F453138

General Info

Members Datasets Scaffolds Average Seq Length
485 275 970 151

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0564783|Ga0451855_0564783_137_676
Length 179
Sequence MSQSPMTIGLAREQPTRLDLGKIWWTFQMKSRLLIVHHTPSPHCQEMFEAVLSGATDPEIEGVEVVRRPALTCSAADMLEADGYLLGTPANLGYISGALKHAFDQSYYQILDSTRGRPFGVYLHGNEGTEGAERAIDGITAGLGWVRTAETVIVAGKPGKDDLEACWNLGATVAAALME

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
259 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
264 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
265 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
266 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
267 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
268 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
269 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
270 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
271 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
272 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
273 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
274 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
275 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.55
Nodule 0.21
Rhizoplane 8.87
Rhizosphere 74.23
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0564783 3300041511 Bacteria 716
2 JGI24739J22299_10238343 3300001989 Bacteria 533
3 JGI24743J22301_10015914 3300001991 Bacteria 1399
4 JGI24735J21928_10176446 3300002067 Bacteria 618
5 JGI24735J21928_10245717 3300002067 Bacteria 521
6 JGI24745J21846_1001039 3300002073 Bacteria 2608
7 JGI24738J21930_10117043 3300002075 Bacteria 577
8 JGI24744J21845_10005816 3300002077 Bacteria 2555
9 JGI24744J21845_10006934 3300002077 Bacteria 2341
10 JGI24034J26672_10011796 3300002239 Bacteria 1312
11 JGI24742J22300_10001379 3300002244 Bacteria 3821
12 Ga0070658_10622247 3300005327 Bacteria 936
13 Ga0070690_100061771 3300005330 Bacteria 2415
14 Ga0070690_100304470 3300005330 Bacteria 1144
15 Ga0068869_100059474 3300005334 Bacteria 2798
16 Ga0068869_100196857 3300005334 Bacteria 1587
17 Ga0070666_10021594 3300005335 Bacteria 4173
18 Ga0070682_100018103 3300005337 Bacteria 4113
19 Ga0070682_100112619 3300005337 Bacteria 1816
20 Ga0068868_100038226 3300005338 Bacteria 3725
21 Ga0068868_102238350 3300005338 Bacteria 521
22 Ga0070660_100204452 3300005339 Bacteria 1602
23 Ga0070689_100339988 3300005340 Bacteria 1257
24 Ga0070689_100815934 3300005340 Bacteria 821
25 Ga0070691_10048271 3300005341 Bacteria 2025
26 Ga0070691_10294806 3300005341 Bacteria 884
27 Ga0070687_100051064 3300005343 Bacteria 2139
28 Ga0070692_10039780 3300005345 Bacteria 2402
29 Ga0070692_10664179 3300005345 Bacteria 697
30 Ga0070668_100027152 3300005347 Bacteria 4345
31 Ga0070668_100149035 3300005347 Bacteria 1890
32 Ga0070668_100940456 3300005347 Bacteria 774
33 Ga0070669_100191738 3300005353 Bacteria 1603
34 Ga0070671_100049921 3300005355 Bacteria 3480
35 Ga0070671_100112599 3300005355 Bacteria 2286
36 Ga0070671_100581688 3300005355 Bacteria 967
37 Ga0070671_101232228 3300005355 Bacteria 659
38 Ga0070674_100082720 3300005356 Bacteria 2297
39 Ga0070673_100124899 3300005364 Bacteria 2152
40 Ga0070673_100640541 3300005364 Bacteria 972
41 Ga0070673_101074372 3300005364 Bacteria 751
42 Ga0070659_100696981 3300005366 Bacteria 878
43 Ga0070667_100050954 3300005367 Bacteria 3489
44 Ga0070667_100105600 3300005367 Bacteria 2437
45 Ga0070703_10388355 3300005406 Bacteria 605
46 Ga0070709_10291322 3300005434 Bacteria 1189
47 Ga0070714_100075630 3300005435 Bacteria 2922
48 Ga0070710_10006509 3300005437 Bacteria 5615
49 Ga0070701_10001427 3300005438 Bacteria 8840
50 Ga0070711_100025857 3300005439 Bacteria 3842
51 Ga0070711_100098842 3300005439 Bacteria 2119
52 Ga0070705_100043429 3300005440 Bacteria 2576
53 Ga0070705_100153261 3300005440 Bacteria 1531
54 Ga0070700_100050442 3300005441 Bacteria 2587
55 Ga0070700_100503549 3300005441 Bacteria 932
56 Ga0070694_100010884 3300005444 Bacteria 5628
57 Ga0070694_100290414 3300005444 Bacteria 1250
58 Ga0070663_100013747 3300005455 Bacteria 5175
59 Ga0070663_100022058 3300005455 Bacteria 4249
60 Ga0070663_100154624 3300005455 Bacteria 1761
61 Ga0070663_100787188 3300005455 Bacteria 815
62 Ga0070678_100090615 3300005456 Bacteria 2344
63 Ga0070678_100385627 3300005456 Bacteria 1213
64 Ga0070678_100434420 3300005456 Bacteria 1147
65 Ga0070662_100013006 3300005457 Bacteria 5531
66 Ga0070662_100122808 3300005457 Bacteria 1992
67 Ga0070681_10770305 3300005458 Bacteria 879
68 Ga0068867_100031588 3300005459 Bacteria 3824
69 Ga0068867_100188495 3300005459 Bacteria 1644
70 Ga0068867_101177280 3300005459 Bacteria 703
