F453083

General Info

Members Datasets Scaffolds Average Seq Length
485 188 485 262

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001108|Ga0105240_1000110824
Length 315
Sequence VSEGEGGGGGWSSEFNKGYAKIPHYRVAARVVFQPSVRRKPERRSRALSRRVAMKLPIRLFLMSLVVAGSANAAMVAKNLDYDVGGKKMQSVLVYDDAAKTPRPGLVMTPDWLGINADNIALAKQIAGKDYVVLVADVYGADVRPKNPDEAGAATKNMYAHRGDLRARIGAALDQLKAQGGKAPLDGKHWGAFGFCFGGATTLELARGAGEVAGVVSFHGNLASDPALKDNIKAKVLVLHGADDKFESPEQIAGFQQEMRDAGADWQFLSYGGAVHCFAIPTADGKVPGCKYDERTAKRAFAQMHQFFGEIFEAK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 2.06
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10055376 3300005327 Bacteria 3222
2 Ga0070658_10147278 3300005327 Bacteria 1969
3 Ga0070683_100155257 3300005329 Bacteria 2170
4 Ga0070690_100103371 3300005330 Bacteria 1892
5 Ga0070670_100228942 3300005331 Bacteria 1617
6 Ga0070670_100270805 3300005331 Bacteria 1482
7 Ga0070670_100522372 3300005331 Bacteria 1057
8 Ga0068869_100029264 3300005334 Bacteria 3858
9 Ga0070666_10000350 3300005335 Bacteria 28941
10 Ga0070666_10004180 3300005335 Bacteria 8765
11 Ga0070666_10010272 3300005335 Bacteria 5852
12 Ga0070666_10030930 3300005335 Bacteria 3531
13 Ga0070666_10040713 3300005335 Bacteria 3102
14 Ga0070666_10232308 3300005335 Bacteria 1303
15 Ga0070680_100070734 3300005336 Bacteria 2866
16 Ga0070680_100272889 3300005336 Bacteria 1432
17 Ga0068868_100027431 3300005338 Bacteria 4346
18 Ga0068868_100106401 3300005338 Bacteria 2275
19 Ga0070689_100162476 3300005340 Bacteria 1806
20 Ga0070661_100049777 3300005344 Bacteria 3067
21 Ga0070661_100051539 3300005344 Bacteria 3012
22 Ga0070661_100145344 3300005344 Bacteria 1790
23 Ga0070661_100216186 3300005344 Bacteria 1469
24 Ga0070661_100398244 3300005344 Bacteria 1088
25 Ga0070669_100012211 3300005353 Bacteria 6096
26 Ga0070675_100026753 3300005354 Bacteria 4629
27 Ga0070671_100031998 3300005355 Bacteria 4349
28 Ga0070674_100216187 3300005356 Bacteria 1489
29 Ga0070673_100021166 3300005364 Bacteria 4708
30 Ga0070673_100049802 3300005364 Bacteria 3272
31 Ga0070673_100432451 3300005364 Bacteria 1181
32 Ga0070659_100120149 3300005366 Bacteria 2127
33 Ga0070667_100013185 3300005367 Bacteria 6832
34 Ga0070667_100020046 3300005367 Bacteria 5552
35 Ga0070667_100035954 3300005367 Bacteria 4150
36 Ga0070667_100130138 3300005367 Bacteria 2196
37 Ga0070667_100133516 3300005367 Bacteria 2168
38 Ga0070667_100244330 3300005367 Bacteria 1604
39 Ga0070667_100289896 3300005367 Bacteria 1471
40 Ga0070667_100302831 3300005367 Unclassified 1439
41 Ga0070663_100000029 3300005455 Bacteria 82128
42 Ga0070663_100005153 3300005455 Bacteria 7738
43 Ga0070663_100054907 3300005455 Bacteria 2849
44 Ga0070663_100175004 3300005455 Bacteria 1661
45 Ga0070678_100052598 3300005456 Bacteria 2958
46 Ga0070678_100059527 3300005456 Bacteria 2808
47 Ga0070662_100004053 3300005457 Bacteria 9200
48 Ga0070662_100329555 3300005457 Unclassified 1247
49 Ga0070681_10243516 3300005458 Bacteria 1712
50 Ga0068867_100019447 3300005459 Bacteria 4838
51 Ga0070685_10008593 3300005466 Bacteria 5255
52 Ga0070685_10143348 3300005466 Bacteria 1507
53 Ga0070684_100156920 3300005535 Bacteria 2064
54 Ga0070684_100792660 3300005535 Bacteria 885
55 Ga0068853_100002537 3300005539 Bacteria 13707
56 Ga0068853_100033907 3300005539 Bacteria 4332
57 Ga0068853_100055188 3300005539 Bacteria 3424
58 Ga0068853_100063363 3300005539 Bacteria 3202
59 Ga0068853_100084095 3300005539 Bacteria 2788
60 Ga0068853_100102414 3300005539 Bacteria 2533
61 Ga0068853_100120728 3300005539 Bacteria 2338
62 Ga0070686_100043252 3300005544 Bacteria 2826
63 Ga0070693_100261801 3300005547 Bacteria 1151
64 Ga0070665_100000026 3300005548 Bacteria 365176
65 Ga0070665_100006914 3300005548 Bacteria 11528
66 Ga0070665_100010402 3300005548 Bacteria 9415
67 Ga0070665_100014732 3300005548 Bacteria 7845
68 Ga0070665_100023347 3300005548 Bacteria 6225
69 Ga0070665_100089521 3300005548 Bacteria 3083
70 Ga0070665_100117982 3300005548 Bacteria 2656
71 Ga0070665_100213401 3300005548 Bacteria 1931
