F453125

General Info

Members Datasets Scaffolds Average Seq Length
485 183 970 160

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10200748|Ga0265338_102007482
Length 177
Sequence VSFFFLEATAFAKLFVREPGTDALIRLLQNVEDNRKLISAATPLEVYAAIRRRERSGQIAPEAATAALEMLRVEAGRMVQQPLNPGVLESARQLLDRTSLRWPEALQLGSALTARDMFPSTGITFVASSAALIDAARAEGLEPLDPSNLELSNLASSDLPGDRAATAQEVRAAKESE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.3
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 24.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10200748 3300028800 Bacteria 1504
2 rootH2_10065475 3300003320 Bacteria 10537
3 rootH2_10074522 3300003320 Bacteria 3555
4 rootH1_10091289 3300003323 Unclassified 2810
5 Ga0070658_10018250 3300005327 Bacteria 5615
6 Ga0070683_100000622 3300005329 Bacteria 25523
7 Ga0070683_100004820 3300005329 Bacteria 11171
8 Ga0070683_100220158 3300005329 Unclassified 1804
9 Ga0070683_100320038 3300005329 Bacteria 1476
10 Ga0070670_100049031 3300005331 Bacteria 3633
11 Ga0070670_100075666 3300005331 Unclassified 2892
12 Ga0068869_100000494 3300005334 Bacteria 21941
13 Ga0068869_100007993 3300005334 Bacteria 6794
14 Ga0070666_10030415 3300005335 Bacteria 3557
15 Ga0070666_10046569 3300005335 Bacteria 2909
16 Ga0070680_100049808 3300005336 Unclassified 3415
17 Ga0068868_100000004 3300005338 Bacteria 150718
18 Ga0068868_100000820 3300005338 Bacteria 21081
19 Ga0068868_100068293 3300005338 Bacteria 2830
20 Ga0068868_100539757 3300005338 Bacteria 1026
21 Ga0070660_100002466 3300005339 Bacteria 12681
22 Ga0070660_100883181 3300005339 Unclassified 753
23 Ga0070661_100000803 3300005344 Bacteria 22558
24 Ga0070661_100193733 3300005344 Unclassified 1551
25 Ga0070661_100363043 3300005344 Bacteria 1138
26 Ga0070661_100494858 3300005344 Unclassified 978
27 Ga0070668_100097709 3300005347 Unclassified 2323
28 Ga0070669_100047429 3300005353 Bacteria 3134
29 Ga0070675_100849328 3300005354 Unclassified 835
30 Ga0070671_100007121 3300005355 Bacteria 8941
31 Ga0070673_100114120 3300005364 Bacteria 2244
32 Ga0070688_101217803 3300005365 Unclassified 605
33 Ga0070667_100001102 3300005367 Bacteria 24760
34 Ga0070714_100222117 3300005435 Unclassified 1737
35 Ga0070714_100860153 3300005435 Unclassified 880
36 Ga0070713_100017807 3300005436 Bacteria 5388
37 Ga0070713_100051777 3300005436 Bacteria 3397
38 Ga0070713_100131298 3300005436 Bacteria 2209
39 Ga0070713_100541273 3300005436 Bacteria 1102
40 Ga0070710_10601309 3300005437 Bacteria 765
41 Ga0070711_100066503 3300005439 Bacteria 2525
42 Ga0070711_100680241 3300005439 Unclassified 865
43 Ga0070711_101088153 3300005439 Unclassified 688
44 Ga0070663_100101443 3300005455 Bacteria 2148
45 Ga0070663_100190736 3300005455 Bacteria 1595
46 Ga0070663_100215026 3300005455 Bacteria 1507
47 Ga0070678_100020978 3300005456 Bacteria 4298
48 Ga0070662_100052170 3300005457 Bacteria 2955
49 Ga0070681_10001332 3300005458 Bacteria 21596
50 Ga0070681_10406320 3300005458 Bacteria 1273
51 Ga0070679_100002431 3300005530 Bacteria 16880
52 Ga0070684_100045076 3300005535 Bacteria 3818
53 Ga0070684_100157387 3300005535 Unclassified 2060
54 Ga0070684_100273662 3300005535 Bacteria 1546
55 Ga0070684_100279233 3300005535 Viruses 1530
56 Ga0070684_100436499 3300005535 Bacteria 1209
57 Ga0068853_100000160 3300005539 Bacteria 45847
58 Ga0068853_100015320 3300005539 Bacteria 6300
59 Ga0068853_100021457 3300005539 Bacteria 5386
60 Ga0068853_100045831 3300005539 Bacteria 3747
61 Ga0068853_100375891 3300005539 Unclassified 1326
62 Ga0070672_100009743 3300005543 Bacteria 6634
63 Ga0070665_100006802 3300005548 Bacteria 11625
64 Ga0070665_100068416 3300005548 Bacteria 3560
65 Ga0070665_100291900 3300005548 Unclassified 1633
66 Ga0068855_100001591 3300005563 Bacteria 28512
67 Ga0068855_100075926 3300005563 Bacteria 3901
68 Ga0068855_100112869 3300005563 Bacteria 3118
69 Ga0068855_100144506 3300005563 Bacteria 2709
70 Ga0070664_100279025 3300005564 Bacteria 1507
71 Ga0070664_100312339 3300005564 Bacteria 1423
72 Ga0068857_100000700 3300005577 Bacteria 24940
73 Ga0068857_100043199 3300005577 Bacteria 3998
74 Ga0068857_100081140 3300005577 Unclassified 2896
75 Ga0068857_100083005 3300005577 Unclassified 2863
76 Ga0068857_100190860 3300005577 Unclassified 1866
77 Ga0068857_100978160 3300005577 Unclassified 814
78 Ga0068857_101255501 3300005577 Unclassified 718
79 Ga0068854_100059950 3300005578 Unclassified 2751
80 Ga0068854_100446490 3300005578 Unclassified 1079
