114129_10018285 3300009147 Bacteria 9983
186 Ga0114129_10018457 3300009147 Bacteria 9937
187 Ga0114129_10019030 3300009147 Bacteria 9782
188 Ga0114129_10042374 3300009147 Bacteria 6411
189 Ga0114129_10064903 3300009147 Bacteria 5096
190 Ga0114129_10309651 3300009147 Bacteria 2102
191 Ga0114129_10314362 3300009147 Bacteria 2084
192 Ga0114129_10927734 3300009147 Unclassified 1101
193 Ga0105243_10056531 3300009148 Bacteria 3121
194 Ga0105241_10060335 3300009174 Bacteria 2918
195 Ga0105242_10005116 3300009176 Bacteria 10115
196 Ga0105242_10023674 3300009176 Bacteria 4841
197 Ga0105242_10361489 3300009176 Bacteria 1344
198 Ga0105248_10007182 3300009177 Bacteria 12221
199 Ga0105248_10020451 3300009177 Bacteria 7334
200 Ga0105248_10030306 3300009177 Bacteria 6040
201 Ga0105248_10031454 3300009177 Bacteria 5932
202 Ga0105248_10034422 3300009177 Bacteria 5664
203 Ga0105248_10058602 3300009177 Bacteria 4325
204 Ga0105248_10060602 3300009177 Bacteria 4249
205 Ga0105248_10399350 3300009177 Bacteria 1548
206 Ga0105248_10407369 3300009177 Bacteria 1531
207 Ga0105238_10286630 3300009551 Bacteria 1629
208 Ga0105238_10628809 3300009551 Bacteria 1083
209 Ga0105249_10166205 3300009553 Bacteria 2136
210 Ga0105239_10240311 3300010375 Bacteria 2033
211 Ga0157378_10102739 3300013297 Bacteria 2611
212 Ga0157378_10562072 3300013297 Unclassified 1148
213 Ga0163162_10058052 3300013306 Bacteria 3898
214 Ga0163162_10326975 3300013306 Bacteria 1666
215 Ga0157375_10057963 3300013308 Bacteria 3830
216 Ga0157375_10273159 3300013308 Bacteria 1852
217 Ga0157375_10343450 3300013308 Bacteria 1658
218 Ga0163163_10006478 3300014325 Bacteria 10246
219 Ga0163163_10008769 3300014325 Bacteria 9000
220 Ga0163163_10025968 3300014325 Bacteria 5592
221 Ga0163163_10217579 3300014325 Bacteria 1959
222 Ga0163163_10285036 3300014325 Bacteria 1704
223 Ga0157380_10064407 3300014326 Bacteria 2943
224 Ga0157380_10100085 3300014326 Bacteria 2412
225 Ga0157380_10392859 3300014326 Bacteria 1313
226 Ga0157380_10437710 3300014326 Bacteria 1252
227 Ga0157379_10007571 3300014968 Bacteria 9403
228 Ga0157376_10009444 3300014969 Bacteria 7081
229 Ga0157376_10107407 3300014969 Bacteria 2450
230 Ga0157376_10212255 3300014969 Bacteria 1788
231 Ga0157376_10354414 3300014969 Bacteria 1405
232 Ga0182007_10074187 3300015262 Bacteria 1115
233 Ga0207642_10172800 3300025899 Bacteria 1171
234 Ga0207688_10022774 3300025901 Bacteria 3430
235 Ga0207688_10068232 3300025901 Bacteria 2013
236 Ga0207680_10008368 3300025903 Bacteria 5074
237 Ga0207680_10019404 3300025903 Bacteria 3636
238 Ga0207680_10019566 3300025903 Bacteria 3623
239 Ga0207680_10240406 3300025903 Bacteria 1248
240 Ga0207645_10000374 3300025907 Bacteria 37092
241 Ga0207645_10060154 3300025907 Bacteria 2426
242 Ga0207707_10036257 3300025912 Bacteria 4313
243 Ga0207707_10382796 3300025912 Bacteria 1209
244 Ga0207695_10049166 3300025913 Bacteria 4447
245 Ga0207662_10012896 3300025918 Bacteria 4664
246 Ga0207662_10076506 3300025918 Bacteria 2034
247 Ga0207657_10000448 3300025919 Bacteria 43812
248 Ga0207649_10089302 3300025920 Bacteria 2014
249 Ga0207646_10045039 3300025922 Bacteria 3960
250 Ga0207646_10128290 3300025922 Bacteria 2281
251 Ga0207646_10142451 3300025922 Unclassified 2159
252 Ga0207646_10154072 3300025922 Bacteria 2072
253 Ga0207681_10010167 3300025923 Bacteria 5762
254 Ga0207681_10120585 3300025923 Unclassified 1923
255 Ga0207694_10275596 3300025924 Bacteria 1381
256 Ga0207650_10068670 3300025925 Bacteria 2662