71 Ga0070685_10012918 3300005466 Bacteria 4396
72 Ga0070685_10125369 3300005466 Bacteria 1599
73 Ga0070685_10148216 3300005466 Bacteria 1484
74 Ga0070685_10153371 3300005466 Bacteria 1462
75 Ga0070684_100389970 3300005535 Bacteria 1283
76 Ga0068853_100006169 3300005539 Bacteria 9494
77 Ga0068853_100020695 3300005539 Bacteria 5472
78 Ga0068853_100403475 3300005539 Bacteria 1280
79 Ga0068853_100655699 3300005539 Bacteria 999
80 Ga0070686_100236460 3300005544 Bacteria 1328
81 Ga0070695_100063171 3300005545 Bacteria 2406
82 Ga0070696_100704107 3300005546 Bacteria 823
83 Ga0070693_100012898 3300005547 Bacteria 4243
84 Ga0070693_100057614 3300005547 Bacteria 2246
85 Ga0070693_100210499 3300005547 Bacteria 1268
86 Ga0070665_100056071 3300005548 Bacteria 3951
87 Ga0070665_100101370 3300005548 Bacteria 2883
88 Ga0070665_100763927 3300005548 Bacteria 979
89 Ga0070704_100028325 3300005549 Bacteria 3725
90 Ga0068855_100106019 3300005563 Bacteria 3231
91 Ga0068855_100506620 3300005563 Bacteria 1311
92 Ga0068855_100659814 3300005563 Bacteria 1122
93 Ga0068855_101133863 3300005563 Bacteria 816
94 Ga0070664_100376950 3300005564 Bacteria 1294
95 Ga0068854_100031321 3300005578 Bacteria 3695
96 Ga0068854_100121244 3300005578 Bacteria 1985
97 Ga0068854_100168962 3300005578 Bacteria 1700
98 Ga0068854_101359256 3300005578 Bacteria 641
99 Ga0068856_100132254 3300005614 Bacteria 2500
100 Ga0068856_100356153 3300005614 Bacteria 1482
101 Ga0070702_100114608 3300005615 Bacteria 1677
102 Ga0070702_100151771 3300005615 Bacteria 1488
103 Ga0070702_100183673 3300005615 Bacteria 1370
104 Ga0068852_100056994 3300005616 Bacteria 3379
105 Ga0068852_100231137 3300005616 Bacteria 1763
106 Ga0068859_100071780 3300005617 Bacteria 3497
107 Ga0068859_100257040 3300005617 Bacteria 1837
108 Ga0068864_100085711 3300005618 Bacteria 2770
109 Ga0068866_10013039 3300005718 Bacteria 3635
110 Ga0068866_10195226 3300005718 Bacteria 1205
111 Ga0068861_100021924 3300005719 Bacteria 4595
112 Ga0068861_100067600 3300005719 Bacteria 2759
113 Ga0068861_100560645 3300005719 Bacteria 1042
114 Ga0068861_100675096 3300005719 Bacteria 957
115 Ga0068851_10039079 3300005834 Bacteria 2383
116 Ga0068870_10055477 3300005840 Bacteria 2111
117 Ga0068870_10201488 3300005840 Bacteria 1207
118 Ga0068870_11415475 3300005840 Bacteria 510
119 Ga0068863_101768231 3300005841 Bacteria 628
120 Ga0068858_100026283 3300005842 Bacteria 5411
121 Ga0068858_100056172 3300005842 Bacteria 3639
122 Ga0068858_100345082 3300005842 Bacteria 1425
123 Ga0068860_100012267 3300005843 Bacteria 8446
124 Ga0068862_100027160 3300005844 Bacteria 4817
125 Ga0068862_100034281 3300005844 Bacteria 4293
126 Ga0081455_10076489 3300005937 Bacteria 2757
127 Ga0081455_10084571 3300005937 Bacteria 2589
128 Ga0081538_10123089 3300005981 Bacteria 1241
129 Ga0081538_10202311 3300005981 Bacteria 814
130 Ga0075365_10004973 3300006038 Bacteria 7116
131 Ga0075365_10015397 3300006038 Bacteria 4626
132 Ga0075365_10022977 3300006038 Bacteria 3916
133 Ga0075368_10022373 3300006042 Bacteria 2407
134 Ga0075363_100020118 3300006048 Bacteria 3345
135 Ga0075363_100100047 3300006048 Bacteria 1604
136 Ga0075363_100103750 3300006048 Bacteria 1575
137 Ga0075363_100308682 3300006048 Bacteria 919
138 Ga0075364_10084793 3300006051 Bacteria 2098
139 Ga0075364_10137368 3300006051 Bacteria 1643
140 Ga0075364_10211443 3300006051 Bacteria 1315
141 Ga0075364_10359180 3300006051 Bacteria 993
142 Ga0070715_10004408 3300006163 Bacteria 4616
143 Ga0070715_10008441 3300006163 Bacteria 3591
144 Ga0070716_100003670 3300006173 Bacteria 7266
145 Ga0070716_100011480 3300006173 Bacteria 4461
146 Ga0070716_100612960 3300006173 Bacteria 820
147 Ga0070712_100007172 3300006175 Bacteria 6950
148 Ga0070712_100036825 3300006175 Bacteria 3331
149 Ga0075362_10082598 3300006177 Bacteria 1483
150 Ga0075367_10050545 3300006178 Bacteria 2455
151 Ga0075369_10016727 3300006186 Bacteria 2963
152 Ga0075369_10027429 3300006186 Bacteria 2381
153 Ga0075366_10339128 3300006195 Bacteria 922
154 Ga0097621_100108213 3300006237 Bacteria 2346
155 Ga0075370_10005493 3300006353 Bacteria 6311
156 Ga0075370_10010294 3300006353 Bacteria 4886
157 Ga0075370_10084261 3300006353 Bacteria 1830
158 Ga0075370_10114399 3300006353 Bacteria 1568
159 Ga0068871_100198670 3300006358 Bacteria 1730
160 Ga0075428_100313718 3300006844 Bacteria 1685
161 Ga0075431_100658812 3300006847 Bacteria 1027
162 Ga0068865_100030432 3300006881 Bacteria 3591
163 Ga0068865_100554959 3300006881 Bacteria 965
164 Ga0068865_100712906 3300006881 Bacteria 858
165 Ga0097620_100071780 3300006931 Bacteria 3497