81 Ga0068854_100841512 3300005578 Bacteria 803
82 Ga0068856_100000911 3300005614 Bacteria 31594
83 Ga0068856_100008779 3300005614 Bacteria 9831
84 Ga0068856_100059056 3300005614 Bacteria 3788
85 Ga0068856_100156382 3300005614 Bacteria 2290
86 Ga0068856_100170656 3300005614 Bacteria 2187
87 Ga0068856_100209745 3300005614 Bacteria 1963
88 Ga0068856_100304791 3300005614 Bacteria 1611
89 Ga0068856_100733008 3300005614 Unclassified 1008
90 Ga0068856_100744584 3300005614 Unclassified 1000
91 Ga0068856_100964008 3300005614 Unclassified 871
92 Ga0068852_100000128 3300005616 Bacteria 50718
93 Ga0068852_100000198 3300005616 Bacteria 41169
94 Ga0068852_100005977 3300005616 Bacteria 8765
95 Ga0068852_100066341 3300005616 Bacteria 3151
96 Ga0068852_100381299 3300005616 Unclassified 1383
97 Ga0068852_100460259 3300005616 Unclassified 1261
98 Ga0068852_101333860 3300005616 Bacteria 739
99 Ga0068859_100004029 3300005617 Bacteria 14981
100 Ga0068859_100096516 3300005617 Bacteria 3009
101 Ga0068859_100232915 3300005617 Bacteria 1930
102 Ga0068851_10011898 3300005834 Bacteria 4092
103 Ga0068851_10014287 3300005834 Bacteria 3769
104 Ga0068851_10052026 3300005834 Bacteria 2082
105 Ga0068851_10064096 3300005834 Viruses 1888
106 Ga0068851_10212581 3300005834 Bacteria 1084
107 Ga0068851_10238602 3300005834 Bacteria 1027
108 Ga0068863_100003497 3300005841 Bacteria 15501
109 Ga0068863_100090096 3300005841 Bacteria 2908
110 Ga0068858_100002015 3300005842 Bacteria 20768
111 Ga0068860_100000069 3300005843 Bacteria 179064
112 Ga0068862_100120549 3300005844 Bacteria 2311
113 Ga0070717_10000865 3300006028 Bacteria 20036
114 Ga0070717_10460063 3300006028 Unclassified 1147
115 Ga0070717_11118203 3300006028 Unclassified 717
116 Ga0097621_100000563 3300006237 Bacteria 26040
117 Ga0097621_100106845 3300006237 Bacteria 2361
118 Ga0097621_100780984 3300006237 Unclassified 884
119 Ga0068871_100001097 3300006358 Bacteria 18178
120 Ga0068871_100100526 3300006358 Bacteria 2422
121 Ga0068871_100157063 3300006358 Bacteria 1943
122 Ga0068871_101679374 3300006358 Unclassified 602
123 Ga0068865_100016858 3300006881 Bacteria 4686
124 Ga0097620_100004029 3300006931 Bacteria 14981
125 Ga0097620_100096515 3300006931 Bacteria 3009
126 Ga0097620_100232937 3300006931 Bacteria 1930
127 Ga0105240_10000084 3300009093 Bacteria 192787
128 Ga0105240_10000683 3300009093 Bacteria 62430
129 Ga0105240_10005376 3300009093 Bacteria 19100
130 Ga0105240_10008934 3300009093 Bacteria 14247
131 Ga0105240_10016547 3300009093 Bacteria 9982
132 Ga0105240_10105647 3300009093 Bacteria 3418
133 Ga0105240_10112281 3300009093 Bacteria 3295
134 Ga0105240_10220192 3300009093 Bacteria 2212
135 Ga0105240_11343931 3300009093 Bacteria 752
136 Ga0105240_11371366 3300009093 Unclassified 744
137 Ga0105245_10002009 3300009098 Bacteria 18458
138 Ga0105245_10017185 3300009098 Bacteria 6310
139 Ga0105245_10030157 3300009098 Bacteria 4794
140 Ga0105245_10277234 3300009098 Bacteria 1638
141 Ga0105247_10000429 3300009101 Bacteria 35735
142 Ga0105247_10020386 3300009101 Bacteria 3986
143 Ga0105241_10001726 3300009174 Bacteria 16593
144 Ga0105241_10039267 3300009174 Bacteria 3570
145 Ga0105241_10108000 3300009174 Bacteria 2224
146 Ga0105241_10488749 3300009174 Bacteria 1095
147 Ga0105242_10142740 3300009176 Bacteria 2080
148 Ga0105248_10017082 3300009177 Bacteria 7992
149 Ga0105248_10091700 3300009177 Bacteria 3421
150 Ga0105248_10966507 3300009177 Bacteria 962
151 Ga0105248_11234636 3300009177 Unclassified 845
152 Ga0105237_10000600 3300009545 Bacteria 50222
153 Ga0105237_10002410 3300009545 Bacteria 23212
154 Ga0105237_10009808 3300009545 Bacteria 10239
155 Ga0105237_10014754 3300009545 Bacteria 8155
156 Ga0105237_10138133 3300009545 Unclassified 2432
157 Ga0105237_10428211 3300009545 Bacteria 1329
158 Ga0105238_10000160 3300009551 Bacteria 73564
159 Ga0105238_10000333 3300009551 Bacteria 51587
160 Ga0105238_10000669 3300009551 Bacteria 35976
161 Ga0105238_10002832 3300009551 Bacteria 17307
162 Ga0105238_10122397 3300009551 Bacteria 2581
163 Ga0105238_10150519 3300009551 Bacteria 2302
164 Ga0105238_10263929 3300009551 Bacteria 1702
165 Ga0105238_10457655 3300009551 Bacteria 1273
166 Ga0105238_10523085 3300009551 Unclassified 1189
167 Ga0105249_10074008 3300009553 Unclassified 3152
168 Ga0105249_11041546 3300009553 Unclassified 888
169 Ga0105239_10003042 3300010375 Bacteria 20846
170 Ga0105239_10005862 3300010375 Bacteria 14324