257 Ga0207659_10000075 3300025926 Bacteria 63221
258 Ga0207659_10145249 3300025926 Bacteria 1846
259 Ga0207687_10052962 3300025927 Bacteria 2833
260 Ga0207664_10019392 3300025929 Bacteria 5026
261 Ga0207644_10309742 3300025931 Bacteria 1274
262 Ga0207706_10104334 3300025933 Bacteria 2494
263 Ga0207706_10178768 3300025933 Bacteria 1864
264 Ga0207686_10016246 3300025934 Bacteria 4174
265 Ga0207686_10158865 3300025934 Bacteria 1582
266 Ga0207709_10226296 3300025935 Bacteria 1352
267 Ga0207709_10421155 3300025935 Bacteria 1026
268 Ga0207670_10006763 3300025936 Bacteria 6374
269 Ga0207669_10165206 3300025937 Bacteria 1569
270 Ga0207669_10168952 3300025937 Bacteria 1554
271 Ga0207669_10232495 3300025937 Unclassified 1361
272 Ga0207704_10002338 3300025938 Bacteria 8521
273 Ga0207704_10235007 3300025938 Bacteria 1366
274 Ga0207665_10000029 3300025939 Bacteria 95174
275 Ga0207691_10063765 3300025940 Bacteria 3341
276 Ga0207691_10435302 3300025940 Bacteria 1117
277 Ga0207711_10012847 3300025941 Bacteria 6957
278 Ga0207711_10013002 3300025941 Bacteria 6913
279 Ga0207711_10038778 3300025941 Bacteria 4051
280 Ga0207711_10113083 3300025941 Bacteria 2417
281 Ga0207711_10233687 3300025941 Bacteria 1684
282 Ga0207711_10385127 3300025941 Bacteria 1301
283 Ga0207679_10014814 3300025945 Bacteria 5136
284 Ga0207679_10073854 3300025945 Bacteria 2582
285 Ga0207651_10018356 3300025960 Unclassified 4160
286 Ga0207651_10023357 3300025960 Bacteria 3802
287 Ga0207651_10081917 3300025960 Bacteria 2328
288 Ga0207651_10134611 3300025960 Bacteria 1898
289 Ga0207651_10214189 3300025960 Bacteria 1553
290 Ga0207712_10256094 3300025961 Bacteria 1417
291 Ga0207640_10022849 3300025981 Bacteria 3750
292 Ga0207640_10083201 3300025981 Bacteria 2194
293 Ga0207658_10233019 3300025986 Bacteria 1555
294 Ga0207703_10076932 3300026035 Bacteria 2769
295 Ga0207703_10204513 3300026035 Bacteria 1756
296 Ga0207703_10354598 3300026035 Bacteria 1351
297 Ga0207708_10002808 3300026075 Bacteria 12801
298 Ga0207708_10006299 3300026075 Bacteria 8797
299 Ga0207641_10014394 3300026088 Bacteria 6482
300 Ga0207648_10162385 3300026089 Bacteria 1973
301 Ga0207648_10199925 3300026089 Bacteria 1772
302 Ga0207648_10233526 3300026089 Bacteria 1636
303 Ga0207676_10053771 3300026095 Bacteria 3152
304 Ga0207675_100003224 3300026118 Bacteria 15999
305 Ga0207675_100018383 3300026118 Bacteria 6518
306 Ga0207675_100096405 3300026118 Bacteria 2784
307 Ga0207675_100326638 3300026118 Bacteria 1499
308 Ga0207675_100538348 3300026118 Bacteria 1166
309 Ga0207683_10026204 3300026121 Bacteria 5032
310 Ga0207683_10312591 3300026121 Bacteria 1438
311 Ga0207698_10087735 3300026142 Bacteria 2535
312 Ga0209813_10007312 3300027866 Bacteria 2749
313 Ga0207428_10000385 3300027907 Bacteria 55418
314 Ga0207428_10009579 3300027907 Bacteria 8675
315 Ga0207428_10012805 3300027907 Bacteria 7356
316 Ga0207428_10019067 3300027907 Bacteria 5850
317 Ga0207428_10099604 3300027907 Bacteria 2247
318 Ga0207428_10165204 3300027907 Bacteria 1679
319 Ga0207428_10310373 3300027907 Unclassified 1166
320 Ga0268266_10242562 3300028379 Bacteria 1664
321 Ga0268265_10006019 3300028380 Bacteria 8253
322 Ga0268265_10024471 3300028380 Bacteria 4272
323 Ga0268265_10303159 3300028380 Bacteria 1439
324 Ga0307408_100002466 3300031548 Bacteria 12973
325 Ga0307408_100086699 3300031548 Unclassified 2354
326 Ga0307408_100107350 3300031548 Bacteria 2138
327 Ga0307406_10150979 3300031901 Bacteria 1657
328 Ga0307407_10079956 3300031903 Bacteria 1974