72 Ga0070665_100500887 3300005548 Bacteria 1226
73 Ga0068855_100019339 3300005563 Bacteria 8183
74 Ga0068855_100087470 3300005563 Bacteria 3601
75 Ga0068855_100360917 3300005563 Bacteria 1598
76 Ga0068855_101080304 3300005563 Unclassified 840
77 Ga0070664_100067718 3300005564 Bacteria 3051
78 Ga0070664_100106960 3300005564 Bacteria 2438
79 Ga0070664_100631607 3300005564 Bacteria 995
80 Ga0068857_100084549 3300005577 Bacteria 2835
81 Ga0068857_100109360 3300005577 Bacteria 2484
82 Ga0068854_100012520 3300005578 Bacteria 5559
83 Ga0068856_100030997 3300005614 Bacteria 5230
84 Ga0068856_100156288 3300005614 Bacteria 2291
85 Ga0068852_100007256 3300005616 Bacteria 8083
86 Ga0068852_100058623 3300005616 Bacteria 3336
87 Ga0068852_100165405 3300005616 Bacteria 2069
88 Ga0068852_100209396 3300005616 Unclassified 1849
89 Ga0068852_100539988 3300005616 Unclassified 1165
90 Ga0068859_100001840 3300005617 Bacteria 21596
91 Ga0068859_100035642 3300005617 Bacteria 4993
92 Ga0068859_100091736 3300005617 Bacteria 3089
93 Ga0068859_100111193 3300005617 Bacteria 2802
94 Ga0068859_100313080 3300005617 Bacteria 1663
95 Ga0068859_100404674 3300005617 Bacteria 1461
96 Ga0068864_100007613 3300005618 Bacteria 8917
97 Ga0068864_100060869 3300005618 Bacteria 3269
98 Ga0068864_100521401 3300005618 Bacteria 1146
99 Ga0068861_100016689 3300005719 Bacteria 5201
100 Ga0068851_10000257 3300005834 Bacteria 25204
101 Ga0068863_100003420 3300005841 Bacteria 15650
102 Ga0068863_100015047 3300005841 Bacteria 7434
103 Ga0068863_100032202 3300005841 Bacteria 4997
104 Ga0068863_100054825 3300005841 Bacteria 3776
105 Ga0068863_100166170 3300005841 Bacteria 2116
106 Ga0068863_100398505 3300005841 Bacteria 1346
107 Ga0068863_100610877 3300005841 Bacteria 1080
108 Ga0068858_100089538 3300005842 Bacteria 2863
109 Ga0068860_100025094 3300005843 Bacteria 5753
110 Ga0068860_100060657 3300005843 Bacteria 3594
111 Ga0068860_100115366 3300005843 Bacteria 2569
112 Ga0068860_100207545 3300005843 Bacteria 1900
113 Ga0068862_100000185 3300005844 Bacteria 68550
114 Ga0081455_10090524 3300005937 Bacteria 2480
115 Ga0081540_1013631 3300005983 Bacteria 5272
116 Ga0070717_10463329 3300006028 Unclassified 1143
117 Ga0070712_100387365 3300006175 Bacteria 1152
118 Ga0097621_100105352 3300006237 Bacteria 2377
119 Ga0097621_100116278 3300006237 Unclassified 2265
120 Ga0097621_100138095 3300006237 Bacteria 2081
121 Ga0097621_100226603 3300006237 Bacteria 1631
122 Ga0068871_100036203 3300006358 Bacteria 3928
123 Ga0068871_100040939 3300006358 Bacteria 3713
124 Ga0068871_100073237 3300006358 Bacteria 2823
125 Ga0068871_100087030 3300006358 Bacteria 2597
126 Ga0068865_100001855 3300006881 Bacteria 12406
127 Ga0068865_100006246 3300006881 Bacteria 7254
128 Ga0068865_100018474 3300006881 Bacteria 4499
129 Ga0068865_100037794 3300006881 Bacteria 3262
130 Ga0068865_100078000 3300006881 Bacteria 2369
131 Ga0097620_100001840 3300006931 Bacteria 21596
132 Ga0097620_100035641 3300006931 Bacteria 4993
133 Ga0097620_100091732 3300006931 Bacteria 3089
134 Ga0097620_100111199 3300006931 Bacteria 2802
135 Ga0097620_100313097 3300006931 Bacteria 1663
136 Ga0097620_100404662 3300006931 Bacteria 1461
137 Ga0105240_10001108 3300009093 Bacteria 47413
138 Ga0105240_10029279 3300009093 Bacteria 7179
139 Ga0105240_10066951 3300009093 Bacteria 4454
140 Ga0105240_10414510 3300009093 Bacteria 1515
141 Ga0105245_10191777 3300009098 Bacteria 1958
142 Ga0105245_10295514 3300009098 Bacteria 1588
143 Ga0105247_10078331 3300009101 Bacteria 2079
144 Ga0105241_10022873 3300009174 Bacteria 4634
145 Ga0105241_10050290 3300009174 Bacteria 3176
146 Ga0105241_10148384 3300009174 Bacteria 1916
147 Ga0105241_10758279 3300009174 Bacteria 890
148 Ga0105242_10011540 3300009176 Bacteria 6795
149 Ga0105242_10137652 3300009176 Bacteria 2115
150 Ga0105248_10000246 3300009177 Bacteria 62735
151 Ga0105248_10218952 3300009177 Bacteria 2144
152 Ga0105237_10000231 3300009545 Bacteria 79368
153 Ga0105237_10008060 3300009545 Bacteria 11456
154 Ga0105237_10054191 3300009545 Bacteria 4018