171 Ga0105239_10013521 3300010375 Bacteria 9061
172 Ga0105239_10022918 3300010375 Bacteria 6884
173 Ga0105239_10053592 3300010375 Bacteria 4424
174 Ga0105239_10137189 3300010375 Bacteria 2723
175 Ga0105246_10000367 3300011119 Bacteria 24218
176 Ga0157373_10058518 3300013100 Bacteria 2732
177 Ga0157373_10309112 3300013100 Bacteria 1123
178 Ga0157373_10687033 3300013100 Unclassified 749
179 Ga0157371_10020862 3300013102 Unclassified 4819
180 Ga0157370_10010701 3300013104 Bacteria 9652
181 Ga0157370_10370881 3300013104 Unclassified 1319
182 Ga0157369_10001120 3300013105 Bacteria 33505
183 Ga0157369_10005611 3300013105 Bacteria 14574
184 Ga0157369_10025222 3300013105 Bacteria 6600
185 Ga0157369_10069097 3300013105 Bacteria 3795
186 Ga0157369_10076096 3300013105 Bacteria 3598
187 Ga0157369_10104742 3300013105 Unclassified 3012
188 Ga0157369_10120316 3300013105 Bacteria 2787
189 Ga0157369_10215439 3300013105 Unclassified 2011
190 Ga0157369_10493219 3300013105 Unclassified 1267
191 Ga0157374_10003603 3300013296 Bacteria 13038
192 Ga0157374_10008135 3300013296 Bacteria 8964
193 Ga0157374_10025955 3300013296 Bacteria 5267
194 Ga0157374_10032375 3300013296 Unclassified 4760
195 Ga0157374_10133212 3300013296 Unclassified 2407
196 Ga0157374_10696649 3300013296 Bacteria 1029
197 Ga0157378_10000594 3300013297 Bacteria 33911
198 Ga0157378_10025382 3300013297 Bacteria 5219
199 Ga0157378_10026691 3300013297 Archaea 5091
200 Ga0157378_10043653 3300013297 Bacteria 3981
201 Ga0157378_10051527 3300013297 Bacteria 3663
202 Ga0163162_10244609 3300013306 Unclassified 1925
203 Ga0157372_10001342 3300013307 Bacteria 26606
204 Ga0157372_10060364 3300013307 Bacteria 4243
205 Ga0157372_10067799 3300013307 Bacteria 4011
206 Ga0157372_10140532 3300013307 Unclassified 2781
207 Ga0157372_10193273 3300013307 Bacteria 2357
208 Ga0157372_10829398 3300013307 Bacteria 1074
209 Ga0157375_10001739 3300013308 Bacteria 18711
210 Ga0157375_10002593 3300013308 Bacteria 15696
211 Ga0157375_11253782 3300013308 Unclassified 871
212 Ga0163163_10000845 3300014325 Bacteria 26046
213 Ga0163163_10057447 3300014325 Bacteria 3848
214 Ga0157377_10022168 3300014745 Unclassified 3350
215 Ga0157379_10000285 3300014968 Bacteria 40069
216 Ga0157379_10060507 3300014968 Bacteria 3385
217 Ga0157379_10067982 3300014968 Unclassified 3185
218 Ga0157376_10000340 3300014969 Bacteria 31116
219 Ga0157376_10061738 3300014969 Bacteria 3151
220 Ga0157376_10490511 3300014969 Unclassified 1205
221 Ga0157376_10667408 3300014969 Unclassified 1042
222 Ga0157376_10881973 3300014969 Bacteria 912
223 Ga0163161_11189833 3300017792 Unclassified 659
224 Ga0197907_11230329 3300020069 Bacteria 636
225 Ga0206356_10381479 3300020070 Bacteria 630
226 Ga0206352_11017649 3300020078 Bacteria 581
227 Ga0207656_10005463 3300025321 Bacteria 4496
228 Ga0207656_10009126 3300025321 Bacteria 3677
229 Ga0207656_10027573 3300025321 Bacteria 2324
230 Ga0207656_10041897 3300025321 Viruses 1947
231 Ga0207710_10000516 3300025900 Bacteria 23849
232 Ga0207680_10083522 3300025903 Unclassified 2013
233 Ga0207705_10239167 3300025909 Bacteria 1383
234 Ga0207654_10000122 3300025911 Bacteria 50286
235 Ga0207654_10000981 3300025911 Bacteria 15653
236 Ga0207707_10156051 3300025912 Bacteria 1996
237 Ga0207695_10000052 3300025913 Bacteria 398089
238 Ga0207695_10000145 3300025913 Bacteria 209555
239 Ga0207695_10000306 3300025913 Bacteria 119113
240 Ga0207695_10000380 3300025913 Bacteria 100840
241 Ga0207695_10002205 3300025913 Bacteria 29296
242 Ga0207695_10003111 3300025913 Bacteria 23739
243 Ga0207695_10004211 3300025913 Bacteria 19765
244 Ga0207695_10054686 3300025913 Bacteria 4166
245 Ga0207671_10000076 3300025914 Bacteria 151211
246 Ga0207671_10000541 3300025914 Bacteria 51028
247 Ga0207671_10010178 3300025914 Bacteria 7786
248 Ga0207671_10064473 3300025914 Unclassified 2724
249 Ga0207671_10126327 3300025914 Bacteria 1960
250 Ga0207671_10263102 3300025914 Bacteria 1358
251 Ga0207660_10305586 3300025917 Unclassified 1267
252 Ga0207657_10005309 3300025919 Bacteria 13504
253 Ga0207649_10030701 3300025920 Unclassified 3186
254 Ga0207649_10136445 3300025920 Unclassified 1673
255 Ga0207649_10203818 3300025920 Unclassified 1399
256 Ga0207649_10483125 3300025920 Bacteria 940
257 Ga0207649_10784474 3300025920 Unclassified 743
258 Ga0207652_10061909 3300025921 Unclassified 3233
259 Ga0207652_10332374 3300025921 Unclassified 1372
260 Ga0207694_10000029 3300025924 Bacteria 239107