329 Ga0307412_10109095 3300031911 Bacteria 1973
330 Ga0307412_10426950 3300031911 Bacteria 1085
331 Ga0307416_100137539 3300032002 Bacteria 2213
332 Ga0307416_100182271 3300032002 Bacteria 1969
333 Ga0307416_100399586 3300032002 Bacteria 1411
334 Ga0307411_10005293 3300032005 Bacteria 6320
335 Ga0307411_10159346 3300032005 Bacteria 1688
336 Ga0307411_10377048 3300032005 Bacteria 1165
337 Ga0307415_100285367 3300032126 Bacteria 1360
338 Ga0373948_0002290 3300034817 Bacteria 2806
339 Ga0373950_0000745 3300034818 Bacteria 4047
340 Ga0373958_0000974 3300034819 Bacteria 3729
341 Ga0373959_0002259 3300034820 Bacteria 3068
342 Ga0373938_0004632 3300034957 Bacteria 2308
343 Ga0373929_0011882 3300035085 Bacteria 1647
344 Ga0373940_0021577 3300035088 Bacteria 1647
345 Ga0373949_0000538 3300035090 Bacteria 12498
346 Ga0373951_0002318 3300035091 Bacteria 4831
347 Ga0373952_0001646 3300035092 Bacteria 4064
348 Ga0373932_0000622 3300035112 Bacteria 10731
349 Ga0373939_0002425 3300035114 Bacteria 4393
350 Ga0373941_0000120 3300035115 Bacteria 13418
351 Ga0373957_0012380 3300035120 Bacteria 2871
352 Ga0373943_0007910 3300035170 Unclassified 4772
353 Ga0373942_0000368 3300035207 Bacteria 12447
354 Ga0373961_0000583 3300035241 Bacteria 13650
355 Ga0373962_0004572 3300035242 Bacteria 3347
356 Ga0373924_0060294 3300035410 Unclassified 1586
357 Ga0373924_0099754 3300035410 Bacteria 1248
358 Ga0373931_0050563 3300035691 Bacteria 2211
359 Ga0373935_0006658 3300035692 Bacteria 6903
360 Ga0373927_0233489 3300035695 Bacteria 1209
361 Ga0373933_0229427 3300035724 Bacteria 1192
362 Ga0373947_0005356 3300035725 Bacteria 7490
363 Ga0373937_0047270 3300036401 Bacteria 3937
364 Ga0395905_0077472 3300037471 Bacteria 3115
365 Ga0439435_0002711 3300042436 Bacteria 3567
366 Ga0439435_0010377 3300042436 Bacteria 2210
367 Ga0439435_0025719 3300042436 Bacteria 1563
368 Ga0439464_0004641 3300042439 Bacteria 3520
369 Ga0451577_0178461 3300042876 Bacteria 1914
370 Ga0451576_0005245 3300045051 Bacteria 16359
371 Ga0451576_0224467 3300045051 Bacteria 1961
372 Ga0451576_0240122 3300045051 Bacteria 1893
373 Ga0466967_0247556 3300045976 Bacteria 1702
374 Ga0495629_0195551 3300046459 Unclassified 1399
375 Ga0495582_0087762 3300046473 Bacteria 1732
376 Ga0495586_0078466 3300046535 Bacteria 1812
377 Ga0495598_0059850 3300046537 Bacteria 1172
378 Ga0495621_0039642 3300046539 Bacteria 1648
379 Ga0495645_0003365 3300046543 Bacteria 10837
380 Ga0495658_0070124 3300046683 Bacteria 2033
381 Ga0495669_0005747 3300046684 Bacteria 5172
382 Ga0495613_0085050 3300046689 Bacteria 2296
383 Ga0495604_0247701 3300047317 Bacteria 1216
384 Ga0495674_0034386 3300047319 Bacteria 4585
385 Ga0495684_0027830 3300047471 Bacteria 4342
386 Ga0496101_0365911 3300048904 Bacteria 1134
387 Ga0496102_0110628 3300048905 Bacteria 2561
388 Ga0496102_0139541 3300048905 Bacteria 2272
389 Ga0496103_0303839 3300048906 Unclassified 1026
390 Ga0496104_0000157 3300048907 Bacteria 61755
391 Ga0496104_0084385 3300048907 Bacteria 3031
392 Ga0496104_0562750 3300048907 Unclassified 1051
393 Ga0496106_0099168 3300048909 Bacteria 2258
394 Ga0496106_0158824 3300048909 Bacteria 1787
395 Ga0496107_0180826 3300048910 Bacteria 1566
396 Ga0496108_0003567 3300048911 Bacteria 12468
397 Ga0496108_0120816 3300048911 Bacteria 2247
398 Ga0496109_0010468 3300048912 Bacteria 7924
399 Ga0496110_0001487 3300048913 Bacteria 16980
400 Ga0496110_0287911 3300048913 Bacteria 1496
401 Ga0496111_0008114 3300048914 Bacteria 6935