155 Ga0105237_10066189 3300009545 Bacteria 3609
156 Ga0105237_10247667 3300009545 Unclassified 1784
157 Ga0105237_10470162 3300009545 Bacteria 1263
158 Ga0105238_10002517 3300009551 Bacteria 18331
159 Ga0105238_10010512 3300009551 Bacteria 9291
160 Ga0105238_10011232 3300009551 Bacteria 9011
161 Ga0105238_10021215 3300009551 Bacteria 6620
162 Ga0105238_10062903 3300009551 Bacteria 3711
163 Ga0105238_10173779 3300009551 Bacteria 2131
164 Ga0105238_10312464 3300009551 Bacteria 1556
165 Ga0105249_10001225 3300009553 Bacteria 22566
166 Ga0105249_10003063 3300009553 Bacteria 14440
167 Ga0105249_10062410 3300009553 Bacteria 3422
168 Ga0105249_10169495 3300009553 Bacteria 2116
169 Ga0105239_10006133 3300010375 Bacteria 13987
170 Ga0105239_10007220 3300010375 Bacteria 12763
171 Ga0105239_10069261 3300010375 Bacteria 3877
172 Ga0105239_10095752 3300010375 Bacteria 3279
173 Ga0105239_10145809 3300010375 Bacteria 2640
174 Ga0105239_10192060 3300010375 Unclassified 2285
175 Ga0105246_10010675 3300011119 Bacteria 5689
176 Ga0157373_10134699 3300013100 Unclassified 1737
177 Ga0157370_10240645 3300013104 Bacteria 1674
178 Ga0157369_10000001 3300013105 Bacteria 554908
179 Ga0157369_10011883 3300013105 Bacteria 9890
180 Ga0157369_10331284 3300013105 Unclassified 1582
181 Ga0157374_10050922 3300013296 Bacteria 3852
182 Ga0157374_10084600 3300013296 Bacteria 3015
183 Ga0157374_10143304 3300013296 Bacteria 2320
184 Ga0157378_10088515 3300013297 Bacteria 2810
185 Ga0157378_10092472 3300013297 Unclassified 2752
186 Ga0163162_10000021 3300013306 Bacteria 214873
187 Ga0163162_10006211 3300013306 Bacteria 11575
188 Ga0163162_10029580 3300013306 Bacteria 5421
189 Ga0163162_10614302 3300013306 Unclassified 1213
190 Ga0157372_10001728 3300013307 Bacteria 23694
191 Ga0157372_10011884 3300013307 Bacteria 9277
192 Ga0157372_10033755 3300013307 Bacteria 5623
193 Ga0157372_10104863 3300013307 Bacteria 3233
194 Ga0157372_10138755 3300013307 Bacteria 2800
195 Ga0157375_10001711 3300013308 Bacteria 18837
196 Ga0157375_10101345 3300013308 Bacteria 2962
197 Ga0163163_10001486 3300014325 Bacteria 19850
198 Ga0163163_10004834 3300014325 Bacteria 11573
199 Ga0163163_10492291 3300014325 Bacteria 1288
200 Ga0157379_10003069 3300014968 Bacteria 14127
201 Ga0157379_10034516 3300014968 Bacteria 4510
202 Ga0157379_10127347 3300014968 Bacteria 2292
203 Ga0157379_10249583 3300014968 Bacteria 1611
204 Ga0157376_10011316 3300014969 Bacteria 6572
205 Ga0157376_10029837 3300014969 Bacteria 4347
206 Ga0157376_10065030 3300014969 Bacteria 3078
207 Ga0157376_10075155 3300014969 Bacteria 2883
208 Ga0157376_10209990 3300014969 Bacteria 1797
209 Ga0157376_10350206 3300014969 Bacteria 1413
210 Ga0209233_1002755 3300025261 Bacteria 6323
211 Ga0207697_10034652 3300025315 Bacteria 2066
212 Ga0207656_10000343 3300025321 Bacteria 15834
213 Ga0207656_10015685 3300025321 Bacteria 2937
214 Ga0207656_10046243 3300025321 Bacteria 1866
215 Ga0207680_10000092 3300025903 Bacteria 41687
216 Ga0207680_10005480 3300025903 Bacteria 6065
217 Ga0207680_10081471 3300025903 Bacteria 2035
218 Ga0207647_10002348 3300025904 Bacteria 14385
219 Ga0207645_10004975 3300025907 Bacteria 9742
220 Ga0207705_10043041 3300025909 Bacteria 3243
221 Ga0207654_10029181 3300025911 Bacteria 3016
222 Ga0207654_10055336 3300025911 Bacteria 2296
223 Ga0207707_10298575 3300025912 Bacteria 1393
224 Ga0207695_10000032 3300025913 Bacteria 521283
225 Ga0207695_10000256 3300025913 Bacteria 135850
226 Ga0207695_10071391 3300025913 Bacteria 3546
227 Ga0207695_10088961 3300025913 Bacteria 3107
228 Ga0207695_10148675 3300025913 Bacteria 2284
229 Ga0207671_10004399 3300025914 Bacteria 13503
230 Ga0207671_10051190 3300025914 Bacteria 3060
231 Ga0207671_10061903 3300025914 Unclassified 2778
232 Ga0207671_10169072 3300025914 Bacteria 1697
233 Ga0207671_10257638 3300025914 Bacteria 1372
234 Ga0207671_10445363 3300025914 Bacteria 1031
235 Ga0207663_10101082 3300025916 Bacteria 1937
236 Ga0207663_10133130 3300025916 Bacteria 1721