261 Ga0207694_10000141 3300025924 Bacteria 74190
262 Ga0207694_10012262 3300025924 Bacteria 6459
263 Ga0207694_10089673 3300025924 Bacteria 2425
264 Ga0207694_10337571 3300025924 Bacteria 1246
265 Ga0207694_10905066 3300025924 Bacteria 746
266 Ga0207650_10011142 3300025925 Bacteria 6184
267 Ga0207650_10076009 3300025925 Bacteria 2536
268 Ga0207687_10001340 3300025927 Bacteria 16844
269 Ga0207687_10017510 3300025927 Bacteria 4718
270 Ga0207687_10092130 3300025927 Bacteria 2212
271 Ga0207700_10012714 3300025928 Bacteria 5440
272 Ga0207700_10082799 3300025928 Bacteria 2510
273 Ga0207700_10195975 3300025928 Bacteria 1700
274 Ga0207700_10348053 3300025928 Unclassified 1290
275 Ga0207664_10515266 3300025929 Bacteria 1072
276 Ga0207664_10643824 3300025929 Unclassified 952
277 Ga0207644_10004651 3300025931 Bacteria 8919
278 Ga0207644_10028846 3300025931 Bacteria 3846
279 Ga0207644_10220616 3300025931 Bacteria 1503
280 Ga0207706_10006107 3300025933 Bacteria 11185
281 Ga0207691_10006913 3300025940 Bacteria 10941
282 Ga0207711_10019543 3300025941 Bacteria 5639
283 Ga0207711_11304595 3300025941 Unclassified 668
284 Ga0207689_10001059 3300025942 Bacteria 26471
285 Ga0207689_10094461 3300025942 Bacteria 2456
286 Ga0207661_10000489 3300025944 Bacteria 25486
287 Ga0207661_10005464 3300025944 Bacteria 8961
288 Ga0207661_10197726 3300025944 Unclassified 1766
289 Ga0207661_10626686 3300025944 Bacteria 988
290 Ga0207661_10765800 3300025944 Bacteria 889
291 Ga0207667_10003917 3300025949 Bacteria 18319
292 Ga0207667_10007242 3300025949 Bacteria 13383
293 Ga0207667_10041071 3300025949 Unclassified 4921
294 Ga0207667_10456260 3300025949 Bacteria 1298
295 Ga0207667_10762003 3300025949 Bacteria 967
296 Ga0207667_10911486 3300025949 Unclassified 870
297 Ga0207651_10334495 3300025960 Bacteria 1270
298 Ga0207712_10381748 3300025961 Unclassified 1179
299 Ga0207712_10813328 3300025961 Unclassified 822
300 Ga0207668_10136551 3300025972 Unclassified 1880
301 Ga0207640_10028320 3300025981 Bacteria 3425
302 Ga0207640_10441118 3300025981 Unclassified 1070
303 Ga0207658_10000542 3300025986 Bacteria 34178
304 Ga0207658_11376213 3300025986 Unclassified 645
305 Ga0207677_10000023 3300026023 Bacteria 128514
306 Ga0207677_10010452 3300026023 Bacteria 5252
307 Ga0207677_10460001 3300026023 Unclassified 1092
308 Ga0207703_10004334 3300026035 Bacteria 11660
309 Ga0207639_10000050 3300026041 Bacteria 121432
310 Ga0207639_10009590 3300026041 Bacteria 6685
311 Ga0207639_10049299 3300026041 Bacteria 3193
312 Ga0207639_10054008 3300026041 Bacteria 3068
313 Ga0207639_10385673 3300026041 Unclassified 1259
314 Ga0207639_10519393 3300026041 Bacteria 1090
315 Ga0207678_10129813 3300026067 Bacteria 2149
316 Ga0207678_10307754 3300026067 Bacteria 1362
317 Ga0207678_10538797 3300026067 Unclassified 1020
318 Ga0207702_10000643 3300026078 Bacteria 38203
319 Ga0207702_10004751 3300026078 Bacteria 11993
320 Ga0207702_10029811 3300026078 Unclassified 4542
321 Ga0207702_10036536 3300026078 Bacteria 4109
322 Ga0207702_10202118 3300026078 Bacteria 1842
323 Ga0207702_10266447 3300026078 Unclassified 1615
324 Ga0207702_10699900 3300026078 Bacteria 998
325 Ga0207702_10903674 3300026078 Unclassified 875
326 Ga0207641_10003647 3300026088 Bacteria 13579
327 Ga0207641_11425378 3300026088 Unclassified 694
328 Ga0207676_10001284 3300026095 Bacteria 18676
329 Ga0207674_10001505 3300026116 Bacteria 30063
330 Ga0207674_10002586 3300026116 Bacteria 22784
331 Ga0207674_10048268 3300026116 Bacteria 4358
332 Ga0207674_10262668 3300026116 Unclassified 1674
333 Ga0207674_11739375 3300026116 Unclassified 591
334 Ga0207683_10001899 3300026121 Bacteria 18488
335 Ga0207698_10000034 3300026142 Bacteria 108528
336 Ga0207698_10000743 3300026142 Bacteria 18908
337 Ga0207698_10068059 3300026142 Bacteria 2810
338 Ga0207698_10082569 3300026142 Unclassified 2598
339 Ga0207698_10256732 3300026142 Unclassified 1603
340 Ga0207698_10261498 3300026142 Unclassified 1590
341 Ga0268266_10060170 3300028379 Bacteria 3274
342 Ga0268266_10205262 3300028379 Bacteria 1805
343 Ga0268266_10472885 3300028379 Unclassified 1194
344 Ga0268265_10100462 3300028380 Bacteria 2335
345 Ga0268264_10000086 3300028381 Bacteria 239021
346 Ga0265318_10084299 3300028577 Unclassified 1172
347 Ga0265318_10148553 3300028577 Bacteria 860
348 Ga0265336_10002325 3300028666 Bacteria 7925
349 Ga0265336_10002564 3300028666 Bacteria 7433
350 Ga0265338_10001762 3300028800 Bacteria 34208