402 Ga0496112_0000148 3300048915 Bacteria 44089
403 Ga0496112_0016116 3300048915 Bacteria 6988
404 Ga0496112_0104402 3300048915 Bacteria 2804
405 Ga0496112_0136679 3300048915 Bacteria 2421
406 Ga0496112_0165829 3300048915 Bacteria 2175
407 Ga0496112_0539352 3300048915 Bacteria 1101
408 Ga0496113_0079890 3300048916 Bacteria 2504
409 Ga0496114_0129871 3300048917 Bacteria 2175
410 Ga0496114_0371394 3300048917 Bacteria 1266
411 Ga0496114_0436716 3300048917 Bacteria 1159
412 Ga0501034_0070296 3300049571 Bacteria 3512
413 Ga0501039_0039611 3300049575 Bacteria 3640
414 Ga0501041_0007813 3300049577 Bacteria 6285
415 Ga0501047_0035489 3300049581 Bacteria 4818
416 Ga0501047_0064182 3300049581 Bacteria 3542
417 Ga0501071_0151795 3300049587 Bacteria 1728
418 Ga0501072_0101554 3300049588 Bacteria 2286
419 Ga0501074_0045986 3300049590 Bacteria 3157
420 Ga0501075_0206304 3300049591 Bacteria 1499
421 Ga0501075_0224485 3300049591 Bacteria 1433
422 Ga0501081_0017446 3300049743 Bacteria 4752
423 Ga0501081_0087589 3300049743 Bacteria 2187
424 Ga0501044_0018212 3300049823 Bacteria 7532
425 Ga0501045_0113934 3300049824 Bacteria 2005
426 nmdc:mga0yw44_40241_c1 3300050492 Bacteria 2776
427 nmdc:mga0k408_35882_c1 3300050493 Bacteria 2844
428 nmdc:mga0k408_51912_c1 3300050493 Bacteria 2376
429 nmdc:mga04h51_10683_c1 3300050495 Bacteria 2528
430 nmdc:mga04h51_22527_c1 3300050495 Bacteria 1907
431 nmdc:mga07m45_1562_c1 3300050496 Bacteria 10536
432 nmdc:mga05p37_1107_c1 3300050507 Bacteria 28841
433 nmdc:mga05p37_18704_c1 3300050507 Bacteria 8372
434 nmdc:mga05p37_18828_c1 3300050507 Bacteria 8345
435 nmdc:mga05p37_2459_c1 3300050507 Bacteria 21542
436 nmdc:mga05p37_270261_c1 3300050507 Unclassified 2032
437 nmdc:mga05p37_300870_c1 3300050507 Unclassified 1906
438 nmdc:mga05p37_301737_c1 3300050507 Bacteria 1902
439 nmdc:mga05p37_34176_c1 3300050507 Bacteria 6226
440 nmdc:mga05p37_4615_c1 3300050507 Bacteria 16106
441 nmdc:mga05p37_75526_c1 3300050507 Bacteria 4148
442 nmdc:mga05p37_79945_c1 3300050507 Bacteria 4026
443 nmdc:mga05p37_9829_c1 3300050507 Bacteria 11354
444 nmdc:mga09592_150945_c1 3300050508 Bacteria 2004
445 nmdc:mga09592_216216_c1 3300050508 Bacteria 1661
446 nmdc:mga09592_94528_c1 3300050508 Bacteria 2556
447 nmdc:mga0qj67_18661_c1 3300050509 Bacteria 5288
448 nmdc:mga06r32_16928_c1 3300050510 Bacteria 6651
449 nmdc:mga06r32_303993_c1 3300050510 Unclassified 1581
450 nmdc:mga06r32_94331_c1 3300050510 Bacteria 2928
451 nmdc:mga08y16_108403_c1 3300050511 Bacteria 2891
452 nmdc:mga08y16_1540_c1 3300050511 Bacteria 23195
453 nmdc:mga08y16_268843_c1 3300050511 Bacteria 1760
454 nmdc:mga08y16_273951_c1 3300050511 Bacteria 1742
455 nmdc:mga08y16_34271_c1 3300050511 Bacteria 5334
456 nmdc:mga08y16_36151_c1 3300050511 Bacteria 5187
457 nmdc:mga08y16_5338_c1 3300050511 Bacteria 13444
458 nmdc:mga08y16_680_c1 3300050511 Bacteria 32152
459 nmdc:mga0n895_122884_c1 3300050512 Bacteria 2618
460 nmdc:mga0n895_176356_c1 3300050512 Bacteria 2168
461 nmdc:mga0n895_275539_c1 3300050512 Bacteria 1706
462 nmdc:mga0n895_50708_c1 3300050512 Bacteria 4069
463 nmdc:mga0n895_58368_c1 3300050512 Bacteria 3805
464 nmdc:mga0n895_6669_c1 3300050512 Bacteria 9841
465 nmdc:mga0n895_91483_c1 3300050512 Bacteria 3045
466 nmdc:mga0rr50_1053_c1 3300050513 Bacteria 15000
467 nmdc:mga0rr50_260407_c1 3300050513 Bacteria 1443
468 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
469 nmdc:mga0rr50_327143_c1 3300050513 Bacteria 1286
470 nmdc:mga0rr50_33927_c1 3300050513 Bacteria 3650