166 Ga0097620_100257071 3300006931 Bacteria 1837
167 Ga0105240_11213100 3300009093 Bacteria 798
168 Ga0105245_10013134 3300009098 Bacteria 7217
169 Ga0105245_10093002 3300009098 Bacteria 2778
170 Ga0105245_10133450 3300009098 Bacteria 2331
171 Ga0105245_11728992 3300009098 Bacteria 678
172 Ga0105247_10009546 3300009101 Bacteria 5887
173 Ga0105247_10203457 3300009101 Bacteria 1332
174 Ga0105247_10293576 3300009101 Bacteria 1125
175 Ga0114129_10255345 3300009147 Bacteria 2352
176 Ga0114129_11394677 3300009147 Bacteria 865
177 Ga0105243_10016292 3300009148 Bacteria 5624
178 Ga0105241_10042229 3300009174 Bacteria 3448
179 Ga0105241_10513807 3300009174 Bacteria 1070
180 Ga0105242_10004961 3300009176 Bacteria 10294
181 Ga0105242_10179988 3300009176 Bacteria 1865
182 Ga0105242_10599600 3300009176 Bacteria 1064
183 Ga0105248_10031898 3300009177 Bacteria 5887
184 Ga0105248_10970063 3300009177 Bacteria 960
185 Ga0105237_10016653 3300009545 Bacteria 7635
186 Ga0105237_10125799 3300009545 Bacteria 2558
187 Ga0105237_10208625 3300009545 Bacteria 1954
188 Ga0105238_10143277 3300009551 Bacteria 2366
189 Ga0105238_10374080 3300009551 Bacteria 1415
190 Ga0105238_11284159 3300009551 Bacteria 758
191 Ga0105238_12332752 3300009551 Bacteria 570
192 Ga0105249_10034759 3300009553 Bacteria 4568
193 Ga0105239_10083105 3300010375 Bacteria 3526
194 Ga0105239_10090628 3300010375 Bacteria 3373
195 Ga0105239_10723753 3300010375 Bacteria 1138
196 Ga0105246_10100756 3300011119 Bacteria 2102
197 Ga0157370_10366856 3300013104 Bacteria 1327
198 Ga0157370_10394269 3300013104 Bacteria 1275
199 Ga0157369_10209273 3300013105 Bacteria 2045
200 Ga0157374_10014955 3300013296 Bacteria 6800
201 Ga0157374_10138903 3300013296 Bacteria 2358
202 Ga0157378_10046441 3300013297 Bacteria 3860
203 Ga0163162_10008693 3300013306 Bacteria 9884
204 Ga0163162_10064950 3300013306 Bacteria 3695
205 Ga0157372_10046245 3300013307 Bacteria 4831
206 Ga0157375_10041094 3300013308 Bacteria 4463
207 Ga0157375_10627263 3300013308 Bacteria 1233
208 Ga0163163_10260234 3300014325 Bacteria 1786
209 Ga0163163_10773872 3300014325 Bacteria 1023
210 Ga0157380_10039386 3300014326 Bacteria 3675
211 Ga0157380_10224794 3300014326 Bacteria 1682
212 Ga0157377_10024126 3300014745 Bacteria 3230
213 Ga0157377_10040056 3300014745 Bacteria 2593
214 Ga0157379_10747033 3300014968 Bacteria 921
215 Ga0157376_10243296 3300014969 Bacteria 1677
216 Ga0163161_10010367 3300017792 Bacteria 6453
217 Ga0163161_10115881 3300017792 Bacteria 2008
218 Ga0163161_10245065 3300017792 Bacteria 1395
219 Ga0163161_10317157 3300017792 Bacteria 1231
220 Ga0213876_10004579 3300021384 Bacteria 7711
221 Ga0213876_10005148 3300021384 Bacteria 7209
222 Ga0213876_10393888 3300021384 Bacteria 737
223 Ga0213875_10087503 3300021388 Bacteria 1453
224 Ga0209051_1020377 3300025303 Bacteria 2857
225 Ga0209051_1072585 3300025303 Bacteria 1028
226 Ga0207656_10018007 3300025321 Bacteria 2775
227 Ga0207653_10052155 3300025885 Bacteria 1364
228 Ga0207692_10020863 3300025898 Bacteria 2988
229 Ga0207642_10177750 3300025899 Bacteria 1157
230 Ga0207642_10449038 3300025899 Bacteria 781
231 Ga0207642_10568277 3300025899 Bacteria 702
232 Ga0207710_10001258 3300025900 Bacteria 12819
233 Ga0207710_10054558 3300025900 Bacteria 1800
234 Ga0207688_10003173 3300025901 Bacteria 8962
235 Ga0207680_10116937 3300025903 Bacteria 1738
236 Ga0207680_10225582 3300025903 Bacteria 1286
237 Ga0207680_10450010 3300025903 Bacteria 914
238 Ga0207647_10059912 3300025904 Bacteria 2328
239 Ga0207647_10064793 3300025904 Bacteria 2220
240 Ga0207685_10006287 3300025905 Bacteria 3221
241 Ga0207671_10089186 3300025914 Bacteria 2321
242 Ga0207671_10292601 3300025914 Bacteria 1286
243 Ga0207693_10014537 3300025915 Bacteria 6326
244 Ga0207693_10014715 3300025915 Bacteria 6285
245 Ga0207663_10004607 3300025916 Bacteria 6870
246 Ga0207663_10050292 3300025916 Bacteria 2589
247 Ga0207660_10723498 3300025917 Bacteria 812
248 Ga0207657_10113362 3300025919 Bacteria 2237
249 Ga0207681_10485039 3300025923 Bacteria 1010
250 Ga0207694_11235192 3300025924 Bacteria 632
251 Ga0207694_11432222 3300025924 Bacteria 584
252 Ga0207687_10013192 3300025927 Bacteria 5398
253 Ga0207687_10018261 3300025927 Bacteria 4627
254 Ga0207687_10104781 3300025927 Bacteria 2088
255 Ga0207700_10252149 3300025928 Bacteria 1508
256 Ga0207700_10578954 3300025928 Bacteria 998
257 Ga0207664_10100383 3300025929 Bacteria 2390
258 Ga0207664_10173104 3300025929 Bacteria 1849
259 Ga0207690_10154822 3300025932 Bacteria 1703
260 Ga0207706_10027729 3300025933 Bacteria 5063
261 Ga0207706_10085553 3300025933 Bacteria 2772
262 Ga0207686_10053432 3300025934 Bacteria 2525
