F453273

General Info

Members Datasets Scaffolds Average Seq Length
486 226 972 368

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000801|Ga0213875_1000080115
Length 402
Sequence VTGPAVTRLPWKESAWAQPYGTDASGQAAPGGTRTVTGPPVTELEAAVYVIPTDAPEADGTLAWNKTTMVLVTAWANGERGIGWSYTSAAAQAVVSEVLAGVVVGRSAFDIPGAAEAMARAVRNIGRPGIAAMAISAVDIALWDLKARLLGRSLTSLLGQAAERVPVYGSGGFTSYDDARTRKQLANWVQRERIPRVKIKIGESWGGNLRRDLARVALAREVIGPDTELYVDANGAYTTGQAVRMAGELAAYGVTWFEEPVSSQDLAGLAAVRRQVTADVAAGEYSWSLADSARLIDAGAVDCLQLDVTRCGGVTEFLRGAALAAAHNLQVSGHCAPGLHAHVGAAVPNLRHVEYFHDHQRIEGLLFDGFPAGDGGAMRPDPDQPGHGMTLRAADAEPYRCA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
208 2643221647 Streptomyces sp. Root369 Isolate Unclassified
209 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
210 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
211 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
212 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
213 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
214 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
215 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
216 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
217 2891562705 Microbispora tritici MT50 Isolate Unclassified
218 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
219 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
220 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
221 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
222 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
223 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
224 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
225 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
226 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.14
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000801 3300021388 Bacteria 23505
2 rootH2_10046051 3300003320 Bacteria 2771
3 Ga0070658_10116436 3300005327 Bacteria 2218
4 Ga0070683_100004079 3300005329 Bacteria 11973
5 Ga0070683_100185755 3300005329 Bacteria 1973
6 Ga0070670_100204232 3300005331 Bacteria 1717
7 Ga0070682_100063038 3300005337 Bacteria 2349
8 Ga0068868_100115168 3300005338 Bacteria 2188
9 Ga0070660_100009661 3300005339 Bacteria 6794
10 Ga0070689_100012441 3300005340 Bacteria 6130
11 Ga0070661_100023456 3300005344 Bacteria 4422
12 Ga0070692_10018268 3300005345 Bacteria 3368
13 Ga0070669_100367501 3300005353 Bacteria 1171
14 Ga0070671_100031380 3300005355 Bacteria 4389
15 Ga0070673_100055269 3300005364 Bacteria 3127
16 Ga0070688_100151241 3300005365 Bacteria 1587
17 Ga0070659_100077909 3300005366 Bacteria 2644
18 Ga0070667_100083118 3300005367 Bacteria 2742
19 Ga0070703_10007389 3300005406 Bacteria 3086
20 Ga0070709_10001393 3300005434 Bacteria 13143
21 Ga0070709_10004393 3300005434 Bacteria 7604
22 Ga0070709_10029130 3300005434 Bacteria 3299
23 Ga0070714_100001932 3300005435 Bacteria 15140
24 Ga0070714_100004758 3300005435 Bacteria 10278
25 Ga0070714_100006919 3300005435 Bacteria 8794
26 Ga0070714_100038128 3300005435 Bacteria 4041
27 Ga0070714_100103967 3300005435 Bacteria 2506
28 Ga0070713_100000812 3300005436 Bacteria 20038
29 Ga0070713_100010105 3300005436 Bacteria 6807
30 Ga0070713_100010910 3300005436 Bacteria 6588
31 Ga0070713_100012424 3300005436 Bacteria 6245
32 Ga0070713_100022060 3300005436 Bacteria 4913
33 Ga0070713_100030957 3300005436 Bacteria 4255
34 Ga0070710_10000495 3300005437 Bacteria 18513
35 Ga0070710_10001280 3300005437 Bacteria 11935
36 Ga0070701_10057594 3300005438 Bacteria 2037
37 Ga0070711_100001628 3300005439 Bacteria 12400
38 Ga0070711_100041680 3300005439 Bacteria 3102
39 Ga0070711_100072430 3300005439 Bacteria 2431
40 Ga0070711_100123208 3300005439 Bacteria 1920
41 Ga0070705_100007505 3300005440 Bacteria 5369
42 Ga0070708_100004997 3300005445 Bacteria 10485
43 Ga0070663_100005907 3300005455 Bacteria 7324
44 Ga0070678_100168047 3300005456 Bacteria 1783
45 Ga0070685_10064334 3300005466 Bacteria 2156
46 Ga0070706_100004171 3300005467 Bacteria 14055
47 Ga0070706_100009702 3300005467 Bacteria 8947
48 Ga0070706_100132767 3300005467 Bacteria 2324
49 Ga0070707_100000166 3300005468 Bacteria 63590
50 Ga0070707_100001693 3300005468 Bacteria 21273
51 Ga0070698_100000006 3300005471 Bacteria 129236
52 Ga0070698_100000804 3300005471 Bacteria 34239
53 Ga0070698_100001088 3300005471 Bacteria 29878
54 Ga0070698_100059250 3300005471 Bacteria 3867
55 Ga0070698_100088358 3300005471 Bacteria 3084
56 Ga0070699_100128426 3300005518 Bacteria 2234
57 Ga0070679_100067235 3300005530 Bacteria 3574
58 Ga0070679_100118567 3300005530 Bacteria 2631
59 Ga0070684_100090307 3300005535 Bacteria 2724
60 Ga0070684_100224946 3300005535 Bacteria 1712