471 nmdc:mga0rr50_57566_c1 3300050513 Bacteria 2908
472 nmdc:mga0rr50_73571_c1 3300050513 Bacteria 2613
473 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
474 nmdc:mga08x19_159499_c1 3300050514 Bacteria 1531
475 nmdc:mga08x19_29555_c1 3300050514 Bacteria 3438
476 nmdc:mga08x19_8159_c1 3300050514 Bacteria 6223
477 nmdc:mga0a205_15456_c1 3300050515 Bacteria 7135
478 nmdc:mga0a205_15791_c1 3300050515 Bacteria 7060
479 nmdc:mga0a205_18853_c1 3300050515 Bacteria 6496
480 nmdc:mga0a205_191542_c1 3300050515 Bacteria 1937
481 nmdc:mga0a205_316059_c1 3300050515 Bacteria 1433
482 nmdc:mga0a205_33989_c1 3300050515 Bacteria 4891
483 nmdc:mga0a205_6998_c1 3300050515 Bacteria 5110
484 nmdc:mga0a205_93589_c1 3300050515 Bacteria 2903
485 Ga0495601_0029330 3300053077 Bacteria 3412
486 Ga0495595_0021060 3300053084 Bacteria 2845
487 Ga0495619_0076450 3300053085 Unclassified 2248
488 Ga0495619_0121206 3300053085 Bacteria 1793
489 Ga0590077_008472 3300059426 Bacteria 2105
490 Ga0207675_100082229
491 Ga0070658_10317920
492 Ga0070676_10040968
493 Ga0070676_10210530
494 Ga0070683_100001607
495 Ga0070683_100039717
496 Ga0070690_100015464
497 Ga0070690_100020294
498 Ga0070670_100032723
499 Ga0070670_100036869
500 Ga0070670_100046997
501 Ga0070677_10058796
502 Ga0068869_100144688
503 Ga0070666_10034573
504 Ga0070666_10041817
505 Ga0070680_100284680
506 Ga0068868_100112910
507 Ga0070660_100033011
508 Ga0070689_100488766
509 Ga0070691_10001036
510 Ga0070661_100034543
511 Ga0070668_100084400
512 Ga0070669_100004259
513 Ga0070669_100013003
514 Ga0070669_100026845
515 Ga0070675_100000147
516 Ga0070675_100021497
517 Ga0070675_100039069
518 Ga0070675_100185169
519 Ga0070675_100284584
520 Ga0070671_100001353
521 Ga0070671_100038433
522 Ga0070671_100043695
523 Ga0070674_100004114
524 Ga0070674_100075542
525 Ga0070674_100080761
526 Ga0070673_100036797
527 Ga0070673_100050297
528 Ga0070673_100088967
529 Ga0070688_100006547
530 Ga0070688_100021145
531 Ga0070688_100062876
532 Ga0070688_100151431
533 Ga0070667_100021430
534 Ga0070667_100030019
535 Ga0070714_100064654
536 Ga0070705_100027167
537 Ga0070700_100007688
538 Ga0070700_100169950
539 Ga0070694_100037985
540 Ga0070708_100035155
541 Ga0070708_100065999
542 Ga0070663_100300854
543 Ga0070678_100115173
544 Ga0070662_100039419
545 Ga0070662_100132396
546 Ga0070681_10017150
547 Ga0070681_10530569
548 Ga0068867_100043386
549 Ga0068867_100128448
550 Ga0068867_100343627
551 Ga0070685_10010170
552 Ga0070706_100371201
553 Ga0070707_100059469
554 Ga0070707_100101243
555 Ga0070698_100163366
556 Ga0070698_100267835
557 Ga0070699_100001909
558 Ga0070699_100074203
559 Ga0070699_100184521
560 Ga0070679_100231375
561 Ga0070684_100000291
562 Ga0070697_100056986
563 Ga0070697_100101328
564 Ga0070672_100196629
565 Ga0070686_100001956
566 Ga0070686_100029981
567 Ga0070686_100038802
568 Ga0070686_100072991
569 Ga0070686_100073428
570 Ga0070695_100007855
571 Ga0070696_100019788
572 Ga0070665_100034316
573 Ga0070665_100062347
574 Ga0070704_100001892
575 Ga0070704_100010266
576 Ga0070704_100015463
577 Ga0070704_100441814
578 Ga0068855_100313082
579 Ga0070664_100000724
580 Ga0070664_100023298
581 Ga0070664_100172869
582 Ga0068857_100366028
583 Ga0068854_100030731
584 Ga0068854_100083985
585 Ga0070702_100010598
586 Ga0068852_100146202
587 Ga0068859_100149835
588 Ga0068859_100330845
589 Ga0068864_100026062
590 Ga0068864_100273979
591 Ga0068864_100442841
592 Ga0068866_10061230
593 Ga0068861_100002556