263 Ga0207686_10078711 3300025934 Bacteria 2145
264 Ga0207709_10023220 3300025935 Bacteria 3528
265 Ga0207670_10013576 3300025936 Bacteria 4807
266 Ga0207704_10018034 3300025938 Bacteria 3675
267 Ga0207665_10002811 3300025939 Bacteria 11666
268 Ga0207665_10012979 3300025939 Bacteria 5477
269 Ga0207691_10178726 3300025940 Bacteria 1855
270 Ga0207711_10028716 3300025941 Bacteria 4684
271 Ga0207711_10093659 3300025941 Bacteria 2646
272 Ga0207711_10499175 3300025941 Bacteria 1134
273 Ga0207689_10034650 3300025942 Bacteria 4192
274 Ga0207689_10053450 3300025942 Bacteria 3328
275 Ga0207679_10647805 3300025945 Bacteria 955
276 Ga0207679_11947947 3300025945 Bacteria 535
277 Ga0207667_10184600 3300025949 Bacteria 2141
278 Ga0207667_10768630 3300025949 Bacteria 962
279 Ga0207651_10555436 3300025960 Bacteria 999
280 Ga0207651_10586700 3300025960 Bacteria 973
281 Ga0207712_10010034 3300025961 Bacteria 6002
282 Ga0207712_10046450 3300025961 Bacteria 3011
283 Ga0207712_10271726 3300025961 Bacteria 1379
284 Ga0207668_10004171 3300025972 Bacteria 8477
285 Ga0207668_10058561 3300025972 Bacteria 2694
286 Ga0207668_10326315 3300025972 Bacteria 1275
287 Ga0207677_10023781 3300026023 Bacteria 3791
288 Ga0207677_10503533 3300026023 Bacteria 1048
289 Ga0207677_10772049 3300026023 Bacteria 858
290 Ga0207703_10026758 3300026035 Bacteria 4543
291 Ga0207703_10046548 3300026035 Bacteria 3493
292 Ga0207703_10154910 3300026035 Bacteria 2001
293 Ga0207639_10005245 3300026041 Bacteria 8742
294 Ga0207639_10068561 3300026041 Bacteria 2764
295 Ga0207639_10612739 3300026041 Bacteria 1005
296 Ga0207639_11245274 3300026041 Bacteria 698
297 Ga0207678_10032308 3300026067 Bacteria 4561
298 Ga0207678_10032647 3300026067 Bacteria 4537
299 Ga0207678_10097493 3300026067 Bacteria 2513
300 Ga0207678_11099326 3300026067 Bacteria 704
301 Ga0207708_10029574 3300026075 Bacteria 4152
302 Ga0207708_10065647 3300026075 Bacteria 2774
303 Ga0207708_10401040 3300026075 Bacteria 1134
304 Ga0207702_10166798 3300026078 Bacteria 2016
305 Ga0207702_10899820 3300026078 Bacteria 877
306 Ga0207641_10432399 3300026088 Bacteria 1269
307 Ga0207648_10025646 3300026089 Bacteria 5248
308 Ga0207648_10031424 3300026089 Bacteria 4695
309 Ga0207648_11103929 3300026089 Bacteria 744
310 Ga0207676_11332420 3300026095 Bacteria 713
311 Ga0207674_10079905 3300026116 Bacteria 3273
312 Ga0207675_100013138 3300026118 Bacteria 7727
313 Ga0207675_100088208 3300026118 Bacteria 2914
314 Ga0207683_10050398 3300026121 Bacteria 3647
315 Ga0207683_10054416 3300026121 Bacteria 3510
316 Ga0207683_10182607 3300026121 Bacteria 1902
317 Ga0207698_10012402 3300026142 Bacteria 5575
318 Ga0207698_10131083 3300026142 Bacteria 2142
319 Ga0207698_10497501 3300026142 Bacteria 1186
320 Ga0209813_10017665 3300027866 Bacteria 1961
321 Ga0268266_10050605 3300028379 Bacteria 3565
322 Ga0268266_10431731 3300028379 Bacteria 1250
323 Ga0268265_10038519 3300028380 Bacteria 3517
324 Ga0265327_10000118 3300031251 Bacteria 172792
325 Ga0373949_0033986 3300035090 Bacteria 1227
326 Ga0373932_0132942 3300035112 Bacteria 840
327 Ga0373941_0150254 3300035115 Bacteria 854
328 Ga0373957_0034453 3300035120 Bacteria 1875
329 Ga0373931_0031207 3300035691 Bacteria 2749
330 Ga0316584_0515668 3300036712 Bacteria 838
331 Ga0436364_0825378 3300037853 Bacteria 2111
332 Ga0436365_0615230 3300039437 Bacteria 1157
333 Ga0436365_0943767 3300039437 Bacteria 12284
334 Ga0436365_1469068 3300039437 Bacteria 36678
335 Ga0436363_1206684 3300039450 Bacteria 1504
336 Ga0439466_0010586 3300041411 Bacteria 3428
337 Ga0439465_0070415 3300041413 Bacteria 1171
338 Ga0451787_758408 3300041441 Bacteria 706
339 Ga0451789_0564658 3300041443 Bacteria 986
340 Ga0451789_1095215 3300041443 Bacteria 838
341 Ga0451793_0354003 3300041452 Bacteria 2505
342 Ga0451802_0060104 3300041460 Bacteria 723
343 Ga0451802_1143654 3300041460 Bacteria 636
344 Ga0439445_0054408 3300042004 Bacteria 1085
345 Ga0439459_0031461 3300042438 Bacteria 1082
346 Ga0466966_0030639 3300044684 Bacteria 3490
347 Ga0466963_0287825 3300044694 Bacteria 1155
348 Ga0466963_0388408 3300044694 Bacteria 984
349 Ga0466963_0603340 3300044694 Bacteria 775
350 Ga0466963_0701139 3300044694 Bacteria 714
351 Ga0466960_0483672 3300044901 Unclassified 723
352 Ga0466967_1124440 3300045976 Bacteria 783
353 Ga0495603_0022455 3300046455 Bacteria 3819
354 Ga0495629_0036963 3300046459 Bacteria 3444
355 Ga0495638_0132423 3300046460 Bacteria 1463
356 Ga0495641_0022501 3300046461 Bacteria 3152
357 Ga0495653_0708949 3300046463 Bacteria 611
358 Ga0495639_0178517 3300046475 Bacteria 1033
359 Ga0495662_0063449 3300046476 Bacteria 1785