61 Ga0070697_100047264 3300005536 Bacteria 3490
62 Ga0070697_100145591 3300005536 Bacteria 1994
63 Ga0068853_100061334 3300005539 Bacteria 3252
64 Ga0070672_100249086 3300005543 Bacteria 1496
65 Ga0070693_100020068 3300005547 Bacteria 3517
66 Ga0070704_100155966 3300005549 Bacteria 1801
67 Ga0068855_100218354 3300005563 Bacteria 2139
68 Ga0070664_100124559 3300005564 Bacteria 2259
69 Ga0068854_100145565 3300005578 Bacteria 1822
70 Ga0068856_100042335 3300005614 Bacteria 4479
71 Ga0068856_100064294 3300005614 Bacteria 3625
72 Ga0068856_100119689 3300005614 Bacteria 2634
73 Ga0068859_100096282 3300005617 Bacteria 3012
74 Ga0068861_100299747 3300005719 Bacteria 1392
75 Ga0068870_10088838 3300005840 Bacteria 1724
76 Ga0068863_100165953 3300005841 Bacteria 2117
77 Ga0070717_10001234 3300006028 Bacteria 17388
78 Ga0070717_10006107 3300006028 Bacteria 8847
79 Ga0070717_10006960 3300006028 Bacteria 8359
80 Ga0070717_10022391 3300006028 Bacteria 4993
81 Ga0070717_10089793 3300006028 Bacteria 2592
82 Ga0070717_10113593 3300006028 Bacteria 2313
83 Ga0070717_10172699 3300006028 Bacteria 1881
84 Ga0070717_10255294 3300006028 Bacteria 1550
85 Ga0070715_10012589 3300006163 Bacteria 3084
86 Ga0070716_100000112 3300006173 Bacteria 31826
87 Ga0070716_100016411 3300006173 Bacteria 3821
88 Ga0070712_100005448 3300006175 Bacteria 7881
89 Ga0070712_100006628 3300006175 Bacteria 7197
90 Ga0070712_100011981 3300006175 Bacteria 5512
91 Ga0070712_100049646 3300006175 Bacteria 2915
92 Ga0070712_100051968 3300006175 Bacteria 2856
93 Ga0070712_100101695 3300006175 Bacteria 2127
94 Ga0097621_100261457 3300006237 Bacteria 1518
95 Ga0075433_10146021 3300006852 Bacteria 2103
96 Ga0075434_100005843 3300006871 Bacteria 11240
97 Ga0075434_100022650 3300006871 Bacteria 6117
98 Ga0097620_100096285 3300006931 Bacteria 3012
99 Ga0075435_100003348 3300007076 Bacteria 10858
100 Ga0075435_100010797 3300007076 Bacteria 6687
101 Ga0105240_10058742 3300009093 Bacteria 4801
102 Ga0105245_10236584 3300009098 Bacteria 1768
103 Ga0105241_10040344 3300009174 Bacteria 3524
104 Ga0105242_10137775 3300009176 Bacteria 2114
105 Ga0105246_10012541 3300011119 Bacteria 5293
106 Ga0157370_10084959 3300013104 Bacteria 2973
107 Ga0157369_10158232 3300013105 Bacteria 2392
108 Ga0157378_10036017 3300013297 Bacteria 4379
109 Ga0163162_10040823 3300013306 Bacteria 4641
110 Ga0157375_10081947 3300013308 Bacteria 3267
111 Ga0163163_10151768 3300014325 Bacteria 2360
112 Ga0163163_10521550 3300014325 Bacteria 1250
113 Ga0157380_10181278 3300014326 Bacteria 1850
114 Ga0157377_10009441 3300014745 Bacteria 4786
115 Ga0157379_10051944 3300014968 Bacteria 3660
116 Ga0157376_10123770 3300014969 Bacteria 2296
117 Ga0157376_10150117 3300014969 Bacteria 2101
118 Ga0213875_10037878 3300021388 Bacteria 2272
119 Ga0207653_10021249 3300025885 Bacteria 2059
120 Ga0207692_10001034 3300025898 Bacteria 10169
121 Ga0207692_10017124 3300025898 Bacteria 3225
122 Ga0207692_10084903 3300025898 Bacteria 1702
123 Ga0207688_10002695 3300025901 Bacteria 9616
124 Ga0207647_10054652 3300025904 Bacteria 2456
125 Ga0207685_10015189 3300025905 Bacteria 2434
126 Ga0207685_10049880 3300025905 Bacteria 1610
127 Ga0207699_10001286 3300025906 Bacteria 11920
128 Ga0207699_10002425 3300025906 Bacteria 8814
129 Ga0207699_10009031 3300025906 Bacteria 4945
130 Ga0207699_10056534 3300025906 Bacteria 2339
131 Ga0207699_10134916 3300025906 Bacteria 1615
132 Ga0207643_10006540 3300025908 Bacteria 6246
133 Ga0207684_10000893 3300025910 Bacteria 33923
134 Ga0207684_10002178 3300025910 Bacteria 20052
135 Ga0207684_10016625 3300025910 Bacteria 6316
136 Ga0207684_10100748 3300025910 Bacteria 2469
137 Ga0207654_10108457 3300025911 Bacteria 1723
138 Ga0207693_10002516 3300025915 Bacteria 15938
139 Ga0207693_10019367 3300025915 Bacteria 5414
140 Ga0207693_10051684 3300025915 Bacteria 3224
141 Ga0207693_10054823 3300025915 Bacteria 3127
142 Ga0207693_10107623 3300025915 Bacteria 2187
143 Ga0207693_10116804 3300025915 Bacteria 2095
144 Ga0207663_10003350 3300025916 Bacteria 7826
145 Ga0207663_10029071 3300025916 Bacteria 3241
146 Ga0207663_10034638 3300025916 Bacteria 3022
147 Ga0207663_10137432 3300025916 Bacteria 1698
148 Ga0207663_10143400 3300025916 Bacteria 1667
149 Ga0207662_10001365 3300025918 Bacteria 11799
150 Ga0207657_10009973 3300025919 Bacteria 9507
151 Ga0207652_10056706 3300025921 Bacteria 3373
152 Ga0207646_10000049 3300025922 Bacteria 171680
153 Ga0207646_10006717 3300025922 Bacteria 11850
154 Ga0207646_10326704 3300025922 Bacteria 1386
155 Ga0207694_10096245 3300025924 Bacteria 2341
156 Ga0207700_10001490 3300025928 Bacteria 13253
157 Ga0207700_10005304 3300025928 Bacteria 7689
158 Ga0207700_10007808 3300025928 Bacteria 6575