351 Ga0265338_10007604 3300028800 Bacteria 13383
352 Ga0265338_10015414 3300028800 Bacteria 8398
353 Ga0265338_10050113 3300028800 Bacteria 3778
354 Ga0265338_10106952 3300028800 Unclassified 2263
355 Ga0265338_10213193 3300028800 Bacteria 1448
356 Ga0265338_10429466 3300028800 Bacteria 938
357 Ga0265338_10622845 3300028800 Bacteria 750
358 Ga0265338_10791934 3300028800 Bacteria 650
359 Ga0265324_10057449 3300029957 Unclassified 1332
360 Ga0265770_1009026 3300030878 Bacteria 1431
361 Ga0265770_1036335 3300030878 Unclassified 846
362 Ga0265760_10077576 3300031090 Bacteria 1025
363 Ga0265330_10000081 3300031235 Bacteria 80150
364 Ga0265330_10002764 3300031235 Bacteria 9429
365 Ga0265330_10027097 3300031235 Bacteria 2589
366 Ga0265330_10075708 3300031235 Unclassified 1453
367 Ga0265332_10021164 3300031238 Bacteria 2874
368 Ga0265332_10164597 3300031238 Bacteria 926
369 Ga0265328_10000875 3300031239 Bacteria 13924
370 Ga0265328_10011486 3300031239 Bacteria 3537
371 Ga0265328_10042287 3300031239 Bacteria 1677
372 Ga0265328_10102195 3300031239 Bacteria 1062
373 Ga0265320_10186675 3300031240 Bacteria 928
374 Ga0265325_10000107 3300031241 Bacteria 58325
375 Ga0265325_10000217 3300031241 Bacteria 40450
376 Ga0265325_10011856 3300031241 Bacteria 4999
377 Ga0265325_10021095 3300031241 Unclassified 3584
378 Ga0265325_10021698 3300031241 Bacteria 3523
379 Ga0265325_10064642 3300031241 Bacteria 1849
380 Ga0265325_10087188 3300031241 Unclassified 1543
381 Ga0265325_10251534 3300031241 Bacteria 800
382 Ga0265329_10213169 3300031242 Bacteria 638
383 Ga0265340_10000452 3300031247 Bacteria 22181
384 Ga0265340_10008669 3300031247 Bacteria 5483
385 Ga0265340_10038549 3300031247 Unclassified 2363
386 Ga0265340_10052114 3300031247 Bacteria 1980
387 Ga0265340_10187548 3300031247 Bacteria 933
388 Ga0265340_10213948 3300031247 Bacteria 865
389 Ga0265340_10333258 3300031247 Unclassified 671
390 Ga0265339_10000076 3300031249 Bacteria 85094
391 Ga0265339_10001972 3300031249 Bacteria 15087
392 Ga0265339_10003674 3300031249 Bacteria 10709
393 Ga0265339_10004247 3300031249 Bacteria 9809
394 Ga0265339_10006334 3300031249 Bacteria 7779
395 Ga0265339_10011295 3300031249 Bacteria 5508
396 Ga0265339_10060601 3300031249 Bacteria 2039
397 Ga0265339_10082343 3300031249 Bacteria 1699
398 Ga0265339_10225802 3300031249 Unclassified 914
399 Ga0265327_10199617 3300031251 Bacteria 906
400 Ga0265316_10000390 3300031344 Bacteria 50094
401 Ga0265316_10000933 3300031344 Bacteria 31802
402 Ga0265316_10002225 3300031344 Bacteria 20351
403 Ga0265316_10013607 3300031344 Bacteria 7219
404 Ga0265316_10019635 3300031344 Bacteria 5772
405 Ga0265316_10026842 3300031344 Bacteria 4781
406 Ga0265316_10032766 3300031344 Bacteria 4239
407 Ga0265316_10132708 3300031344 Bacteria 1875
408 Ga0265316_10166502 3300031344 Bacteria 1646
409 Ga0265316_10182251 3300031344 Bacteria 1563
410 Ga0265316_10266878 3300031344 Bacteria 1253
411 Ga0265316_10467141 3300031344 Unclassified 904
412 Ga0265313_10000769 3300031595 Bacteria 32597
413 Ga0265313_10011855 3300031595 Bacteria 5385
414 Ga0265313_10065208 3300031595 Bacteria 1691
415 Ga0265314_10000052 3300031711 Bacteria 187634
416 Ga0265314_10006183 3300031711 Bacteria 10634
417 Ga0265314_10031690 3300031711 Bacteria 3898
418 Ga0265314_10085550 3300031711 Bacteria 2067
419 Ga0265314_10088776 3300031711 Bacteria 2018
420 Ga0265314_10156072 3300031711 Bacteria 1394
421 Ga0265314_10293908 3300031711 Unclassified 914
422 Ga0265342_10000771 3300031712 Bacteria 32633
423 Ga0265342_10001875 3300031712 Bacteria 18973
424 Ga0265342_10028423 3300031712 Unclassified 3483
425 Ga0265342_10029560 3300031712 Bacteria 3402
426 Ga0265342_10033618 3300031712 Bacteria 3151
427 Ga0265342_10083458 3300031712 Bacteria 1841
428 Ga0265342_10118770 3300031712 Unclassified 1490
429 Ga0265342_10280698 3300031712 Bacteria 881
430 Ga0265342_10491467 3300031712 Unclassified 627
431 Ga0265342_10550436 3300031712 Unclassified 585
432 Ga0373923_0342606 3300035111 Bacteria 713
433 Ga0373953_0058462 3300035117 Bacteria 1572
434 Ga0373954_0355001 3300035118 Bacteria 724
435 Ga0373957_0077726 3300035120 Bacteria 1306
436 Ga0373924_0341306 3300035410 Bacteria 667
437 Ga0373937_0775143 3300036401 Bacteria 907
438 Ga0395900_0601664 3300037418 Bacteria 1040
439 Ga0453683_0328469 3300044673 Bacteria 981
440 Ga0466961_0065316 3300044693 Bacteria 2312
441 Ga0466961_0107439 3300044693 Bacteria 1757
442 Ga0466958_0682850 3300045836 Unclassified 669