360 Ga0495606_0210705 3300046507 Bacteria 1101
361 Ga0495652_0771840 3300046529 Bacteria 642
362 Ga0495665_0040218 3300046531 Bacteria 2490
363 Ga0495640_0093532 3300046533 Bacteria 1981
364 Ga0495635_0504933 3300046663 Bacteria 796
365 Ga0495588_0109180 3300046674 Bacteria 1457
366 Ga0495658_0351725 3300046683 Bacteria 936
367 Ga0495613_0696597 3300046689 Bacteria 669
368 Ga0495649_0083002 3300046694 Bacteria 1712
369 Ga0495674_0323394 3300047319 Bacteria 1256
370 Ga0495674_0904688 3300047319 Bacteria 681
371 Ga0495676_0063817 3300047321 Bacteria 2869
372 Ga0495593_0006915 3300047673 Bacteria 6643
373 Ga0496100_0020308 3300048903 Bacteria 3980
374 Ga0496100_0092224 3300048903 Bacteria 2069
375 Ga0496101_0002021 3300048904 Bacteria 12320
376 Ga0496101_0016267 3300048904 Bacteria 5020
377 Ga0496102_0000056 3300048905 Bacteria 172707
378 Ga0496102_0018871 3300048905 Bacteria 6067
379 Ga0496102_0070169 3300048905 Bacteria 3217
380 Ga0496102_0118232 3300048905 Bacteria 2474
381 Ga0496103_0000040 3300048906 Bacteria 172148
382 Ga0496103_0009238 3300048906 Bacteria 5840
383 Ga0496103_0211711 3300048906 Bacteria 1246
384 Ga0496104_0000418 3300048907 Bacteria 37221
385 Ga0496104_1214956 3300048907 Bacteria 657
386 Ga0496105_0170424 3300048908 Bacteria 1785
387 Ga0496106_0005363 3300048909 Bacteria 9487
388 Ga0496106_0013765 3300048909 Bacteria 5975
389 Ga0496106_0073769 3300048909 Bacteria 2611
390 Ga0496106_0746662 3300048909 Bacteria 778
391 Ga0496107_0047440 3300048910 Bacteria 3093
392 Ga0496107_0048913 3300048910 Bacteria 3047
393 Ga0496107_0135370 3300048910 Bacteria 1820
394 Ga0496108_0008227 3300048911 Bacteria 8466
395 Ga0496108_0566395 3300048911 Bacteria 991
396 Ga0496108_0911269 3300048911 Bacteria 754
397 Ga0496109_0010373 3300048912 Bacteria 7957
398 Ga0496109_0668641 3300048912 Bacteria 976
399 Ga0496110_0425781 3300048913 Bacteria 1210
400 Ga0496111_0049090 3300048914 Bacteria 3043
401 Ga0496111_0111814 3300048914 Bacteria 2012
402 Ga0496112_0020832 3300048915 Bacteria 6222
403 Ga0496113_0036082 3300048916 Bacteria 3621
404 Ga0496114_0002743 3300048917 Bacteria 13466
405 Ga0496114_0045062 3300048917 Bacteria 3662
406 Ga0496114_0221517 3300048917 Bacteria 1661
407 Ga0496114_0511321 3300048917 Bacteria 1062
408 Ga0496115_0021756 3300048918 Bacteria 4958
409 Ga0496115_0109401 3300048918 Bacteria 2269
410 Ga0496116_0000056 3300048919 Bacteria 282554
411 Ga0496117_0000003 3300048920 Bacteria 1881097
412 Ga0496117_0019240 3300048920 Bacteria 5616
413 Ga0496118_0000001 3300048921 Bacteria 1881100
414 Ga0496118_0000364 3300048921 Bacteria 76481
415 Ga0496119_0079465 3300048922 Bacteria 1894
416 Ga0496120_0038237 3300048923 Bacteria 2840
417 Ga0496121_0167358 3300048924 Bacteria 1600
418 Ga0496126_0003748 3300048929 Bacteria 18902
419 Ga0501032_0034453 3300049569 Bacteria 3466
420 Ga0501033_0005672 3300049570 Bacteria 9853
421 Ga0501033_0651786 3300049570 Bacteria 719
422 Ga0501034_0057372 3300049571 Bacteria 3915
423 Ga0501034_1695452 3300049571 Bacteria 504
424 Ga0501036_0029117 3300049572 Bacteria 4668
425 Ga0501037_0000420 3300049573 Bacteria 35141
426 Ga0501038_0077578 3300049574 Bacteria 2804
427 Ga0501039_0017351 3300049575 Bacteria 5521
428 Ga0501043_0006727 3300049579 Bacteria 9177
429 Ga0501047_0274457 3300049581 Bacteria 1532
430 Ga0501068_0223477 3300049584 Bacteria 1197
431 Ga0501070_0017327 3300049586 Bacteria 6048
432 Ga0501073_0063671 3300049589 Bacteria 2572
433 Ga0501080_0274451 3300049742 Bacteria 1534
434 Ga0501035_0163706 3300049822 Bacteria 1925
435 Ga0501044_0093250 3300049823 Bacteria 3036
436 Ga0501044_0248612 3300049823 Bacteria 1720
437 Ga0501044_0731849 3300049823 Bacteria 873
438 nmdc:mga03683_148038_c1 3300050489 Bacteria 1058
439 nmdc:mga03683_48413_c1 3300050489 Bacteria 1766
440 nmdc:mga03n38_14520_c1 3300050490 Bacteria 3021
441 nmdc:mga03n38_1472_c1 3300050490 Bacteria 6777
442 nmdc:mga03n38_20711_c1 3300050490 Bacteria 2636
443 nmdc:mga03n38_45146_c1 3300050490 Bacteria 1939
444 nmdc:mga00v17_204954_c1 3300050491 Bacteria 1275
445 nmdc:mga00v17_309812_c1 3300050491 Bacteria 1025
446 nmdc:mga00v17_46207_c1 3300050491 Bacteria 2634
447 nmdc:mga00v17_59157_c1 3300050491 Bacteria 2350
448 nmdc:mga00v17_64033_c1 3300050491 Bacteria 2265
449 nmdc:mga00v17_67110_c1 3300050491 Bacteria 2216
450 nmdc:mga0yw44_18016_c1 3300050492 Bacteria 3859
451 nmdc:mga0yw44_229575_c1 3300050492 Bacteria 1232
452 nmdc:mga0yw44_6560_c1 3300050492 Bacteria 5634
453 nmdc:mga0yw44_807094_c1 3300050492 Bacteria 637
454 nmdc:mga0yw44_94677_c1 3300050492 Bacteria 1893
455 nmdc:mga0k408_124207_c1 3300050493 Bacteria 539