159 Ga0207700_10008800 3300025928 Bacteria 6272
160 Ga0207700_10036224 3300025928 Bacteria 3561
161 Ga0207700_10088201 3300025928 Bacteria 2442
162 Ga0207700_10094820 3300025928 Bacteria 2366
163 Ga0207700_10124590 3300025928 Bacteria 2094
164 Ga0207664_10000313 3300025929 Bacteria 36100
165 Ga0207664_10005624 3300025929 Bacteria 8573
166 Ga0207664_10040000 3300025929 Bacteria 3642
167 Ga0207664_10043625 3300025929 Bacteria 3509
168 Ga0207664_10067341 3300025929 Bacteria 2873
169 Ga0207664_10122258 3300025929 Bacteria 2180
170 Ga0207706_10032567 3300025933 Bacteria 4641
171 Ga0207665_10000128 3300025939 Bacteria 50300
172 Ga0207665_10007742 3300025939 Bacteria 7092
173 Ga0207665_10016301 3300025939 Bacteria 4878
174 Ga0207665_10037572 3300025939 Bacteria 3223
175 Ga0207665_10053709 3300025939 Bacteria 2716
176 Ga0207691_10037238 3300025940 Bacteria 4506
177 Ga0207689_10001715 3300025942 Bacteria 20750
178 Ga0207667_10464571 3300025949 Bacteria 1285
179 Ga0207678_10018557 3300026067 Bacteria 6108
180 Ga0207708_10015681 3300026075 Bacteria 5685
181 Ga0207702_10058008 3300026078 Bacteria 3293
182 Ga0207702_10109815 3300026078 Bacteria 2450
183 Ga0207702_10150473 3300026078 Bacteria 2116
184 Ga0207674_10001322 3300026116 Bacteria 32223
185 Ga0207675_100019086 3300026118 Bacteria 6400
186 Ga0207683_10008312 3300026121 Bacteria 8879
187 Ga0373926_0012950 3300035083 Bacteria 2825
188 Ga0373926_0037572 3300035083 Bacteria 1723
189 Ga0373928_0020247 3300035084 Bacteria 1394
190 Ga0373934_0000135 3300035086 Bacteria 27297
191 Ga0373934_0002775 3300035086 Bacteria 6421
192 Ga0373934_0003070 3300035086 Bacteria 6096
193 Ga0373934_0015549 3300035086 Bacteria 2888
194 Ga0373934_0044049 3300035086 Bacteria 1764
195 Ga0373934_0051722 3300035086 Bacteria 1628
196 Ga0373923_0002210 3300035111 Bacteria 5919
197 Ga0373923_0016662 3300035111 Bacteria 2797
198 Ga0373923_0029773 3300035111 Bacteria 2191
199 Ga0373923_0042571 3300035111 Bacteria 1876
200 Ga0373923_0061138 3300035111 Bacteria 1600
201 Ga0373932_0009424 3300035112 Bacteria 2348
202 Ga0373936_0001803 3300035113 Bacteria 7875
203 Ga0373936_0004790 3300035113 Bacteria 5107
204 Ga0373936_0014349 3300035113 Bacteria 3027
205 Ga0373936_0030236 3300035113 Bacteria 2136
206 Ga0373945_0000797 3300035116 Bacteria 9212
207 Ga0373953_0000064 3300035117 Bacteria 27233
208 Ga0373953_0018871 3300035117 Bacteria 2558
209 Ga0373954_0000427 3300035118 Bacteria 15688
210 Ga0373954_0011885 3300035118 Bacteria 3866
211 Ga0373956_0000192 3300035119 Bacteria 23554
212 Ga0373956_0003968 3300035119 Bacteria 5944
213 Ga0373956_0028927 3300035119 Bacteria 2414
214 Ga0373956_0037439 3300035119 Bacteria 2144
215 Ga0373957_0000156 3300035120 Bacteria 17289
216 Ga0373957_0001305 3300035120 Bacteria 6690
217 Ga0373957_0001624 3300035120 Bacteria 6156
218 Ga0373957_0020447 3300035120 Bacteria 2338
219 Ga0373943_0002465 3300035170 Bacteria 8410
220 Ga0373943_0126262 3300035170 Bacteria 1364
221 Ga0373946_0000356 3300035171 Bacteria 14838
222 Ga0373946_0058699 3300035171 Bacteria 1631
223 Ga0373946_0092284 3300035171 Bacteria 1343
224 Ga0373955_0000138 3300035172 Bacteria 28847
225 Ga0373955_0009622 3300035172 Bacteria 4536
226 Ga0373955_0013540 3300035172 Bacteria 3947
227 Ga0373955_0019711 3300035172 Bacteria 3376
228 Ga0373955_0040701 3300035172 Bacteria 2487
229 Ga0373924_0003190 3300035410 Bacteria 5611
230 Ga0373924_0010102 3300035410 Bacteria 3474
231 Ga0373924_0026172 3300035410 Bacteria 2312
232 Ga0373931_0114583 3300035691 Bacteria 1533
233 Ga0373935_0006299 3300035692 Bacteria 7069
234 Ga0373935_0016726 3300035692 Bacteria 4440
235 Ga0373927_0005486 3300035695 Bacteria 8736
236 Ga0373933_0000015 3300035724 Bacteria 103111
237 Ga0373933_0020753 3300035724 Bacteria 3724
238 Ga0373933_0062232 3300035724 Bacteria 2253
239 Ga0373933_0062351 3300035724 Bacteria 2251
240 Ga0373933_0151997 3300035724 Bacteria 1466
241 Ga0373947_0012146 3300035725 Bacteria 4930
242 Ga0373947_0048955 3300035725 Bacteria 2537
243 Ga0373937_0000053 3300036401 Bacteria 103072
244 Ga0373937_0000952 3300036401 Bacteria 24624
245 Ga0373937_0018693 3300036401 Bacteria 6192
246 Ga0373937_0133538 3300036401 Bacteria 2319
247 Ga0373937_0163005 3300036401 Bacteria 2090
248 Ga0373925_0007017 3300037068 Bacteria 8227
249 Ga0373925_0008325 3300037068 Bacteria 7549
250 Ga0373925_0013280 3300037068 Bacteria 5961
251 Ga0373925_0026254 3300037068 Bacteria 4261
252 Ga0373925_0053469 3300037068 Bacteria 3019
253 Ga0436364_0349698 3300037853 Bacteria 2972
254 Ga0436364_0524996 3300037853 Bacteria 57206
255 Ga0436364_0871460 3300037853 Bacteria 1268
256 Ga0436364_0904341 3300037853 Bacteria 1890