237 Ga0207649_10001915 3300025920 Bacteria 11887
238 Ga0207649_10031448 3300025920 Bacteria 3155
239 Ga0207649_10170402 3300025920 Bacteria 1516
240 Ga0207694_10000926 3300025924 Bacteria 25987
241 Ga0207694_10001219 3300025924 Bacteria 22303
242 Ga0207694_10001900 3300025924 Bacteria 17304
243 Ga0207694_10013702 3300025924 Bacteria 6110
244 Ga0207694_10046534 3300025924 Bacteria 3353
245 Ga0207694_10084565 3300025924 Bacteria 2496
246 Ga0207650_10237735 3300025925 Bacteria 1471
247 Ga0207659_10041806 3300025926 Bacteria 3211
248 Ga0207706_10004125 3300025933 Bacteria 13708
249 Ga0207706_10304113 3300025933 Bacteria 1389
250 Ga0207686_10052765 3300025934 Bacteria 2539
251 Ga0207704_10008111 3300025938 Bacteria 5000
252 Ga0207704_10024249 3300025938 Bacteria 3286
253 Ga0207704_10028670 3300025938 Bacteria 3092
254 Ga0207704_10053131 3300025938 Bacteria 2461
255 Ga0207691_10032229 3300025940 Bacteria 4887
256 Ga0207691_10089244 3300025940 Bacteria 2765
257 Ga0207711_10002283 3300025941 Bacteria 17214
258 Ga0207711_10054511 3300025941 Bacteria 3431
259 Ga0207689_10028174 3300025942 Bacteria 4698
260 Ga0207689_10045113 3300025942 Bacteria 3646
261 Ga0207689_10059186 3300025942 Bacteria 3151
262 Ga0207689_10588044 3300025942 Bacteria 936
263 Ga0207679_10095716 3300025945 Bacteria 2309
264 Ga0207679_10664819 3300025945 Bacteria 943
265 Ga0207667_10012246 3300025949 Bacteria 9905
266 Ga0207667_10079892 3300025949 Bacteria 3389
267 Ga0207667_10217811 3300025949 Bacteria 1956
268 Ga0207667_10329783 3300025949 Bacteria 1558
269 Ga0207712_10000189 3300025961 Bacteria 63193
270 Ga0207712_10016011 3300025961 Bacteria 4847
271 Ga0207712_10023327 3300025961 Bacteria 4082
272 Ga0207712_10050533 3300025961 Bacteria 2903
273 Ga0207712_10186858 3300025961 Unclassified 1632
274 Ga0207668_10004626 3300025972 Bacteria 8092
275 Ga0207668_10029954 3300025972 Bacteria 3572
276 Ga0207668_10099587 3300025972 Bacteria 2157
277 Ga0207668_10120103 3300025972 Bacteria 1989
278 Ga0207640_10018023 3300025981 Bacteria 4143
279 Ga0207640_10365503 3300025981 Bacteria 1164
280 Ga0207658_10000013 3300025986 Bacteria 220396
281 Ga0207658_10020312 3300025986 Bacteria 4599
282 Ga0207658_10138888 3300025986 Bacteria 1963
283 Ga0207677_10114115 3300026023 Bacteria 2018
284 Ga0207677_10235524 3300026023 Bacteria 1478
285 Ga0207677_10409442 3300026023 Bacteria 1152
286 Ga0207703_10070886 3300026035 Bacteria 2877
287 Ga0207639_10000240 3300026041 Bacteria 41113
288 Ga0207639_10004037 3300026041 Bacteria 9906
289 Ga0207639_10005312 3300026041 Bacteria 8698
290 Ga0207639_10029851 3300026041 Bacteria 3996
291 Ga0207639_10046036 3300026041 Bacteria 3289
292 Ga0207639_10074828 3300026041 Bacteria 2661
293 Ga0207639_10440508 3300026041 Bacteria 1181
294 Ga0207639_10645109 3300026041 Bacteria 979
295 Ga0207678_10000035 3300026067 Bacteria 104807
296 Ga0207678_10024086 3300026067 Bacteria 5319
297 Ga0207678_10033873 3300026067 Bacteria 4449
298 Ga0207678_10058337 3300026067 Bacteria 3321
299 Ga0207702_10026249 3300026078 Bacteria 4834
300 Ga0207702_10206904 3300026078 Bacteria 1822
301 Ga0207702_10275370 3300026078 Bacteria 1589
302 Ga0207641_10028141 3300026088 Bacteria 4642
303 Ga0207641_10056047 3300026088 Bacteria 3348
304 Ga0207641_10060774 3300026088 Bacteria 3221
305 Ga0207641_10191419 3300026088 Bacteria 1880
306 Ga0207648_10057420 3300026089 Bacteria 3396
307 Ga0207648_10097407 3300026089 Bacteria 2574
308 Ga0207676_10004232 3300026095 Bacteria 10136
309 Ga0207676_10060746 3300026095 Bacteria 2991
310 Ga0207676_10267635 3300026095 Unclassified 1546
311 Ga0207674_10001361 3300026116 Bacteria 31639
312 Ga0207674_10104996 3300026116 Bacteria 2803
313 Ga0207675_100039837 3300026118 Bacteria 4384
314 Ga0207683_10026726 3300026121 Bacteria 4985
315 Ga0207683_10029550 3300026121 Bacteria 4745
316 Ga0207683_10047621 3300026121 Bacteria 3754
317 Ga0207683_10127298 3300026121 Bacteria 2289
318 Ga0207698_10010163 3300026142 Bacteria 6031
319 Ga0207698_10025694 3300026142 Bacteria 4154