456 nmdc:mga06z11_2016_c1 3300050494 Bacteria 7697
457 nmdc:mga04h51_36416_c1 3300050495 Bacteria 1583
458 nmdc:mga07m45_349446_c1 3300050496 Bacteria 859
459 nmdc:mga07m45_9577_c1 3300050496 Bacteria 1896
460 nmdc:mga07m45_97116_c1 3300050496 Bacteria 1691
461 nmdc:mga05p37_96086_c1 3300050507 Bacteria 3650
462 nmdc:mga06r32_987274_c1 3300050510 Bacteria 795
463 nmdc:mga0sz30_214278_c1 3300050516 Bacteria 856
464 nmdc:mga0sz30_3055_c1 3300050516 Bacteria 5993
465 nmdc:mga0sz30_91002_c1 3300050516 Bacteria 1327
466 Ga0495619_0132966 3300053085 Bacteria 1710
467 Ga0500643_012879 3300053087 Bacteria 2980
468 Ga0500646_0150675 3300053090 Bacteria 770
469 Ga0500642_0324374 3300053130 Bacteria 690
470 Ga0500658_0196470 3300053134 Bacteria 922
471 Ga0500559_0025273 3300053136 Bacteria 2528
472 Ga0500645_080535 3300053730 Bacteria 929
473 2523387477 2523231044 Bacteria 6434991
474 2738705394 2738541274 Bacteria 6909446
475 2739145519 2738541356 Bacteria 5935017
476 2739334501 2738543028 Bacteria 6917070
477 2776374796 2775506925 Bacteria 7237746
478 2842891447 2842888712 Bacteria 4279094
479 2863070604 2863067949 Bacteria 8541735
480 2902801482 2902799365 Bacteria 5419524
481 2902815404 2902810491 Bacteria 6794147
482 2919716085 2919713450 Bacteria 7431245
483 2939587436 2939582691 Bacteria 7088898
484 2947224392 2947224130 Bacteria 9938529
485 8002777673 8002775197 Bacteria 10728764
486 Ga0451855_0564783
487 JGI24739J22299_10238343
488 JGI24743J22301_10015914
489 JGI24735J21928_10176446
490 JGI24735J21928_10245717
491 JGI24745J21846_1001039
492 JGI24738J21930_10117043
493 JGI24744J21845_10005816
494 JGI24744J21845_10006934
495 JGI24034J26672_10011796
496 JGI24742J22300_10001379
497 Ga0070658_10622247
498 Ga0070690_100061771
499 Ga0070690_100304470
500 Ga0068869_100059474
501 Ga0068869_100196857
502 Ga0070666_10021594
503 Ga0070682_100018103
504 Ga0070682_100112619
505 Ga0068868_100038226
506 Ga0068868_102238350
507 Ga0070660_100204452
508 Ga0070689_100339988
509 Ga0070689_100815934
510 Ga0070691_10048271
511 Ga0070691_10294806
512 Ga0070687_100051064
513 Ga0070692_10039780
514 Ga0070692_10664179
515 Ga0070668_100027152
516 Ga0070668_100149035
517 Ga0070668_100940456
518 Ga0070669_100191738
519 Ga0070671_100049921
520 Ga0070671_100112599
521 Ga0070671_100581688
522 Ga0070671_101232228
523 Ga0070674_100082720
524 Ga0070673_100124899
525 Ga0070673_100640541
526 Ga0070673_101074372
527 Ga0070659_100696981
528 Ga0070667_100050954
529 Ga0070667_100105600
530 Ga0070703_10388355
531 Ga0070709_10291322
532 Ga0070714_100075630
533 Ga0070710_10006509
534 Ga0070701_10001427
535 Ga0070711_100025857
536 Ga0070711_100098842
537 Ga0070705_100043429
538 Ga0070705_100153261
539 Ga0070700_100050442
540 Ga0070700_100503549
541 Ga0070694_100010884
542 Ga0070694_100290414
543 Ga0070663_100013747
544 Ga0070663_100022058
545 Ga0070663_100154624
546 Ga0070663_100787188
547 Ga0070678_100090615
548 Ga0070678_100385627
549 Ga0070678_100434420
550 Ga0070662_100013006
551 Ga0070662_100122808
552 Ga0070681_10770305
553 Ga0068867_100031588
554 Ga0068867_100188495
555 Ga0068867_101177280
556 Ga0070685_10012918
557 Ga0070685_10125369
558 Ga0070685_10148216
559 Ga0070685_10153371
560 Ga0070684_100389970
561 Ga0068853_100006169
562 Ga0068853_100020695
563 Ga0068853_100403475
564 Ga0068853_100655699
565 Ga0070686_100236460
566 Ga0070695_100063171
567 Ga0070696_100704107
568 Ga0070693_100012898
569 Ga0070693_100057614
570 Ga0070693_100210499
571 Ga0070665_100056071
572 Ga0070665_100101370
573 Ga0070665_100763927
574 Ga0070704_100028325
575 Ga0068855_100106019
576 Ga0068855_100506620
577 Ga0068855_100659814
578 Ga0068855_101133863
579 Ga0070664_100376950
580 Ga0068854_100031321
581 Ga0068854_100121244
582 Ga0068854_100168962
583 Ga0068854_101359256
584 Ga0068856_100132254
585 Ga0068856_100356153
586 Ga0070702_100114608
587 Ga0070702_100151771
588 Ga0070702_100183673
589 Ga0068852_100056994
590 Ga0068852_100231137
591 Ga0068859_100071780
592 Ga0068859_100257040
593 Ga0068864_100085711
594 Ga0068866_10013039
595 Ga0068866_10195226
596 Ga0068861_100021924
597 Ga0068861_100067600
598 Ga0068861_100560645
599 Ga0068861_100675096
600 Ga0068851_10039079
601 Ga0068870_10055477
602 Ga0068870_10201488
603 Ga0068870_11415475
604 Ga0068863_101768231
605 Ga0068858_100026283
606 Ga0068858_100056172
607 Ga0068858_100345082
608 Ga0068860_100012267
609 Ga0068862_100027160
610 Ga0068862_100034281
611 Ga0081455_10076489
612 Ga0081455_10084571
613 Ga0081538_10123089
614 Ga0081538_10202311
615 Ga0075365_10004973
616 Ga0075365_10015397
617 Ga0075365_10022977
618 Ga0075368_10022373
619 Ga0075363_100020118