257 Ga0436364_1332433 3300037853 Bacteria 9642
258 Ga0436365_1415948 3300039437 Bacteria 2339
259 Ga0436361_1156408 3300039447 Bacteria 1175
260 Ga0436363_0141279 3300039450 Bacteria 2493
261 Ga0436363_1444734 3300039450 Bacteria 2067
262 Ga0436362_0834704 3300039453 Bacteria 1356
263 Ga0451853_1112426 3300041512 Bacteria 1870
264 Ga0466963_0029318 3300044694 Bacteria 3541
265 Ga0466963_0091453 3300044694 Bacteria 2073
266 Ga0466964_0005427 3300044706 Bacteria 4732
267 Ga0466971_0059449 3300044719 Bacteria 1726
268 Ga0466968_0022099 3300044735 Bacteria 2583
269 Ga0466970_0100240 3300044765 Bacteria 1577
270 Ga0466960_0016922 3300044901 Bacteria 3171
271 Ga0466967_0025971 3300045976 Bacteria 4841
272 Ga0466967_0057025 3300045976 Bacteria 3446
273 Ga0466967_0081595 3300045976 Bacteria 2921
274 Ga0495592_0000057 3300046454 Bacteria 103108
275 Ga0495592_0041950 3300046454 Bacteria 3427
276 Ga0495592_0051923 3300046454 Bacteria 3045
277 Ga0495592_0061469 3300046454 Bacteria 2760
278 Ga0495592_0079973 3300046454 Bacteria 2365
279 Ga0495592_0112044 3300046454 Bacteria 1929
280 Ga0495629_0001289 3300046459 Bacteria 19720
281 Ga0495629_0028277 3300046459 Bacteria 3980
282 Ga0495641_0016339 3300046461 Bacteria 3914
283 Ga0495641_0020551 3300046461 Bacteria 3344
284 Ga0495651_0000032 3300046462 Bacteria 103111
285 Ga0495651_0001462 3300046462 Bacteria 18262
286 Ga0495651_0006098 3300046462 Bacteria 9202
287 Ga0495651_0039320 3300046462 Bacteria 3683
288 Ga0495651_0056881 3300046462 Bacteria 3003
289 Ga0495651_0065935 3300046462 Bacteria 2764
290 Ga0495651_0122174 3300046462 Bacteria 1911
291 Ga0495653_0000654 3300046463 Bacteria 26455
292 Ga0495653_0000884 3300046463 Bacteria 23152
293 Ga0495653_0010689 3300046463 Bacteria 7516
294 Ga0495653_0025567 3300046463 Bacteria 4740
295 Ga0495653_0076811 3300046463 Bacteria 2481
296 Ga0495653_0081933 3300046463 Bacteria 2383
297 Ga0495653_0115361 3300046463 Bacteria 1922
298 Ga0495582_0003235 3300046473 Bacteria 9150
299 Ga0495582_0028527 3300046473 Bacteria 3063
300 Ga0495639_0017837 3300046475 Bacteria 3085
301 Ga0495639_0063646 3300046475 Bacteria 1694
302 Ga0495662_0010419 3300046476 Bacteria 4552
303 Ga0495664_0006616 3300046477 Bacteria 6408
304 Ga0495664_0088424 3300046477 Bacteria 1862
305 Ga0495608_0000045 3300046511 Bacteria 100413
306 Ga0495608_0001665 3300046511 Bacteria 15968
307 Ga0495608_0011269 3300046511 Bacteria 6225
308 Ga0495608_0014268 3300046511 Bacteria 5513
309 Ga0495608_0022093 3300046511 Bacteria 4361
310 Ga0495608_0022532 3300046511 Bacteria 4318
311 Ga0495608_0078216 3300046511 Bacteria 2152
312 Ga0495618_0009901 3300046514 Bacteria 5768
313 Ga0495618_0022992 3300046514 Bacteria 3851
314 Ga0495618_0029157 3300046514 Bacteria 3442
315 Ga0495628_0000063 3300046516 Bacteria 86231
316 Ga0495628_0004952 3300046516 Bacteria 11712
317 Ga0495628_0036377 3300046516 Bacteria 3952
318 Ga0495628_0174404 3300046516 Bacteria 1629
319 Ga0495628_0201372 3300046516 Bacteria 1500
320 Ga0495666_0129267 3300046526 Bacteria 1181
321 Ga0495652_0000078 3300046529 Bacteria 103039
322 Ga0495652_0007933 3300046529 Bacteria 9747
323 Ga0495652_0021317 3300046529 Bacteria 5762
324 Ga0495652_0042324 3300046529 Bacteria 3928
325 Ga0495652_0076541 3300046529 Bacteria 2775
326 Ga0495652_0096181 3300046529 Bacteria 2412
327 Ga0495652_0250541 3300046529 Bacteria 1313
328 Ga0495652_0275712 3300046529 Bacteria 1234
329 Ga0495640_0039765 3300046533 Bacteria 3298
330 Ga0495640_0065569 3300046533 Bacteria 2451
331 Ga0495586_0019025 3300046535 Bacteria 3655
332 Ga0495587_0000050 3300046536 Bacteria 103111
333 Ga0495587_0001259 3300046536 Bacteria 16827
334 Ga0495587_0017696 3300046536 Bacteria 4425
335 Ga0495645_0013817 3300046543 Bacteria 5721
336 Ga0495645_0062859 3300046543 Bacteria 2688
337 Ga0495645_0129286 3300046543 Bacteria 1772
338 Ga0495645_0190477 3300046543 Bacteria 1398
339 Ga0495667_0000055 3300046559 Bacteria 103111
340 Ga0495667_0001024 3300046559 Bacteria 18088
341 Ga0495667_0001264 3300046559 Bacteria 16586
342 Ga0495667_0011501 3300046559 Bacteria 5990
343 Ga0495667_0027729 3300046559 Bacteria 3813
344 Ga0495667_0046856 3300046559 Bacteria 2857
345 Ga0495634_0016148 3300046642 Bacteria 5344
346 Ga0495634_0017252 3300046642 Bacteria 5154
347 Ga0495635_0003804 3300046663 Bacteria 10480
348 Ga0495635_0007047 3300046663 Bacteria 7857
349 Ga0495635_0008898 3300046663 Bacteria 7007
350 Ga0495635_0081216 3300046663 Bacteria 2218
351 Ga0495635_0154894 3300046663 Bacteria 1560
352 Ga0495657_0000009 3300046675 Bacteria 217555
353 Ga0495657_0003589 3300046675 Bacteria 12623
354 Ga0495657_0012109 3300046675 Bacteria 6418
355 Ga0495657_0016863 3300046675 Bacteria 5311
356 Ga0495657_0031644 3300046675 Bacteria 3696