443 Ga0495629_0054733 3300046459 Bacteria 2791
444 Ga0495580_0145126 3300046472 Bacteria 1645
445 Ga0495582_0661880 3300046473 Bacteria 604
446 Ga0495639_0648753 3300046475 Unclassified 544
447 Ga0495618_0230277 3300046514 Bacteria 1167
448 Ga0495652_0610782 3300046529 Bacteria 743
449 Ga0495652_0625071 3300046529 Unclassified 732
450 Ga0495665_0077655 3300046531 Bacteria 1747
451 Ga0495587_0096101 3300046536 Bacteria 1709
452 Ga0495645_0002315 3300046543 Bacteria 12924
453 Ga0495645_0449242 3300046543 Bacteria 813
454 Ga0495645_0640384 3300046543 Bacteria 650
455 Ga0495635_0032623 3300046663 Bacteria 3613
456 Ga0495657_0351772 3300046675 Unclassified 872
457 Ga0495623_0095455 3300046679 Bacteria 1818
458 Ga0495658_0695349 3300046683 Unclassified 651
459 Ga0495613_0351233 3300046689 Unclassified 1013
460 Ga0495600_0089174 3300046809 Bacteria 2012
461 Ga0495604_0705909 3300047317 Unclassified 640
462 Ga0495674_0085662 3300047319 Bacteria 2699
463 Ga0495684_0087459 3300047471 Bacteria 2362
464 Ga0495602_0087588 3300048088 Bacteria 2595
465 Ga0496100_0280626 3300048903 Unclassified 1242
466 Ga0496100_0451435 3300048903 Bacteria 985
467 Ga0496101_0114421 3300048904 Bacteria 2034
468 Ga0496102_0300196 3300048905 Unclassified 1514
469 Ga0496104_0297689 3300048907 Unclassified 1526
470 Ga0496104_0312770 3300048907 Unclassified 1483
471 Ga0496105_0016341 3300048908 Bacteria 5924
472 Ga0496106_0343629 3300048909 Bacteria 1198
473 Ga0496107_0734038 3300048910 Unclassified 725
474 Ga0496110_0675795 3300048913 Bacteria 933
475 Ga0496111_0500298 3300048914 Bacteria 895
476 Ga0496112_0272218 3300048915 Bacteria 1641
477 Ga0496114_0032579 3300048917 Bacteria 4290
478 Ga0496114_0211596 3300048917 Bacteria 1701
479 Ga0496115_0045295 3300048918 Bacteria 3511
480 Ga0496115_0118392 3300048918 Bacteria 2178
481 Ga0495601_0029751 3300053077 Unclassified 3390
482 Ga0495595_0176296 3300053084 Bacteria 1059
483 Ga0495619_0606135 3300053085 Bacteria 749
484 Ga0587070_025988 3300059491 Viruses 1026
485 Ga0587128_006709 3300059630 Viruses 1428
486 Ga0265338_10200748
487 rootH2_10065475
488 rootH2_10074522
489 rootH1_10091289
490 Ga0070658_10018250
491 Ga0070683_100000622
492 Ga0070683_100004820
493 Ga0070683_100220158
494 Ga0070683_100320038
495 Ga0070670_100049031
496 Ga0070670_100075666
497 Ga0068869_100000494
498 Ga0068869_100007993
499 Ga0070666_10030415
500 Ga0070666_10046569
501 Ga0070680_100049808
502 Ga0068868_100000004
503 Ga0068868_100000820
504 Ga0068868_100068293
505 Ga0068868_100539757
506 Ga0070660_100002466
507 Ga0070660_100883181
508 Ga0070661_100000803
509 Ga0070661_100193733
510 Ga0070661_100363043
511 Ga0070661_100494858
512 Ga0070668_100097709
513 Ga0070669_100047429
514 Ga0070675_100849328
515 Ga0070671_100007121
516 Ga0070673_100114120
517 Ga0070688_101217803
518 Ga0070667_100001102
519 Ga0070714_100222117
520 Ga0070714_100860153
521 Ga0070713_100017807
522 Ga0070713_100051777
523 Ga0070713_100131298
524 Ga0070713_100541273
525 Ga0070710_10601309
526 Ga0070711_100066503
527 Ga0070711_100680241
528 Ga0070711_101088153
529 Ga0070663_100101443
530 Ga0070663_100190736
531 Ga0070663_100215026
532 Ga0070678_100020978
533 Ga0070662_100052170
534 Ga0070681_10001332
535 Ga0070681_10406320
536 Ga0070679_100002431
537 Ga0070684_100045076
538 Ga0070684_100157387
539 Ga0070684_100273662
540 Ga0070684_100279233
541 Ga0070684_100436499
542 Ga0068853_100000160
543 Ga0068853_100015320
544 Ga0068853_100021457
545 Ga0068853_100045831
546 Ga0068853_100375891
547 Ga0070672_100009743
548 Ga0070665_100006802
549 Ga0070665_100068416
550 Ga0070665_100291900
551 Ga0068855_100001591
552 Ga0068855_100075926
553 Ga0068855_100112869
554 Ga0068855_100144506
555 Ga0070664_100279025
556 Ga0070664_100312339
557 Ga0068857_100000700
558 Ga0068857_100043199
559 Ga0068857_100081140
560 Ga0068857_100083005
561 Ga0068857_100190860
562 Ga0068857_100978160
563 Ga0068857_101255501
564 Ga0068854_100059950
565 Ga0068854_100446490
566 Ga0068854_100841512
567 Ga0068856_100000911
568 Ga0068856_100008779
569 Ga0068856_100059056
570 Ga0068856_100156382
571 Ga0068856_100170656
572 Ga0068856_100209745
573 Ga0068856_100304791
574 Ga0068856_100733008
575 Ga0068856_100744584
576 Ga0068856_100964008
577 Ga0068852_100000128
578 Ga0068852_100000198
579 Ga0068852_100005977
580 Ga0068852_100066341
581 Ga0068852_100381299
582 Ga0068852_100460259
583 Ga0068852_101333860
584 Ga0068859_100004029
585 Ga0068859_100096516