620 Ga0075363_100100047
621 Ga0075363_100103750
622 Ga0075363_100308682
623 Ga0075364_10084793
624 Ga0075364_10137368
625 Ga0075364_10211443
626 Ga0075364_10359180
627 Ga0070715_10004408
628 Ga0070715_10008441
629 Ga0070716_100003670
630 Ga0070716_100011480
631 Ga0070716_100612960
632 Ga0070712_100007172
633 Ga0070712_100036825
634 Ga0075362_10082598
635 Ga0075367_10050545
636 Ga0075369_10016727
637 Ga0075369_10027429
638 Ga0075366_10339128
639 Ga0097621_100108213
640 Ga0075370_10005493
641 Ga0075370_10010294
642 Ga0075370_10084261
643 Ga0075370_10114399
644 Ga0068871_100198670
645 Ga0075428_100313718
646 Ga0075431_100658812
647 Ga0068865_100030432
648 Ga0068865_100554959
649 Ga0068865_100712906
650 Ga0097620_100071780
651 Ga0097620_100257071
652 Ga0105240_11213100
653 Ga0105245_10013134
654 Ga0105245_10093002
655 Ga0105245_10133450
656 Ga0105245_11728992
657 Ga0105247_10009546
658 Ga0105247_10203457
659 Ga0105247_10293576
660 Ga0114129_10255345
661 Ga0114129_11394677
662 Ga0105243_10016292
663 Ga0105241_10042229
664 Ga0105241_10513807
665 Ga0105242_10004961
666 Ga0105242_10179988
667 Ga0105242_10599600
668 Ga0105248_10031898
669 Ga0105248_10970063
670 Ga0105237_10016653
671 Ga0105237_10125799
672 Ga0105237_10208625
673 Ga0105238_10143277
674 Ga0105238_10374080
675 Ga0105238_11284159
676 Ga0105238_12332752
677 Ga0105249_10034759
678 Ga0105239_10083105
679 Ga0105239_10090628
680 Ga0105239_10723753
681 Ga0105246_10100756
682 Ga0157370_10366856
683 Ga0157370_10394269
684 Ga0157369_10209273
685 Ga0157374_10014955
686 Ga0157374_10138903
687 Ga0157378_10046441
688 Ga0163162_10008693
689 Ga0163162_10064950
690 Ga0157372_10046245
691 Ga0157375_10041094
692 Ga0157375_10627263
693 Ga0163163_10260234
694 Ga0163163_10773872
695 Ga0157380_10039386
696 Ga0157380_10224794
697 Ga0157377_10024126
698 Ga0157377_10040056
699 Ga0157379_10747033
700 Ga0157376_10243296
701 Ga0163161_10010367
702 Ga0163161_10115881
703 Ga0163161_10245065
704 Ga0163161_10317157
705 Ga0213876_10004579
706 Ga0213876_10005148
707 Ga0213876_10393888
708 Ga0213875_10087503
709 Ga0209051_1020377
710 Ga0209051_1072585
711 Ga0207656_10018007
712 Ga0207653_10052155
713 Ga0207692_10020863
714 Ga0207642_10177750
715 Ga0207642_10449038
716 Ga0207642_10568277
717 Ga0207710_10001258
718 Ga0207710_10054558
719 Ga0207688_10003173
720 Ga0207680_10116937
721 Ga0207680_10225582
722 Ga0207680_10450010
723 Ga0207647_10059912
724 Ga0207647_10064793
725 Ga0207685_10006287
726 Ga0207671_10089186
727 Ga0207671_10292601
728 Ga0207693_10014537
729 Ga0207693_10014715
730 Ga0207663_10004607
731 Ga0207663_10050292
732 Ga0207660_10723498
733 Ga0207657_10113362
734 Ga0207681_10485039
735 Ga0207694_11235192
736 Ga0207694_11432222
737 Ga0207687_10013192
738 Ga0207687_10018261
739 Ga0207687_10104781
740 Ga0207700_10252149
741 Ga0207700_10578954
742 Ga0207664_10100383
743 Ga0207664_10173104
744 Ga0207690_10154822
745 Ga0207706_10027729
746 Ga0207706_10085553
747 Ga0207686_10053432
748 Ga0207686_10078711
749 Ga0207709_10023220
750 Ga0207670_10013576
751 Ga0207704_10018034
752 Ga0207665_10002811
753 Ga0207665_10012979
754 Ga0207691_10178726
755 Ga0207711_10028716
756 Ga0207711_10093659
757 Ga0207711_10499175
758 Ga0207689_10034650
759 Ga0207689_10053450
760 Ga0207679_10647805
761 Ga0207679_11947947
762 Ga0207667_10184600
763 Ga0207667_10768630
764 Ga0207651_10555436
765 Ga0207651_10586700
766 Ga0207712_10010034
767 Ga0207712_10046450
768 Ga0207712_10271726
769 Ga0207668_10004171
770 Ga0207668_10058561
771 Ga0207668_10326315
772 Ga0207677_10023781
773 Ga0207677_10503533
774 Ga0207677_10772049
775 Ga0207703_10026758
776 Ga0207703_10046548
777 Ga0207703_10154910
778 Ga0207639_10005245
779 Ga0207639_10068561
780 Ga0207639_10612739
781 Ga0207639_11245274
782 Ga0207678_10032308
783 Ga0207678_10032647
784 Ga0207678_10097493
785 Ga0207678_11099326
786 Ga0207708_10029574
787 Ga0207708_10065647
788 Ga0207708_10401040
789 Ga0207702_10166798
790 Ga0207702_10899820
791 Ga0207641_10432399
792 Ga0207648_10025646
793 Ga0207648_10031424
794 Ga0207648_11103929
795 Ga0207676_11332420
796 Ga0207674_10079905
797 Ga0207675_100013138
798 Ga0207675_100088208
799 Ga0207683_10050398
800 Ga0207683_10054416
801 Ga0207683_10182607
802 Ga0207698_10012402
803 Ga0207698_10131083
804 Ga0207698_10497501
805 Ga0209813_10017665
806 Ga0268266_10050605
807 Ga0268266_10431731
808 Ga0268265_10038519
809 Ga0265327_10000118
810 Ga0373949_0033986
811 Ga0373932_0132942
812 Ga0373941_0150254
813 Ga0373957_0034453
814 Ga0373931_0031207
815 Ga0316584_0515668
816 Ga0436364_0825378
817 Ga0436365_0615230
818 Ga0436365_0943767
819 Ga0436365_1469068