357 Ga0495599_0000033 3300046678 Bacteria 106425
358 Ga0495599_0000479 3300046678 Bacteria 22810
359 Ga0495599_0014812 3300046678 Bacteria 4829
360 Ga0495599_0053745 3300046678 Bacteria 2523
361 Ga0495599_0071122 3300046678 Bacteria 2171
362 Ga0495623_0000423 3300046679 Bacteria 27905
363 Ga0495623_0018506 3300046679 Bacteria 4499
364 Ga0495623_0090147 3300046679 Bacteria 1883
365 Ga0495646_0013805 3300046680 Bacteria 5136
366 Ga0495646_0053032 3300046680 Bacteria 2447
367 Ga0495613_0009637 3300046689 Bacteria 7175
368 Ga0495613_0013100 3300046689 Bacteria 6162
369 Ga0495624_0003558 3300046690 Bacteria 11536
370 Ga0495624_0132124 3300046690 Bacteria 1530
371 Ga0495624_0186989 3300046690 Bacteria 1260
372 Ga0495600_0000729 3300046809 Bacteria 17290
373 Ga0495600_0004684 3300046809 Bacteria 8202
374 Ga0495600_0025020 3300046809 Bacteria 3845
375 Ga0495600_0055324 3300046809 Bacteria 2591
376 Ga0495600_0134444 3300046809 Bacteria 1606
377 Ga0495581_0009539 3300047315 Bacteria 5616
378 Ga0495581_0093182 3300047315 Bacteria 1748
379 Ga0495581_0105115 3300047315 Bacteria 1641
380 Ga0495604_0000052 3300047317 Bacteria 103088
381 Ga0495604_0002534 3300047317 Bacteria 14577
382 Ga0495604_0004777 3300047317 Bacteria 10741
383 Ga0495604_0036439 3300047317 Bacteria 3878
384 Ga0495604_0050686 3300047317 Bacteria 3222
385 Ga0495604_0063100 3300047317 Bacteria 2827
386 Ga0495674_0000328 3300047319 Bacteria 41808
387 Ga0495674_0008773 3300047319 Bacteria 9618
388 Ga0495674_0033285 3300047319 Bacteria 4670
389 Ga0495674_0086378 3300047319 Bacteria 2686
390 Ga0495674_0087933 3300047319 Bacteria 2658
391 Ga0495674_0142882 3300047319 Bacteria 2011
392 Ga0495676_0004343 3300047321 Bacteria 12953
393 Ga0495680_0000027 3300047322 Bacteria 113036
394 Ga0495680_0005370 3300047322 Bacteria 12082
395 Ga0495680_0006297 3300047322 Bacteria 11052
396 Ga0495680_0007915 3300047322 Bacteria 9693
397 Ga0495680_0011141 3300047322 Bacteria 7983
398 Ga0495680_0034733 3300047322 Bacteria 4068
399 Ga0495680_0043733 3300047322 Bacteria 3544
400 Ga0495680_0059578 3300047322 Bacteria 2946
401 Ga0495675_0000399 3300047444 Bacteria 29995
402 Ga0495675_0003287 3300047444 Bacteria 9716
403 Ga0495675_0030589 3300047444 Bacteria 3435
404 Ga0495675_0075141 3300047444 Bacteria 2129
405 Ga0495684_0001577 3300047471 Bacteria 18280
406 Ga0495684_0009309 3300047471 Bacteria 7581
407 Ga0495684_0066131 3300047471 Bacteria 2748
408 Ga0495684_0207564 3300047471 Bacteria 1442
409 Ga0495593_0008429 3300047673 Bacteria 5995
410 Ga0495593_0095840 3300047673 Bacteria 1525
411 Ga0495602_0000236 3300048088 Bacteria 51630
412 Ga0495602_0000747 3300048088 Bacteria 30870
413 Ga0495602_0058202 3300048088 Bacteria 3385
414 Ga0495602_0058442 3300048088 Bacteria 3375
415 Ga0495614_0008574 3300048089 Bacteria 4546
416 Ga0496100_0070994 3300048903 Bacteria 2324
417 Ga0496101_0067318 3300048904 Bacteria 2615
418 Ga0496103_0049169 3300048906 Bacteria 2607
419 Ga0496104_0022074 3300048907 Bacteria 5849
420 Ga0496104_0052673 3300048907 Bacteria 3844
421 Ga0496104_0095695 3300048907 Bacteria 2841
422 Ga0496104_0177910 3300048907 Bacteria 2037
423 Ga0496105_0000661 3300048908 Bacteria 23132
424 Ga0496105_0113770 3300048908 Bacteria 2232
425 Ga0496106_0048381 3300048909 Bacteria 3202
426 Ga0496107_0052806 3300048910 Bacteria 2931
427 Ga0496108_0056092 3300048911 Bacteria 3309
428 Ga0496109_0074948 3300048912 Bacteria 3111
429 Ga0496109_0141045 3300048912 Bacteria 2253
430 Ga0496110_0193704 3300048913 Bacteria 1846
431 Ga0496111_0181719 3300048914 Bacteria 1563
432 Ga0496112_0000328 3300048915 Bacteria 30672
433 Ga0496112_0072389 3300048915 Bacteria 3407
434 Ga0496112_0309494 3300048915 Bacteria 1525
435 Ga0496113_0035852 3300048916 Bacteria 3631
436 Ga0496114_0069044 3300048917 Bacteria 2967
437 Ga0496114_0213366 3300048917 Bacteria 1693
438 Ga0496115_0007134 3300048918 Bacteria 8205
439 Ga0496115_0135513 3300048918 Bacteria 2030
440 Ga0496115_0250136 3300048918 Bacteria 1459
441 Ga0501033_0000203 3300049570 Bacteria 56963
442 Ga0501039_0023967 3300049575 Bacteria 4686
443 Ga0501043_0076060 3300049579 Bacteria 2637
444 Ga0501046_0000420 3300049580 Bacteria 42319
445 Ga0501046_0009062 3300049580 Bacteria 8627
446 Ga0501047_0000168 3300049581 Bacteria 80293
447 Ga0501047_0028944 3300049581 Bacteria 5343
448 Ga0501047_0224963 3300049581 Bacteria 1731
449 Ga0501048_0067283 3300049582 Bacteria 2532
450 Ga0501070_0104818 3300049586 Bacteria 2338
451 Ga0501080_0054871 3300049742 Bacteria 3711
452 Ga0501035_0159478 3300049822 Bacteria 1953
453 nmdc:mga0n895_134902_c1 3300050512 Bacteria 2495
454 nmdc:mga0n895_232847_c1 3300050512 Bacteria 1869