594 Ga0068861_100097752
595 Ga0068861_100120624
596 Ga0068861_100358908
597 Ga0068863_100002769
598 Ga0068858_100004497
599 Ga0068858_100144637
600 Ga0068858_100165935
601 Ga0068860_100122477
602 Ga0068860_100699913
603 Ga0068862_100038879
604 Ga0068862_100128398
605 Ga0068862_100273530
606 Ga0081539_10005405
607 Ga0081539_10124830
608 Ga0075365_10021668
609 Ga0075368_10015203
610 Ga0075368_10018939
611 Ga0075364_10035942
612 Ga0070716_100000014
613 Ga0075367_10059046
614 Ga0097621_100003404
615 Ga0075370_10007352
616 Ga0068871_100001727
617 Ga0068871_100282746
618 Ga0075428_100049494
619 Ga0075428_100051920
620 Ga0075430_100000735
621 Ga0075431_100034071
622 Ga0075433_10024234
623 Ga0075433_10038816
624 Ga0075433_10042066
625 Ga0075433_10046445
626 Ga0075433_10372814
627 Ga0075434_100000097
628 Ga0075434_100016754
629 Ga0075434_100080958
630 Ga0075434_100108453
631 Ga0075434_100176783
632 Ga0075434_100319558
633 Ga0075429_100032817
634 Ga0068865_100002725
635 Ga0068865_100253252
636 Ga0075436_100000341
637 Ga0075436_100011103
638 Ga0075436_100012951
639 Ga0075436_100020540
640 Ga0075436_100030832
641 Ga0075436_100084453
642 Ga0075436_100189972
643 Ga0075436_100201667
644 Ga0097620_100149842
645 Ga0097620_100330852
646 Ga0075435_100000149
647 Ga0075435_100000353
648 Ga0075435_100004330
649 Ga0075435_100016083
650 Ga0075435_100041679
651 Ga0075435_100075065
652 Ga0075435_100108398
653 Ga0075435_100309917
654 Ga0075435_100341611
655 Ga0105240_10033201
656 Ga0105240_10057740
657 Ga0105240_10215252
658 Ga0111539_10000870
659 Ga0111539_10002313
660 Ga0111539_10015720
661 Ga0111539_10020895
662 Ga0111539_10134239
663 Ga0111539_10204358
664 Ga0111539_10362188
665 Ga0111539_10371999
666 Ga0105245_10018703
667 Ga0105245_10187449
668 Ga0105247_10068374
669 Ga0114129_10001588
670 Ga0114129_10003979
671 Ga0114129_10007344
672 Ga0114129_10013168
673 Ga0114129_10014381
674 Ga0114129_10018285
675 Ga0114129_10018457
676 Ga0114129_10019030
677 Ga0114129_10042374
678 Ga0114129_10064903
679 Ga0114129_10309651
680 Ga0114129_10314362
681 Ga0114129_10927734
682 Ga0105243_10056531
683 Ga0105241_10060335
684 Ga0105242_10005116
685 Ga0105242_10023674
686 Ga0105242_10361489
687 Ga0105248_10007182
688 Ga0105248_10020451
689 Ga0105248_10030306
690 Ga0105248_10031454
691 Ga0105248_10034422
692 Ga0105248_10058602
693 Ga0105248_10060602
694 Ga0105248_10399350
695 Ga0105248_10407369
696 Ga0105238_10286630
697 Ga0105238_10628809
698 Ga0105249_10166205
699 Ga0105239_10240311
700 Ga0157378_10102739
701 Ga0157378_10562072
702 Ga0163162_10058052
703 Ga0163162_10326975
704 Ga0157375_10057963
705 Ga0157375_10273159
706 Ga0157375_10343450
707 Ga0163163_10006478
708 Ga0163163_10008769
709 Ga0163163_10025968
710 Ga0163163_10217579
711 Ga0163163_10285036
712 Ga0157380_10064407
713 Ga0157380_10100085
714 Ga0157380_10392859
715 Ga0157380_10437710
716 Ga0157379_10007571
717 Ga0157376_10009444
718 Ga0157376_10107407
719 Ga0157376_10212255
720 Ga0157376_10354414
721 Ga0182007_10074187
722 Ga0207642_10172800
723 Ga0207688_10022774
724 Ga0207688_10068232
725 Ga0207680_10008368
726 Ga0207680_10019404
727 Ga0207680_10019566
728 Ga0207680_10240406
729 Ga0207645_10000374
730 Ga0207645_10060154
731 Ga0207707_10036257
732 Ga0207707_10382796
733 Ga0207695_10049166
734 Ga0207662_10012896
735 Ga0207662_10076506
736 Ga0207657_10000448
737 Ga0207649_10089302
738 Ga0207646_10045039
739 Ga0207646_10128290
740 Ga0207646_10142451
741 Ga0207646_10154072
742 Ga0207681_10010167