320 Ga0207698_10045485 3300026142 Bacteria 3308
321 Ga0268266_10000001 3300028379 Bacteria 4040580
322 Ga0268266_10000013 3300028379 Bacteria 649715
323 Ga0268266_10007656 3300028379 Bacteria 9712
324 Ga0268266_10077773 3300028379 Bacteria 2885
325 Ga0268266_10693524 3300028379 Bacteria 981
326 Ga0268265_10001042 3300028380 Bacteria 24942
327 Ga0268264_10009673 3300028381 Bacteria 7986
328 Ga0268264_10016619 3300028381 Bacteria 6025
329 Ga0268264_10135281 3300028381 Bacteria 2190
330 Ga0268264_10601653 3300028381 Bacteria 1083
331 Ga0307509_10118446 3300031507 Bacteria 2632
332 Ga0265313_10069956 3300031595 Bacteria 1619
333 Ga0307516_10019150 3300031730 Bacteria 7095
334 Ga0307516_10068531 3300031730 Bacteria 3416
335 Ga0373944_0002903 3300035089 Bacteria 4397
336 Ga0373923_0049174 3300035111 Bacteria 1763
337 Ga0373935_0061618 3300035692 Bacteria 2402
338 Ga0373937_0041464 3300036401 Bacteria 4198
339 Ga0451791_1508417 3300041451 Bacteria 1471
340 Ga0451793_0903364 3300041452 Bacteria 3147
341 Ga0451802_0737098 3300041460 Bacteria 1989
342 Ga0451804_0231991 3300041463 Bacteria 2534
343 Ga0451807_2221165 3300041486 Bacteria 2509
344 Ga0451851_0669231 3300041507 Bacteria 1063
345 Ga0451853_0205579 3300041512 Bacteria 2983
346 Ga0466972_0006856 3300044658 Bacteria 5716
347 Ga0466970_0003424 3300044765 Bacteria 7720
348 Ga0451576_0635429 3300045051 Bacteria 1122
349 Ga0466967_0754887 3300045976 Unclassified 965
350 Ga0495629_0264529 3300046459 Bacteria 1182
351 Ga0495582_0013180 3300046473 Bacteria 4549
352 Ga0495639_0002019 3300046475 Bacteria 8981
353 Ga0495586_0043419 3300046535 Bacteria 2422
354 Ga0495587_0359460 3300046536 Bacteria 811
355 Ga0495657_0068507 3300046675 Bacteria 2325
356 Ga0495581_0064269 3300047315 Bacteria 2120
357 Ga0495684_0079909 3300047471 Bacteria 2483
358 Ga0495686_0003123 3300047472 Bacteria 14636
359 Ga0496101_0233336 3300048904 Bacteria 1431
360 Ga0496102_0295454 3300048905 Bacteria 1527
361 Ga0496104_0000012 3300048907 Bacteria 438011
362 Ga0496105_0000011 3300048908 Bacteria 302186
363 Ga0496115_0137912 3300048918 Bacteria 2012
364 Ga0496117_0072554 3300048920 Bacteria 2300
365 Ga0496117_0136452 3300048920 Bacteria 1477
366 Ga0496117_0307559 3300048920 Bacteria 836
367 Ga0496118_0000356 3300048921 Bacteria 77474
368 Ga0496118_0012629 3300048921 Bacteria 8081
369 Ga0496121_0042942 3300048924 Bacteria 3923
370 Ga0496122_0000062 3300048925 Bacteria 241387
371 Ga0496123_0004387 3300048926 Bacteria 14875
372 Ga0496126_0334182 3300048929 Bacteria 1243
373 Ga0501031_0003044 3300049568 Bacteria 10718
374 Ga0501031_0006995 3300049568 Bacteria 7362
375 Ga0501031_0200686 3300049568 Bacteria 1301
376 Ga0501032_0000770 3300049569 Bacteria 25975
377 Ga0501032_0004115 3300049569 Bacteria 11019
378 Ga0501032_0037713 3300049569 Bacteria 3295
379 Ga0501032_0043374 3300049569 Bacteria 3047
380 Ga0501032_0053299 3300049569 Bacteria 2724
381 Ga0501033_0000634 3300049570 Bacteria 32447
382 Ga0501033_0107078 3300049570 Bacteria 2036
383 Ga0501034_0001449 3300049571 Bacteria 31438
384 Ga0501034_0012545 3300049571 Bacteria 8748
385 Ga0501034_0022631 3300049571 Bacteria 6402
386 Ga0501034_0405679 3300049571 Bacteria 1285
387 Ga0501036_0010967 3300049572 Bacteria 7493
388 Ga0501036_0052249 3300049572 Bacteria 3461
389 Ga0501036_0149893 3300049572 Bacteria 1967
390 Ga0501037_0002152 3300049573 Bacteria 14263
391 Ga0501037_0063889 3300049573 Bacteria 2683
392 Ga0501038_0007689 3300049574 Bacteria 9937
393 Ga0501038_0141910 3300049574 Bacteria 1964
394 Ga0501039_0025605 3300049575 Bacteria 4534
395 Ga0501039_0026347 3300049575 Bacteria 4467
396 Ga0501042_0186240 3300049578 Bacteria 1497
397 Ga0501043_0010157 3300049579 Bacteria 7379
398 Ga0501043_0017476 3300049579 Bacteria 5622
399 Ga0501043_0032194 3300049579 Bacteria 4121
400 Ga0501043_0041406 3300049579 Bacteria 3619
401 Ga0501043_0257395 3300049579 Bacteria 1343
402 Ga0501046_0003892 3300049580 Bacteria 13652
403 Ga0501046_0004386 3300049580 Bacteria 12826
404 Ga0501046_0006043 3300049580 Bacteria 10768