586 Ga0068859_100232915
587 Ga0068851_10011898
588 Ga0068851_10014287
589 Ga0068851_10052026
590 Ga0068851_10064096
591 Ga0068851_10212581
592 Ga0068851_10238602
593 Ga0068863_100003497
594 Ga0068863_100090096
595 Ga0068858_100002015
596 Ga0068860_100000069
597 Ga0068862_100120549
598 Ga0070717_10000865
599 Ga0070717_10460063
600 Ga0070717_11118203
601 Ga0097621_100000563
602 Ga0097621_100106845
603 Ga0097621_100780984
604 Ga0068871_100001097
605 Ga0068871_100100526
606 Ga0068871_100157063
607 Ga0068871_101679374
608 Ga0068865_100016858
609 Ga0097620_100004029
610 Ga0097620_100096515
611 Ga0097620_100232937
612 Ga0105240_10000084
613 Ga0105240_10000683
614 Ga0105240_10005376
615 Ga0105240_10008934
616 Ga0105240_10016547
617 Ga0105240_10105647
618 Ga0105240_10112281
619 Ga0105240_10220192
620 Ga0105240_11343931
621 Ga0105240_11371366
622 Ga0105245_10002009
623 Ga0105245_10017185
624 Ga0105245_10030157
625 Ga0105245_10277234
626 Ga0105247_10000429
627 Ga0105247_10020386
628 Ga0105241_10001726
629 Ga0105241_10039267
630 Ga0105241_10108000
631 Ga0105241_10488749
632 Ga0105242_10142740
633 Ga0105248_10017082
634 Ga0105248_10091700
635 Ga0105248_10966507
636 Ga0105248_11234636
637 Ga0105237_10000600
638 Ga0105237_10002410
639 Ga0105237_10009808
640 Ga0105237_10014754
641 Ga0105237_10138133
642 Ga0105237_10428211
643 Ga0105238_10000160
644 Ga0105238_10000333
645 Ga0105238_10000669
646 Ga0105238_10002832
647 Ga0105238_10122397
648 Ga0105238_10150519
649 Ga0105238_10263929
650 Ga0105238_10457655
651 Ga0105238_10523085
652 Ga0105249_10074008
653 Ga0105249_11041546
654 Ga0105239_10003042
655 Ga0105239_10005862
656 Ga0105239_10013521
657 Ga0105239_10022918
658 Ga0105239_10053592
659 Ga0105239_10137189
660 Ga0105246_10000367
661 Ga0157373_10058518
662 Ga0157373_10309112
663 Ga0157373_10687033
664 Ga0157371_10020862
665 Ga0157370_10010701
666 Ga0157370_10370881
667 Ga0157369_10001120
668 Ga0157369_10005611
669 Ga0157369_10025222
670 Ga0157369_10069097
671 Ga0157369_10076096
672 Ga0157369_10104742
673 Ga0157369_10120316
674 Ga0157369_10215439
675 Ga0157369_10493219
676 Ga0157374_10003603
677 Ga0157374_10008135
678 Ga0157374_10025955
679 Ga0157374_10032375
680 Ga0157374_10133212
681 Ga0157374_10696649
682 Ga0157378_10000594
683 Ga0157378_10025382
684 Ga0157378_10026691
685 Ga0157378_10043653
686 Ga0157378_10051527
687 Ga0163162_10244609
688 Ga0157372_10001342
689 Ga0157372_10060364
690 Ga0157372_10067799
691 Ga0157372_10140532
692 Ga0157372_10193273
693 Ga0157372_10829398
694 Ga0157375_10001739
695 Ga0157375_10002593
696 Ga0157375_11253782
697 Ga0163163_10000845
698 Ga0163163_10057447
699 Ga0157377_10022168
700 Ga0157379_10000285
701 Ga0157379_10060507
702 Ga0157379_10067982
703 Ga0157376_10000340
704 Ga0157376_10061738
705 Ga0157376_10490511
706 Ga0157376_10667408
707 Ga0157376_10881973
708 Ga0163161_11189833
709 Ga0197907_11230329
710 Ga0206356_10381479
711 Ga0206352_11017649
712 Ga0207656_10005463
713 Ga0207656_10009126
714 Ga0207656_10027573
715 Ga0207656_10041897
716 Ga0207710_10000516
717 Ga0207680_10083522
718 Ga0207705_10239167
719 Ga0207654_10000122
720 Ga0207654_10000981
721 Ga0207707_10156051
722 Ga0207695_10000052
723 Ga0207695_10000145
724 Ga0207695_10000306
725 Ga0207695_10000380
726 Ga0207695_10002205
727 Ga0207695_10003111
728 Ga0207695_10004211
729 Ga0207695_10054686
730 Ga0207671_10000076
731 Ga0207671_10000541
732 Ga0207671_10010178
733 Ga0207671_10064473
734 Ga0207671_10126327
735 Ga0207671_10263102
736 Ga0207660_10305586
737 Ga0207657_10005309
738 Ga0207649_10030701
739 Ga0207649_10136445
740 Ga0207649_10203818
741 Ga0207649_10483125
742 Ga0207649_10784474
743 Ga0207652_10061909
744 Ga0207652_10332374
745 Ga0207694_10000029
746 Ga0207694_10000141
747 Ga0207694_10012262
748 Ga0207694_10089673
749 Ga0207694_10337571
750 Ga0207694_10905066
751 Ga0207650_10011142
752 Ga0207650_10076009
753 Ga0207687_10001340
754 Ga0207687_10017510
755 Ga0207687_10092130
756 Ga0207700_10012714
757 Ga0207700_10082799
758 Ga0207700_10195975
759 Ga0207700_10348053
760 Ga0207664_10515266
761 Ga0207664_10643824
762 Ga0207644_10004651
763 Ga0207644_10028846
764 Ga0207644_10220616
765 Ga0207706_10006107
766 Ga0207691_10006913
767 Ga0207711_10019543
768 Ga0207711_11304595
769 Ga0207689_10001059
770 Ga0207689_10094461
771 Ga0207661_10000489
772 Ga0207661_10005464
773 Ga0207661_10197726
774 Ga0207661_10626686
775 Ga0207661_10765800
776 Ga0207667_10003917
777 Ga0207667_10007242