455 nmdc:mga0n895_3056_c1 3300050512 Bacteria 13304
456 nmdc:mga0rr50_780_c1 3300050513 Bacteria 17137
457 nmdc:mga08x19_75317_c1 3300050514 Bacteria 2206
458 nmdc:mga0a205_145612_c1 3300050515 Bacteria 2269
459 Ga0495601_0012484 3300053077 Bacteria 5096
460 Ga0495601_0024064 3300053077 Bacteria 3748
461 Ga0495612_0004298 3300053078 Bacteria 5914
462 Ga0495595_0000944 3300053084 Bacteria 11191
463 Ga0495595_0005220 3300053084 Bacteria 5246
464 Ga0495619_0009308 3300053085 Bacteria 6201
465 Ga0495619_0018454 3300053085 Bacteria 4426
466 Ga0495619_0019879 3300053085 Bacteria 4274
467 2623590932 2622736626 Bacteria 7181580
468 2644261943 2643221647 Bacteria 10741251
469 2808873890 2808606365 Bacteria 4301966
470 2808914612 2808606375 Bacteria 9466072
471 2856748363 2856741275 Bacteria 8096094
472 2858907011 2858902515 Bacteria 7086037
473 2867302689 2867302475 Bacteria 7087181
474 2867314313 2867312974 Bacteria 7058875
475 2867321617 2867319477 Bacteria 7069771
476 2873315549 2873314349 Bacteria 8512634
477 2891567462 2891562705 Bacteria 8039471
478 2954382839 2954380949 Bacteria 10050426
479 2954693658 2954691527 Bacteria 10720516
480 2954708753 2954701450 Bacteria 10834262
481 2954713305 2954711539 Bacteria 10867210
482 2954723265 2954721474 Bacteria 10456478
483 2954738563 2954731030 Bacteria 10243860
484 2954742171 2954740390 Bacteria 10229294
485 2954757421 2954749733 Bacteria 10366972
486 2954761150 2954759201 Bacteria 9358192
487 Ga0213875_10000801
488 rootH2_10046051
489 Ga0070658_10116436
490 Ga0070683_100004079
491 Ga0070683_100185755
492 Ga0070670_100204232
493 Ga0070682_100063038
494 Ga0068868_100115168
495 Ga0070660_100009661
496 Ga0070689_100012441
497 Ga0070661_100023456
498 Ga0070692_10018268
499 Ga0070669_100367501
500 Ga0070671_100031380
501 Ga0070673_100055269
502 Ga0070688_100151241
503 Ga0070659_100077909
504 Ga0070667_100083118
505 Ga0070703_10007389
506 Ga0070709_10001393
507 Ga0070709_10004393
508 Ga0070709_10029130
509 Ga0070714_100001932
510 Ga0070714_100004758
511 Ga0070714_100006919
512 Ga0070714_100038128
513 Ga0070714_100103967
514 Ga0070713_100000812
515 Ga0070713_100010105
516 Ga0070713_100010910
517 Ga0070713_100012424
518 Ga0070713_100022060
519 Ga0070713_100030957
520 Ga0070710_10000495
521 Ga0070710_10001280
522 Ga0070701_10057594
523 Ga0070711_100001628
524 Ga0070711_100041680
525 Ga0070711_100072430
526 Ga0070711_100123208
527 Ga0070705_100007505
528 Ga0070708_100004997
529 Ga0070663_100005907
530 Ga0070678_100168047
531 Ga0070685_10064334
532 Ga0070706_100004171
533 Ga0070706_100009702
534 Ga0070706_100132767
535 Ga0070707_100000166
536 Ga0070707_100001693
537 Ga0070698_100000006
538 Ga0070698_100000804
539 Ga0070698_100001088
540 Ga0070698_100059250
541 Ga0070698_100088358
542 Ga0070699_100128426
543 Ga0070679_100067235
544 Ga0070679_100118567
545 Ga0070684_100090307
546 Ga0070684_100224946
547 Ga0070697_100047264
548 Ga0070697_100145591
549 Ga0068853_100061334
550 Ga0070672_100249086
551 Ga0070693_100020068
552 Ga0070704_100155966
553 Ga0068855_100218354
554 Ga0070664_100124559
555 Ga0068854_100145565
556 Ga0068856_100042335
557 Ga0068856_100064294
558 Ga0068856_100119689
559 Ga0068859_100096282
560 Ga0068861_100299747
561 Ga0068870_10088838
562 Ga0068863_100165953
563 Ga0070717_10001234
564 Ga0070717_10006107
565 Ga0070717_10006960
566 Ga0070717_10022391
567 Ga0070717_10089793
568 Ga0070717_10113593
569 Ga0070717_10172699
570 Ga0070717_10255294
571 Ga0070715_10012589
572 Ga0070716_100000112
573 Ga0070716_100016411
574 Ga0070712_100005448
575 Ga0070712_100006628
576 Ga0070712_100011981
577 Ga0070712_100049646
578 Ga0070712_100051968
579 Ga0070712_100101695
580 Ga0097621_100261457
581 Ga0075433_10146021
582 Ga0075434_100005843
583 Ga0075434_100022650
584 Ga0097620_100096285
585 Ga0075435_100003348
586 Ga0075435_100010797
587 Ga0105240_10058742
588 Ga0105245_10236584
589 Ga0105241_10040344
590 Ga0105242_10137775
591 Ga0105246_10012541
592 Ga0157370_10084959
593 Ga0157369_10158232
594 Ga0157378_10036017
595 Ga0163162_10040823
596 Ga0157375_10081947
597 Ga0163163_10151768
598 Ga0163163_10521550
599 Ga0157380_10181278
600 Ga0157377_10009441
601 Ga0157379_10051944
602 Ga0157376_10123770
603 Ga0157376_10150117
604 Ga0213875_10037878
605 Ga0207653_10021249
606 Ga0207692_10001034
607 Ga0207692_10017124
608 Ga0207692_10084903
609 Ga0207688_10002695
610 Ga0207647_10054652
611 Ga0207685_10015189
612 Ga0207685_10049880
613 Ga0207699_10001286
614 Ga0207699_10002425
615 Ga0207699_10009031
616 Ga0207699_10056534
617 Ga0207699_10134916
618 Ga0207643_10006540
619 Ga0207684_10000893
620 Ga0207684_10002178
621 Ga0207684_10016625
622 Ga0207684_10100748
623 Ga0207654_10108457
624 Ga0207693_10002516