405 Ga0501046_0010702 3300049580 Bacteria 7869
406 Ga0501046_0110092 3300049580 Bacteria 2105
407 Ga0501047_0000250 3300049581 Bacteria 63699
408 Ga0501047_0002878 3300049581 Bacteria 16325
409 Ga0501047_0017238 3300049581 Bacteria 6914
410 Ga0501047_0033493 3300049581 Bacteria 4959
411 Ga0501047_0039356 3300049581 Bacteria 4574
412 Ga0501047_0110249 3300049581 Bacteria 2635
413 Ga0501047_0312048 3300049581 Bacteria 1413
414 Ga0501047_0404307 3300049581 Bacteria 1198
415 Ga0501048_0024152 3300049582 Bacteria 4437
416 Ga0501048_0032677 3300049582 Bacteria 3761
417 Ga0501048_0091969 3300049582 Bacteria 2139
418 Ga0501067_0000659 3300049583 Bacteria 18522
419 Ga0501067_0008758 3300049583 Bacteria 5605
420 Ga0501067_0227735 3300049583 Bacteria 1038
421 Ga0501068_0024565 3300049584 Bacteria 3540
422 Ga0501068_0044203 3300049584 Bacteria 2682
423 Ga0501069_0000156 3300049585 Bacteria 30035
424 Ga0501069_0005272 3300049585 Bacteria 6716
425 Ga0501069_0076598 3300049585 Bacteria 1881
426 Ga0501070_0022613 3300049586 Bacteria 5264
427 Ga0501070_0026522 3300049586 Bacteria 4860
428 Ga0501070_0043513 3300049586 Bacteria 3736
429 Ga0501070_0092526 3300049586 Bacteria 2502
430 Ga0501070_0099763 3300049586 Bacteria 2402
431 Ga0501070_0250960 3300049586 Bacteria 1447
432 Ga0501071_0018579 3300049587 Bacteria 4816
433 Ga0501071_0319436 3300049587 Bacteria 1179
434 Ga0501072_0033160 3300049588 Bacteria 4046
435 Ga0501073_0013036 3300049589 Bacteria 6062
436 Ga0501073_0047353 3300049589 Bacteria 3022
437 Ga0501073_0052804 3300049589 Bacteria 2845
438 Ga0501073_0060721 3300049589 Bacteria 2638
439 Ga0501073_0111391 3300049589 Bacteria 1898
440 Ga0501073_0145754 3300049589 Bacteria 1641
441 Ga0501074_0008498 3300049590 Bacteria 7440
442 Ga0501074_0013651 3300049590 Bacteria 5904
443 Ga0501074_0048284 3300049590 Bacteria 3075
444 Ga0501074_0051069 3300049590 Unclassified 2984
445 Ga0501074_0051608 3300049590 Bacteria 2968
446 Ga0501074_0056382 3300049590 Bacteria 2831
447 Ga0501079_0073754 3300049741 Bacteria 2638
448 Ga0501079_0092873 3300049741 Bacteria 2338
449 Ga0501079_0130367 3300049741 Bacteria 1956
450 Ga0501079_0311509 3300049741 Bacteria 1232
451 Ga0501080_0000306 3300049742 Bacteria 37439
452 Ga0501080_0000320 3300049742 Bacteria 36678
453 Ga0501080_0004331 3300049742 Bacteria 12602
454 Ga0501080_0016268 3300049742 Bacteria 6868
455 Ga0501080_0060745 3300049742 Bacteria 3518
456 Ga0501080_0161159 3300049742 Bacteria 2071
457 Ga0501080_0258360 3300049742 Bacteria 1587
458 Ga0501081_0081570 3300049743 Bacteria 2265
459 Ga0501083_0003228 3300049744 Bacteria 11370
460 Ga0501083_0027898 3300049744 Bacteria 3893
461 Ga0501083_0097391 3300049744 Bacteria 1941
462 Ga0501083_0140153 3300049744 Bacteria 1584
463 Ga0501035_0007087 3300049822 Bacteria 10481
464 Ga0501035_0032049 3300049822 Bacteria 4784
465 Ga0501035_0057411 3300049822 Bacteria 3470
466 Ga0501035_0122672 3300049822 Bacteria 2270
467 Ga0501044_0009241 3300049823 Bacteria 10765
468 Ga0501044_0034783 3300049823 Bacteria 5281
469 Ga0501044_0036920 3300049823 Bacteria 5109
470 Ga0501044_0183059 3300049823 Bacteria 2061
471 Ga0501044_0187056 3300049823 Bacteria 2035
472 Ga0501044_0391209 3300049823 Bacteria 1304
473 Ga0501045_0008982 3300049824 Bacteria 6980
474 Ga0501045_0505480 3300049824 Bacteria 897
475 Ga0500610_0005485 3300053079 Bacteria 5204
476 Ga0500651_0034143 3300053093 Bacteria 3207
477 Ga0500597_000019 3300053120 Bacteria 34589
478 Ga0500568_0001625 3300053139 Bacteria 14171
479 Ga0501084_0036048 3300054114 Bacteria 4133
480 Ga0501084_0050991 3300054114 Bacteria 3463
481 Ga0501084_0161105 3300054114 Unclassified 1893
482 Ga0501082_0000394 3300060353 Bacteria 38764
483 Ga0501082_0015773 3300060353 Bacteria 6498
484 Ga0501082_0147684 3300060353 Unclassified 2041
485 Ga0530510_0264118 3300061734 Bacteria 1284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10169495 Ga0105249_101694952 231
2 3300013308 Ga0157375_10101345 Ga0157375_101013452 231
3 3300014969 Ga0157376_10075155 Ga0157376_100751552 231