743 Ga0207681_10120585
744 Ga0207694_10275596
745 Ga0207650_10068670
746 Ga0207659_10000075
747 Ga0207659_10145249
748 Ga0207687_10052962
749 Ga0207664_10019392
750 Ga0207644_10309742
751 Ga0207706_10104334
752 Ga0207706_10178768
753 Ga0207686_10016246
754 Ga0207686_10158865
755 Ga0207709_10226296
756 Ga0207709_10421155
757 Ga0207670_10006763
758 Ga0207669_10165206
759 Ga0207669_10168952
760 Ga0207669_10232495
761 Ga0207704_10002338
762 Ga0207704_10235007
763 Ga0207665_10000029
764 Ga0207691_10063765
765 Ga0207691_10435302
766 Ga0207711_10012847
767 Ga0207711_10013002
768 Ga0207711_10038778
769 Ga0207711_10113083
770 Ga0207711_10233687
771 Ga0207711_10385127
772 Ga0207679_10014814
773 Ga0207679_10073854
774 Ga0207651_10018356
775 Ga0207651_10023357
776 Ga0207651_10081917
777 Ga0207651_10134611
778 Ga0207651_10214189
779 Ga0207712_10256094
780 Ga0207640_10022849
781 Ga0207640_10083201
782 Ga0207658_10233019
783 Ga0207703_10076932
784 Ga0207703_10204513
785 Ga0207703_10354598
786 Ga0207708_10002808
787 Ga0207708_10006299
788 Ga0207641_10014394
789 Ga0207648_10162385
790 Ga0207648_10199925
791 Ga0207648_10233526
792 Ga0207676_10053771
793 Ga0207675_100003224
794 Ga0207675_100018383
795 Ga0207675_100096405
796 Ga0207675_100326638
797 Ga0207675_100538348
798 Ga0207683_10026204
799 Ga0207683_10312591
800 Ga0207698_10087735
801 Ga0209813_10007312
802 Ga0207428_10000385
803 Ga0207428_10009579
804 Ga0207428_10012805
805 Ga0207428_10019067
806 Ga0207428_10099604
807 Ga0207428_10165204
808 Ga0207428_10310373
809 Ga0268266_10242562
810 Ga0268265_10006019
811 Ga0268265_10024471
812 Ga0268265_10303159
813 Ga0307408_100002466
814 Ga0307408_100086699
815 Ga0307408_100107350
816 Ga0307406_10150979
817 Ga0307407_10079956
818 Ga0307412_10109095
819 Ga0307412_10426950
820 Ga0307416_100137539
821 Ga0307416_100182271
822 Ga0307416_100399586
823 Ga0307411_10005293
824 Ga0307411_10159346
825 Ga0307411_10377048
826 Ga0307415_100285367
827 Ga0373948_0002290
828 Ga0373950_0000745
829 Ga0373958_0000974
830 Ga0373959_0002259
831 Ga0373938_0004632
832 Ga0373929_0011882
833 Ga0373940_0021577
834 Ga0373949_0000538
835 Ga0373951_0002318
836 Ga0373952_0001646
837 Ga0373932_0000622
838 Ga0373939_0002425
839 Ga0373941_0000120
840 Ga0373957_0012380
841 Ga0373943_0007910
842 Ga0373942_0000368
843 Ga0373961_0000583
844 Ga0373962_0004572
845 Ga0373924_0060294
846 Ga0373924_0099754
847 Ga0373931_0050563
848 Ga0373935_0006658
849 Ga0373927_0233489
850 Ga0373933_0229427
851 Ga0373947_0005356
852 Ga0373937_0047270
853 Ga0395905_0077472
854 Ga0439435_0002711
855 Ga0439435_0010377
856 Ga0439435_0025719
857 Ga0439464_0004641
858 Ga0451577_0178461
859 Ga0451576_0005245
860 Ga0451576_0224467
861 Ga0451576_0240122
862 Ga0466967_0247556
863 Ga0495629_0195551
864 Ga0495582_0087762
865 Ga0495586_0078466
866 Ga0495598_0059850
867 Ga0495621_0039642
868 Ga0495645_0003365
869 Ga0495658_0070124
870 Ga0495669_0005747
871 Ga0495613_0085050
872 Ga0495604_0247701
873 Ga0495674_0034386
874 Ga0495684_0027830
875 Ga0496101_0365911
876 Ga0496102_0110628
877 Ga0496102_0139541
878 Ga0496103_0303839
879 Ga0496104_0000157
880 Ga0496104_0084385
881 Ga0496104_0562750
882 Ga0496106_0099168
883 Ga0496106_0158824
884 Ga0496107_0180826
885 Ga0496108_0003567
886 Ga0496108_0120816
887 Ga0496109_0010468
888 Ga0496110_0001487
889 Ga0496110_0287911
890 Ga0496111_0008114
891 Ga0496112_0000148
892 Ga0496112_0016116
893 Ga0496112_0104402
894 Ga0496112_0136679
895 Ga0496112_0165829
896 Ga0496112_0539352