625 Ga0207693_10019367
626 Ga0207693_10051684
627 Ga0207693_10054823
628 Ga0207693_10107623
629 Ga0207693_10116804
630 Ga0207663_10003350
631 Ga0207663_10029071
632 Ga0207663_10034638
633 Ga0207663_10137432
634 Ga0207663_10143400
635 Ga0207662_10001365
636 Ga0207657_10009973
637 Ga0207652_10056706
638 Ga0207646_10000049
639 Ga0207646_10006717
640 Ga0207646_10326704
641 Ga0207694_10096245
642 Ga0207700_10001490
643 Ga0207700_10005304
644 Ga0207700_10007808
645 Ga0207700_10008800
646 Ga0207700_10036224
647 Ga0207700_10088201
648 Ga0207700_10094820
649 Ga0207700_10124590
650 Ga0207664_10000313
651 Ga0207664_10005624
652 Ga0207664_10040000
653 Ga0207664_10043625
654 Ga0207664_10067341
655 Ga0207664_10122258
656 Ga0207706_10032567
657 Ga0207665_10000128
658 Ga0207665_10007742
659 Ga0207665_10016301
660 Ga0207665_10037572
661 Ga0207665_10053709
662 Ga0207691_10037238
663 Ga0207689_10001715
664 Ga0207667_10464571
665 Ga0207678_10018557
666 Ga0207708_10015681
667 Ga0207702_10058008
668 Ga0207702_10109815
669 Ga0207702_10150473
670 Ga0207674_10001322
671 Ga0207675_100019086
672 Ga0207683_10008312
673 Ga0373926_0012950
674 Ga0373926_0037572
675 Ga0373928_0020247
676 Ga0373934_0000135
677 Ga0373934_0002775
678 Ga0373934_0003070
679 Ga0373934_0015549
680 Ga0373934_0044049
681 Ga0373934_0051722
682 Ga0373923_0002210
683 Ga0373923_0016662
684 Ga0373923_0029773
685 Ga0373923_0042571
686 Ga0373923_0061138
687 Ga0373932_0009424
688 Ga0373936_0001803
689 Ga0373936_0004790
690 Ga0373936_0014349
691 Ga0373936_0030236
692 Ga0373945_0000797
693 Ga0373953_0000064
694 Ga0373953_0018871
695 Ga0373954_0000427
696 Ga0373954_0011885
697 Ga0373956_0000192
698 Ga0373956_0003968
699 Ga0373956_0028927
700 Ga0373956_0037439
701 Ga0373957_0000156
702 Ga0373957_0001305
703 Ga0373957_0001624
704 Ga0373957_0020447
705 Ga0373943_0002465
706 Ga0373943_0126262
707 Ga0373946_0000356
708 Ga0373946_0058699
709 Ga0373946_0092284
710 Ga0373955_0000138
711 Ga0373955_0009622
712 Ga0373955_0013540
713 Ga0373955_0019711
714 Ga0373955_0040701
715 Ga0373924_0003190
716 Ga0373924_0010102
717 Ga0373924_0026172
718 Ga0373931_0114583
719 Ga0373935_0006299
720 Ga0373935_0016726
721 Ga0373927_0005486
722 Ga0373933_0000015
723 Ga0373933_0020753
724 Ga0373933_0062232
725 Ga0373933_0062351
726 Ga0373933_0151997
727 Ga0373947_0012146
728 Ga0373947_0048955
729 Ga0373937_0000053
730 Ga0373937_0000952
731 Ga0373937_0018693
732 Ga0373937_0133538
733 Ga0373937_0163005
734 Ga0373925_0007017
735 Ga0373925_0008325
736 Ga0373925_0013280
737 Ga0373925_0026254
738 Ga0373925_0053469
739 Ga0436364_0349698
740 Ga0436364_0524996
741 Ga0436364_0871460
742 Ga0436364_0904341
743 Ga0436364_1332433
744 Ga0436365_1415948
745 Ga0436361_1156408
746 Ga0436363_0141279
747 Ga0436363_1444734
748 Ga0436362_0834704
749 Ga0451853_1112426
750 Ga0466963_0029318
751 Ga0466963_0091453
752 Ga0466964_0005427
753 Ga0466971_0059449
754 Ga0466968_0022099
755 Ga0466970_0100240
756 Ga0466960_0016922
757 Ga0466967_0025971
758 Ga0466967_0057025
759 Ga0466967_0081595
760 Ga0495592_0000057
761 Ga0495592_0041950
762 Ga0495592_0051923
763 Ga0495592_0061469
764 Ga0495592_0079973
765 Ga0495592_0112044
766 Ga0495629_0001289
767 Ga0495629_0028277
768 Ga0495641_0016339
769 Ga0495641_0020551
770 Ga0495651_0000032
771 Ga0495651_0001462
772 Ga0495651_0006098
773 Ga0495651_0039320
774 Ga0495651_0056881
775 Ga0495651_0065935
776 Ga0495651_0122174
777 Ga0495653_0000654
778 Ga0495653_0000884
779 Ga0495653_0010689
780 Ga0495653_0025567
781 Ga0495653_0076811
782 Ga0495653_0081933
783 Ga0495653_0115361
784 Ga0495582_0003235
785 Ga0495582_0028527
786 Ga0495639_0017837
787 Ga0495639_0063646
788 Ga0495662_0010419
789 Ga0495664_0006616
790 Ga0495664_0088424
791 Ga0495608_0000045
792 Ga0495608_0001665
793 Ga0495608_0011269
794 Ga0495608_0014268
795 Ga0495608_0022093
796 Ga0495608_0022532
797 Ga0495608_0078216
798 Ga0495618_0009901
799 Ga0495618_0022992
800 Ga0495618_0029157
801 Ga0495628_0000063
802 Ga0495628_0004952
803 Ga0495628_0036377
804 Ga0495628_0174404
805 Ga0495628_0201372
806 Ga0495666_0129267
807 Ga0495652_0000078
808 Ga0495652_0007933
809 Ga0495652_0021317
810 Ga0495652_0042324
811 Ga0495652_0076541
812 Ga0495652_0096181
813 Ga0495652_0250541
814 Ga0495652_0275712
815 Ga0495640_0039765
816 Ga0495640_0065569
817 Ga0495586_0019025
818 Ga0495587_0000050
819 Ga0495587_0001259
820 Ga0495587_0017696
821 Ga0495645_0013817
822 Ga0495645_0062859
823 Ga0495645_0129286
824 Ga0495645_0190477
825 Ga0495667_0000055
826 Ga0495667_0001024
827 Ga0495667_0001264
828 Ga0495667_0011501
829 Ga0495667_0027729
830 Ga0495667_0046856
831 Ga0495634_0016148
832 Ga0495634_0017252
833 Ga0495635_0003804
834 Ga0495635_0007047
835 Ga0495635_0008898