4 3300013296 Ga0157374_10084600 Ga0157374_100846004 233
5 3300013306 Ga0163162_10029580 Ga0163162_100295804 233
6 3300014969 Ga0157376_10209990 Ga0157376_102099902 233
7 3300046536 Ga0495587_0359460 Ga0495587_0359460_12_797 234
8 3300005330 Ga0070690_100103371 Ga0070690_1001033713 235
9 3300005335 Ga0070666_10232308 Ga0070666_102323082 235
10 3300005356 Ga0070674_100216187 Ga0070674_1002161872 235
11 3300005457 Ga0070662_100329555 Ga0070662_1003295551 235
12 3300005466 Ga0070685_10143348 Ga0070685_101433481 235
13 3300005539 Ga0068853_100120728 Ga0068853_1001207283 235
14 3300005563 Ga0068855_100360917 Ga0068855_1003609172 235
15 3300005617 Ga0068859_100313080 Ga0068859_1003130802 235
16 3300005618 Ga0068864_100521401 Ga0068864_1005214011 235
17 3300005841 Ga0068863_100610877 Ga0068863_1006108771 235
18 3300006881 Ga0068865_100078000 Ga0068865_1000780002 235
19 3300006931 Ga0097620_100313097 Ga0097620_1003130972 235
20 3300025938 Ga0207704_10024249 Ga0207704_100242492 235
21 3300025949 Ga0207667_10079892 Ga0207667_100798924 235
22 3300025961 Ga0207712_10186858 Ga0207712_101868582 235
23 3300026041 Ga0207639_10074828 Ga0207639_100748283 235
24 3300026088 Ga0207641_10191419 Ga0207641_101914192 235
25 3300026089 Ga0207648_10097407 Ga0207648_100974073 235
26 3300026095 Ga0207676_10267635 Ga0207676_102676352 235
27 3300026121 Ga0207683_10047621 Ga0207683_100476211 237
28 3300013307 Ga0157372_10104863 Ga0157372_101048634 238
29 3300045051 Ga0451576_0635429 Ga0451576_0635429_236_1018 238
30 3300046675 Ga0495657_0068507 Ga0495657_0068507_1152_1946 238
31 3300005539 Ga0068853_100084095 Ga0068853_1000840954 242
32 3300026041 Ga0207639_10046036 Ga0207639_100460363 242
33 3300026078 Ga0207702_10275370 Ga0207702_102753702 242
34 3300049743 Ga0501081_0081570 Ga0501081_0081570_167_895 242
35 3300054114 Ga0501084_0036048 Ga0501084_0036048_380_1108 242
36 3300009177 Ga0105248_10218952 Ga0105248_102189523 248
37 3300013306 Ga0163162_10006211 Ga0163162_100062118 248
38 3300014968 Ga0157379_10034516 Ga0157379_100345165 248
39 3300025911 Ga0207654_10055336 Ga0207654_100553363 249
40 3300005335 Ga0070666_10030930 Ga0070666_100309303 252
41 3300005544 Ga0070686_100043252 Ga0070686_1000432524 252
42 3300005841 Ga0068863_100054825 Ga0068863_1000548251 252
43 3300006881 Ga0068865_100037794 Ga0068865_1000377944 252
44 3300025903 Ga0207680_10081471 Ga0207680_100814712 252
45 3300046459 Ga0495629_0264529 Ga0495629_0264529_65_832 254
46 3300005336 Ga0070680_100272889 Ga0070680_1002728892 257
47 3300005577 Ga0068857_100084549 Ga0068857_1000845494 257
48 3300009101 Ga0105247_10078331 Ga0105247_100783313 257
49 3300025981 Ga0207640_10365503 Ga0207640_103655032 257
50 3300009093 Ga0105240_10414510 Ga0105240_104145102 259
51 3300009551 Ga0105238_10173779 Ga0105238_101737792 259
52 3300025924 Ga0207694_10013702 Ga0207694_100137025 259
53 3300031730 Ga0307516_10019150 Ga0307516_100191504 259
54 3300005564 Ga0070664_100106960 Ga0070664_1001069604 260
55 3300013306 Ga0163162_10000021 Ga0163162_1000002122 260
56 3300025945 Ga0207679_10664819 Ga0207679_106648191 260
57 3300031730 Ga0307516_10068531 Ga0307516_100685313 260
58 3300006881 Ga0068865_100001855 Ga0068865_1000018556 261
59 3300009176 Ga0105242_10011540 Ga0105242_100115402 261
60 3300013308 Ga0157375_10001711 Ga0157375_1000171111 261
61 3300014969 Ga0157376_10011316 Ga0157376_100113162 261
62 3300025934 Ga0207686_10052765 Ga0207686_100527654 261
63 3300031507 Ga0307509_10118446 Ga0307509_101184463 261
64 3300035089 Ga0373944_0002903 Ga0373944_0002903_3583_4371 261
65 3300035111 Ga0373923_0049174 Ga0373923_0049174_173_961 261
66 3300035692 Ga0373935_0061618 Ga0373935_0061618_473_1261 261
67 3300036401 Ga0373937_0041464 Ga0373937_0041464_46_834 261
68 3300044658 Ga0466972_0006856 Ga0466972_0006856_2216_3001 261
69 3300044765 Ga0466970_0003424 Ga0466970_0003424_4058_4843 261
70 3300046473 Ga0495582_0013180 Ga0495582_0013180_2273_3061 261
71 3300046475 Ga0495639_0002019 Ga0495639_0002019_2147_2935 261