897 Ga0496113_0079890
898 Ga0496114_0129871
899 Ga0496114_0371394
900 Ga0496114_0436716
901 Ga0501034_0070296
902 Ga0501039_0039611
903 Ga0501041_0007813
904 Ga0501047_0035489
905 Ga0501047_0064182
906 Ga0501071_0151795
907 Ga0501072_0101554
908 Ga0501074_0045986
909 Ga0501075_0206304
910 Ga0501075_0224485
911 Ga0501081_0017446
912 Ga0501081_0087589
913 Ga0501044_0018212
914 Ga0501045_0113934
915 nmdc:mga0yw44_40241_c1
916 nmdc:mga0k408_35882_c1
917 nmdc:mga0k408_51912_c1
918 nmdc:mga04h51_10683_c1
919 nmdc:mga04h51_22527_c1
920 nmdc:mga07m45_1562_c1
921 nmdc:mga05p37_1107_c1
922 nmdc:mga05p37_18704_c1
923 nmdc:mga05p37_18828_c1
924 nmdc:mga05p37_2459_c1
925 nmdc:mga05p37_270261_c1
926 nmdc:mga05p37_300870_c1
927 nmdc:mga05p37_301737_c1
928 nmdc:mga05p37_34176_c1
929 nmdc:mga05p37_4615_c1
930 nmdc:mga05p37_75526_c1
931 nmdc:mga05p37_79945_c1
932 nmdc:mga05p37_9829_c1
933 nmdc:mga09592_150945_c1
934 nmdc:mga09592_216216_c1
935 nmdc:mga09592_94528_c1
936 nmdc:mga0qj67_18661_c1
937 nmdc:mga06r32_16928_c1
938 nmdc:mga06r32_303993_c1
939 nmdc:mga06r32_94331_c1
940 nmdc:mga08y16_108403_c1
941 nmdc:mga08y16_1540_c1
942 nmdc:mga08y16_268843_c1
943 nmdc:mga08y16_273951_c1
944 nmdc:mga08y16_34271_c1
945 nmdc:mga08y16_36151_c1
946 nmdc:mga08y16_5338_c1
947 nmdc:mga08y16_680_c1
948 nmdc:mga0n895_122884_c1
949 nmdc:mga0n895_176356_c1
950 nmdc:mga0n895_275539_c1
951 nmdc:mga0n895_50708_c1
952 nmdc:mga0n895_58368_c1
953 nmdc:mga0n895_6669_c1
954 nmdc:mga0n895_91483_c1
955 nmdc:mga0rr50_1053_c1
956 nmdc:mga0rr50_260407_c1
957 nmdc:mga0rr50_28_c1
958 nmdc:mga0rr50_327143_c1
959 nmdc:mga0rr50_33927_c1
960 nmdc:mga0rr50_57566_c1
961 nmdc:mga0rr50_73571_c1
962 nmdc:mga08x19_121_c1
963 nmdc:mga08x19_159499_c1
964 nmdc:mga08x19_29555_c1
965 nmdc:mga08x19_8159_c1
966 nmdc:mga0a205_15456_c1
967 nmdc:mga0a205_15791_c1
968 nmdc:mga0a205_18853_c1
969 nmdc:mga0a205_191542_c1
970 nmdc:mga0a205_316059_c1
971 nmdc:mga0a205_33989_c1
972 nmdc:mga0a205_6998_c1
973 nmdc:mga0a205_93589_c1
974 Ga0495601_0029330
975 Ga0495595_0021060
976 Ga0495619_0076450
977 Ga0495619_0121206
978 Ga0590077_008472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lrf-assembly1.cif.gz_B-2 crystal structure of unliganded agre 0.7725 54 316
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7564 54 314
6lrf-assembly1.cif.gz_A-2 crystal structure of unliganded agre 0.7513 54 314
6lrh-assembly1.cif.gz_A-2 crystal structure of the binary complex of agre c264a mutant with l-arginine 0.7464 54 316
6lrg-assembly1.cif.gz_A crystal structure of the ternary complex of agre with ornithine and nad+ 0.7456 54 316
ID Description Score Start End Superfamily
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6602 54 316 3.40.50.1220
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6558 36 313 3.40.910.10
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6453 54 316 3.40.50.1220
3c2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;putative lor/sdh protein like domains 0.6425 54 316 3.40.50.10690
af_Q6NYK1_8_355_3.40.910.10 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6423 10 310 3.40.910.10
ID Description Score Start End GO Terms
AF-A0A7W0LFT4-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9853 81 312
AF-A0A523VEU0-F1-model_v4 Uncharacterized protein 0.981 41 315
AF-A0A1F9DUS2-F1-model_v4 Uncharacterized protein 0.9805 46 316
AF-A0A496SJZ8-F1-model_v4 Uncharacterized protein 0.977 56 315
AF-A0A832AEC6-F1-model_v4 Uncharacterized protein 0.9769 220 316

Map