836 Ga0495635_0081216
837 Ga0495635_0154894
838 Ga0495657_0000009
839 Ga0495657_0003589
840 Ga0495657_0012109
841 Ga0495657_0016863
842 Ga0495657_0031644
843 Ga0495599_0000033
844 Ga0495599_0000479
845 Ga0495599_0014812
846 Ga0495599_0053745
847 Ga0495599_0071122
848 Ga0495623_0000423
849 Ga0495623_0018506
850 Ga0495623_0090147
851 Ga0495646_0013805
852 Ga0495646_0053032
853 Ga0495613_0009637
854 Ga0495613_0013100
855 Ga0495624_0003558
856 Ga0495624_0132124
857 Ga0495624_0186989
858 Ga0495600_0000729
859 Ga0495600_0004684
860 Ga0495600_0025020
861 Ga0495600_0055324
862 Ga0495600_0134444
863 Ga0495581_0009539
864 Ga0495581_0093182
865 Ga0495581_0105115
866 Ga0495604_0000052
867 Ga0495604_0002534
868 Ga0495604_0004777
869 Ga0495604_0036439
870 Ga0495604_0050686
871 Ga0495604_0063100
872 Ga0495674_0000328
873 Ga0495674_0008773
874 Ga0495674_0033285
875 Ga0495674_0086378
876 Ga0495674_0087933
877 Ga0495674_0142882
878 Ga0495676_0004343
879 Ga0495680_0000027
880 Ga0495680_0005370
881 Ga0495680_0006297
882 Ga0495680_0007915
883 Ga0495680_0011141
884 Ga0495680_0034733
885 Ga0495680_0043733
886 Ga0495680_0059578
887 Ga0495675_0000399
888 Ga0495675_0003287
889 Ga0495675_0030589
890 Ga0495675_0075141
891 Ga0495684_0001577
892 Ga0495684_0009309
893 Ga0495684_0066131
894 Ga0495684_0207564
895 Ga0495593_0008429
896 Ga0495593_0095840
897 Ga0495602_0000236
898 Ga0495602_0000747
899 Ga0495602_0058202
900 Ga0495602_0058442
901 Ga0495614_0008574
902 Ga0496100_0070994
903 Ga0496101_0067318
904 Ga0496103_0049169
905 Ga0496104_0022074
906 Ga0496104_0052673
907 Ga0496104_0095695
908 Ga0496104_0177910
909 Ga0496105_0000661
910 Ga0496105_0113770
911 Ga0496106_0048381
912 Ga0496107_0052806
913 Ga0496108_0056092
914 Ga0496109_0074948
915 Ga0496109_0141045
916 Ga0496110_0193704
917 Ga0496111_0181719
918 Ga0496112_0000328
919 Ga0496112_0072389
920 Ga0496112_0309494
921 Ga0496113_0035852
922 Ga0496114_0069044
923 Ga0496114_0213366
924 Ga0496115_0007134
925 Ga0496115_0135513
926 Ga0496115_0250136
927 Ga0501033_0000203
928 Ga0501039_0023967
929 Ga0501043_0076060
930 Ga0501046_0000420
931 Ga0501046_0009062
932 Ga0501047_0000168
933 Ga0501047_0028944
934 Ga0501047_0224963
935 Ga0501048_0067283
936 Ga0501070_0104818
937 Ga0501080_0054871
938 Ga0501035_0159478
939 nmdc:mga0n895_134902_c1
940 nmdc:mga0n895_232847_c1
941 nmdc:mga0n895_3056_c1
942 nmdc:mga0rr50_780_c1
943 nmdc:mga08x19_75317_c1
944 nmdc:mga0a205_145612_c1
945 Ga0495601_0012484
946 Ga0495601_0024064
947 Ga0495612_0004298
948 Ga0495595_0000944
949 Ga0495595_0005220
950 Ga0495619_0009308
951 Ga0495619_0018454
952 Ga0495619_0019879
953 2623590932
954 2644261943
955 2808873890
956 2808914612
957 2856748363
958 2858907011
959 2867302689
960 2867314313
961 2867321617
962 2873315549
963 2891567462
964 2954382839
965 2954693658
966 2954708753
967 2954713305
968 2954723265
969 2954738563
970 2954742171
971 2954757421
972 2954761150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

180

396

0.95

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

46

159

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyj-assembly1.cif.gz_A crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from rubrobacter xylanophilus 0.9647 3 359
3cyj-assembly1.cif.gz_A crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from rubrobacter xylanophilus 0.9515 3 359
5xd9-assembly1.cif.gz_A-2 crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.9284 3 359
3ck5-assembly1.cif.gz_A crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9263 1 359
3ck5-assembly1.cif.gz_A crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9238 1 359
ID Description Score Start End Superfamily
3cyjD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9665 2 112 3.30.390.10
3cyjD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9435 113 350 3.20.20.120
3cyjD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9358 113 350 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9223 113 350 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9148 113 350 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A6G2I8J9-F1-model_v4 Mandelate racemase 0.9789 1 360 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A401VX72-F1-model_v4 Mandelate racemase 0.9788 4 360 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A538B735-F1-model_v4 Mandelate racemase 0.9776 2 148 GO:0000287
GO:0016052
GO:0016836
AF-A0A3N1HY20-F1-model_v4 L-alanine-DL-glutamate epimerase-like enolase superfamily enzyme 0.9774 2 360 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A846LQR1-F1-model_v4 L-alanine-DL-glutamate epimerase-like enolase superfamily enzyme 0.9771 3 360 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Map