820 Ga0436363_1206684
821 Ga0439466_0010586
822 Ga0439465_0070415
823 Ga0451787_758408
824 Ga0451789_0564658
825 Ga0451789_1095215
826 Ga0451793_0354003
827 Ga0451802_0060104
828 Ga0451802_1143654
829 Ga0439445_0054408
830 Ga0439459_0031461
831 Ga0466966_0030639
832 Ga0466963_0287825
833 Ga0466963_0388408
834 Ga0466963_0603340
835 Ga0466963_0701139
836 Ga0466960_0483672
837 Ga0466967_1124440
838 Ga0495603_0022455
839 Ga0495629_0036963
840 Ga0495638_0132423
841 Ga0495641_0022501
842 Ga0495653_0708949
843 Ga0495639_0178517
844 Ga0495662_0063449
845 Ga0495606_0210705
846 Ga0495652_0771840
847 Ga0495665_0040218
848 Ga0495640_0093532
849 Ga0495635_0504933
850 Ga0495588_0109180
851 Ga0495658_0351725
852 Ga0495613_0696597
853 Ga0495649_0083002
854 Ga0495674_0323394
855 Ga0495674_0904688
856 Ga0495676_0063817
857 Ga0495593_0006915
858 Ga0496100_0020308
859 Ga0496100_0092224
860 Ga0496101_0002021
861 Ga0496101_0016267
862 Ga0496102_0000056
863 Ga0496102_0018871
864 Ga0496102_0070169
865 Ga0496102_0118232
866 Ga0496103_0000040
867 Ga0496103_0009238
868 Ga0496103_0211711
869 Ga0496104_0000418
870 Ga0496104_1214956
871 Ga0496105_0170424
872 Ga0496106_0005363
873 Ga0496106_0013765
874 Ga0496106_0073769
875 Ga0496106_0746662
876 Ga0496107_0047440
877 Ga0496107_0048913
878 Ga0496107_0135370
879 Ga0496108_0008227
880 Ga0496108_0566395
881 Ga0496108_0911269
882 Ga0496109_0010373
883 Ga0496109_0668641
884 Ga0496110_0425781
885 Ga0496111_0049090
886 Ga0496111_0111814
887 Ga0496112_0020832
888 Ga0496113_0036082
889 Ga0496114_0002743
890 Ga0496114_0045062
891 Ga0496114_0221517
892 Ga0496114_0511321
893 Ga0496115_0021756
894 Ga0496115_0109401
895 Ga0496116_0000056
896 Ga0496117_0000003
897 Ga0496117_0019240
898 Ga0496118_0000001
899 Ga0496118_0000364
900 Ga0496119_0079465
901 Ga0496120_0038237
902 Ga0496121_0167358
903 Ga0496126_0003748
904 Ga0501032_0034453
905 Ga0501033_0005672
906 Ga0501033_0651786
907 Ga0501034_0057372
908 Ga0501034_1695452
909 Ga0501036_0029117
910 Ga0501037_0000420
911 Ga0501038_0077578
912 Ga0501039_0017351
913 Ga0501043_0006727
914 Ga0501047_0274457
915 Ga0501068_0223477
916 Ga0501070_0017327
917 Ga0501073_0063671
918 Ga0501080_0274451
919 Ga0501035_0163706
920 Ga0501044_0093250
921 Ga0501044_0248612
922 Ga0501044_0731849
923 nmdc:mga03683_148038_c1
924 nmdc:mga03683_48413_c1
925 nmdc:mga03n38_14520_c1
926 nmdc:mga03n38_1472_c1
927 nmdc:mga03n38_20711_c1
928 nmdc:mga03n38_45146_c1
929 nmdc:mga00v17_204954_c1
930 nmdc:mga00v17_309812_c1
931 nmdc:mga00v17_46207_c1
932 nmdc:mga00v17_59157_c1
933 nmdc:mga00v17_64033_c1
934 nmdc:mga00v17_67110_c1
935 nmdc:mga0yw44_18016_c1
936 nmdc:mga0yw44_229575_c1
937 nmdc:mga0yw44_6560_c1
938 nmdc:mga0yw44_807094_c1
939 nmdc:mga0yw44_94677_c1
940 nmdc:mga0k408_124207_c1
941 nmdc:mga06z11_2016_c1
942 nmdc:mga04h51_36416_c1
943 nmdc:mga07m45_349446_c1
944 nmdc:mga07m45_9577_c1
945 nmdc:mga07m45_97116_c1
946 nmdc:mga05p37_96086_c1
947 nmdc:mga06r32_987274_c1
948 nmdc:mga0sz30_214278_c1
949 nmdc:mga0sz30_3055_c1
950 nmdc:mga0sz30_91002_c1
951 Ga0495619_0132966
952 Ga0500643_012879
953 Ga0500646_0150675
954 Ga0500642_0324374
955 Ga0500658_0196470
956 Ga0500559_0025273
957 Ga0500645_080535
958 2523387477
959 2738705394
960 2739145519
961 2739334501
962 2776374796
963 2842891447
964 2863070604
965 2902801482
966 2902815404
967 2919716085
968 2939587436
969 2947224392
970 8002777673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f12-assembly1.cif.gz_A wrba in complex with fmn under crystallization conditions of wrba-fmn-bq structure (4yqe) 0.8546 4 144
2r97-assembly1.cif.gz_C-2 crystal structure of e. coli wrba in complex with fmn 0.8531 4 144
3zho-assembly1.cif.gz_A-2 x-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution 0.8514 4 144
2a5l-assembly1.cif.gz_B the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.8493 2 144
2rg1-assembly1.cif.gz_B-2 crystal structure of e. coli wrba apoprotein 0.8481 3 144
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9994 3 145 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9722 3 145 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8136 4 142 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8066 1 144 3.40.50.360
1e5dB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7953 3 143 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A0Q9KUS7-F1-model_v4 Flavodoxin 0.9951 2 146
AF-A0A3N1HC53-F1-model_v4 Multimeric flavodoxin WrbA 0.9949 2 145 GO:0016491
AF-A0A0M8Y9I0-F1-model_v4 Flavodoxin 0.9935 12 146 GO:0016491
AF-A0A239DSI2-F1-model_v4 NADPH-dependent FMN reductase 0.9903 1 145
AF-A0A2V2QR17-F1-model_v4 deleted 0.9901 2 146

Map