778 Ga0207667_10041071
779 Ga0207667_10456260
780 Ga0207667_10762003
781 Ga0207667_10911486
782 Ga0207651_10334495
783 Ga0207712_10381748
784 Ga0207712_10813328
785 Ga0207668_10136551
786 Ga0207640_10028320
787 Ga0207640_10441118
788 Ga0207658_10000542
789 Ga0207658_11376213
790 Ga0207677_10000023
791 Ga0207677_10010452
792 Ga0207677_10460001
793 Ga0207703_10004334
794 Ga0207639_10000050
795 Ga0207639_10009590
796 Ga0207639_10049299
797 Ga0207639_10054008
798 Ga0207639_10385673
799 Ga0207639_10519393
800 Ga0207678_10129813
801 Ga0207678_10307754
802 Ga0207678_10538797
803 Ga0207702_10000643
804 Ga0207702_10004751
805 Ga0207702_10029811
806 Ga0207702_10036536
807 Ga0207702_10202118
808 Ga0207702_10266447
809 Ga0207702_10699900
810 Ga0207702_10903674
811 Ga0207641_10003647
812 Ga0207641_11425378
813 Ga0207676_10001284
814 Ga0207674_10001505
815 Ga0207674_10002586
816 Ga0207674_10048268
817 Ga0207674_10262668
818 Ga0207674_11739375
819 Ga0207683_10001899
820 Ga0207698_10000034
821 Ga0207698_10000743
822 Ga0207698_10068059
823 Ga0207698_10082569
824 Ga0207698_10256732
825 Ga0207698_10261498
826 Ga0268266_10060170
827 Ga0268266_10205262
828 Ga0268266_10472885
829 Ga0268265_10100462
830 Ga0268264_10000086
831 Ga0265318_10084299
832 Ga0265318_10148553
833 Ga0265336_10002325
834 Ga0265336_10002564
835 Ga0265338_10001762
836 Ga0265338_10007604
837 Ga0265338_10015414
838 Ga0265338_10050113
839 Ga0265338_10106952
840 Ga0265338_10213193
841 Ga0265338_10429466
842 Ga0265338_10622845
843 Ga0265338_10791934
844 Ga0265324_10057449
845 Ga0265770_1009026
846 Ga0265770_1036335
847 Ga0265760_10077576
848 Ga0265330_10000081
849 Ga0265330_10002764
850 Ga0265330_10027097
851 Ga0265330_10075708
852 Ga0265332_10021164
853 Ga0265332_10164597
854 Ga0265328_10000875
855 Ga0265328_10011486
856 Ga0265328_10042287
857 Ga0265328_10102195
858 Ga0265320_10186675
859 Ga0265325_10000107
860 Ga0265325_10000217
861 Ga0265325_10011856
862 Ga0265325_10021095
863 Ga0265325_10021698
864 Ga0265325_10064642
865 Ga0265325_10087188
866 Ga0265325_10251534
867 Ga0265329_10213169
868 Ga0265340_10000452
869 Ga0265340_10008669
870 Ga0265340_10038549
871 Ga0265340_10052114
872 Ga0265340_10187548
873 Ga0265340_10213948
874 Ga0265340_10333258
875 Ga0265339_10000076
876 Ga0265339_10001972
877 Ga0265339_10003674
878 Ga0265339_10004247
879 Ga0265339_10006334
880 Ga0265339_10011295
881 Ga0265339_10060601
882 Ga0265339_10082343
883 Ga0265339_10225802
884 Ga0265327_10199617
885 Ga0265316_10000390
886 Ga0265316_10000933
887 Ga0265316_10002225
888 Ga0265316_10013607
889 Ga0265316_10019635
890 Ga0265316_10026842
891 Ga0265316_10032766
892 Ga0265316_10132708
893 Ga0265316_10166502
894 Ga0265316_10182251
895 Ga0265316_10266878
896 Ga0265316_10467141
897 Ga0265313_10000769
898 Ga0265313_10011855
899 Ga0265313_10065208
900 Ga0265314_10000052
901 Ga0265314_10006183
902 Ga0265314_10031690
903 Ga0265314_10085550
904 Ga0265314_10088776
905 Ga0265314_10156072
906 Ga0265314_10293908
907 Ga0265342_10000771
908 Ga0265342_10001875
909 Ga0265342_10028423
910 Ga0265342_10029560
911 Ga0265342_10033618
912 Ga0265342_10083458
913 Ga0265342_10118770
914 Ga0265342_10280698
915 Ga0265342_10491467
916 Ga0265342_10550436
917 Ga0373923_0342606
918 Ga0373953_0058462
919 Ga0373954_0355001
920 Ga0373957_0077726
921 Ga0373924_0341306
922 Ga0373937_0775143
923 Ga0395900_0601664
924 Ga0453683_0328469
925 Ga0466961_0065316
926 Ga0466961_0107439
927 Ga0466958_0682850
928 Ga0495629_0054733
929 Ga0495580_0145126
930 Ga0495582_0661880
931 Ga0495639_0648753
932 Ga0495618_0230277
933 Ga0495652_0610782
934 Ga0495652_0625071
935 Ga0495665_0077655
936 Ga0495587_0096101
937 Ga0495645_0002315
938 Ga0495645_0449242
939 Ga0495645_0640384
940 Ga0495635_0032623
941 Ga0495657_0351772
942 Ga0495623_0095455
943 Ga0495658_0695349
944 Ga0495613_0351233
945 Ga0495600_0089174
946 Ga0495604_0705909
947 Ga0495674_0085662
948 Ga0495684_0087459
949 Ga0495602_0087588
950 Ga0496100_0280626
951 Ga0496100_0451435
952 Ga0496101_0114421
953 Ga0496102_0300196
954 Ga0496104_0297689
955 Ga0496104_0312770
956 Ga0496105_0016341
957 Ga0496106_0343629
958 Ga0496107_0734038
959 Ga0496110_0675795
960 Ga0496111_0500298
961 Ga0496112_0272218
962 Ga0496114_0032579
963 Ga0496114_0211596
964 Ga0496115_0045295
965 Ga0496115_0118392
966 Ga0495601_0029751
967 Ga0495595_0176296
968 Ga0495619_0606135
969 Ga0587070_025988
970 Ga0587128_006709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map