72 3300046535 Ga0495586_0043419 Ga0495586_0043419_636_1424 261
73 3300047315 Ga0495581_0064269 Ga0495581_0064269_404_1192 261
74 3300047471 Ga0495684_0079909 Ga0495684_0079909_974_1762 261
75 3300048907 Ga0496104_0000012 Ga0496104_0000012_362130_362918 261
76 3300048908 Ga0496105_0000011 Ga0496105_0000011_75096_75884 261
77 3300048921 Ga0496118_0012629 Ga0496118_0012629_413_1198 261
78 3300005327 Ga0070658_10147278 Ga0070658_101472782 262
79 3300005331 Ga0070670_100228942 Ga0070670_1002289422 262
80 3300005331 Ga0070670_100522372 Ga0070670_1005223721 262
81 3300005334 Ga0068869_100029264 Ga0068869_1000292641 262
82 3300005336 Ga0070680_100070734 Ga0070680_1000707342 262
83 3300005344 Ga0070661_100049777 Ga0070661_1000497772 262
84 3300005344 Ga0070661_100051539 Ga0070661_1000515391 262
85 3300005344 Ga0070661_100216186 Ga0070661_1002161862 262
86 3300005344 Ga0070661_100398244 Ga0070661_1003982442 262
87 3300005364 Ga0070673_100049802 Ga0070673_1000498021 262
88 3300005366 Ga0070659_100120149 Ga0070659_1001201491 262
89 3300005367 Ga0070667_100130138 Ga0070667_1001301382 262
90 3300005367 Ga0070667_100244330 Ga0070667_1002443303 262
91 3300005367 Ga0070667_100289896 Ga0070667_1002898962 262
92 3300005455 Ga0070663_100005153 Ga0070663_1000051535 262
93 3300005458 Ga0070681_10243516 Ga0070681_102435162 262
94 3300005466 Ga0070685_10008593 Ga0070685_100085934 262
95 3300005535 Ga0070684_100792660 Ga0070684_1007926601 262
96 3300005539 Ga0068853_100033907 Ga0068853_1000339074 262
97 3300005539 Ga0068853_100055188 Ga0068853_1000551883 262
98 3300005539 Ga0068853_100063363 Ga0068853_1000633631 262
99 3300005539 Ga0068853_100102414 Ga0068853_1001024143 262
100 3300005548 Ga0070665_100010402 Ga0070665_1000104027 262
101 3300005548 Ga0070665_100213401 Ga0070665_1002134013 262
102 3300005563 Ga0068855_100019339 Ga0068855_1000193396 262
103 3300005563 Ga0068855_100087470 Ga0068855_1000874704 262
104 3300005564 Ga0070664_100631607 Ga0070664_1006316071 262
105 3300005577 Ga0068857_100109360 Ga0068857_1001093602 262
106 3300005614 Ga0068856_100030997 Ga0068856_1000309974 262
107 3300005616 Ga0068852_100007256 Ga0068852_1000072564 262
108 3300005616 Ga0068852_100058623 Ga0068852_1000586233 262
109 3300005616 Ga0068852_100165405 Ga0068852_1001654051 262
110 3300005616 Ga0068852_100209396 Ga0068852_1002093961 262
111 3300005616 Ga0068852_100539988 Ga0068852_1005399882 262
112 3300005617 Ga0068859_100111193 Ga0068859_1001111934 262
113 3300005617 Ga0068859_100404674 Ga0068859_1004046742 262
114 3300005841 Ga0068863_100003420 Ga0068863_10000342010 262
115 3300005841 Ga0068863_100398505 Ga0068863_1003985052 262
116 3300005842 Ga0068858_100089538 Ga0068858_1000895383 262
117 3300005843 Ga0068860_100025094 Ga0068860_1000250944 262
118 3300005843 Ga0068860_100207545 Ga0068860_1002075452 262
119 3300006237 Ga0097621_100105352 Ga0097621_1001053521 262
120 3300006237 Ga0097621_100116278 Ga0097621_1001162783 262
121 3300006358 Ga0068871_100036203 Ga0068871_1000362032 262
122 3300006931 Ga0097620_100111199 Ga0097620_1001111992 262
123 3300006931 Ga0097620_100404662 Ga0097620_1004046622 262
124 3300009093 Ga0105240_10001108 Ga0105240_1000110824 262
125 3300009093 Ga0105240_10029279 Ga0105240_100292793 262
126 3300009098 Ga0105245_10191777 Ga0105245_101917773 262
127 3300009545 Ga0105237_10008060 Ga0105237_100080605 262
128 3300009545 Ga0105237_10054191 Ga0105237_100541912 262
129 3300009545 Ga0105237_10247667 Ga0105237_102476671 262
130 3300009545 Ga0105237_10470162 Ga0105237_104701622 262
131 3300009551 Ga0105238_10002517 Ga0105238_100025177 262
132 3300009551 Ga0105238_10010512 Ga0105238_100105124 262
133 3300009551 Ga0105238_10011232 Ga0105238_100112326 262
134 3300010375 Ga0105239_10006133 Ga0105239_100061336 262
135 3300010375 Ga0105239_10069261 Ga0105239_100692613 262
136 3300010375 Ga0105239_10192060 Ga0105239_101920603 262
137 3300013104 Ga0157370_10240645 Ga0157370_102406452 262
138 3300013105 Ga0157369_10011883 Ga0157369_100118835 262
139 3300013297 Ga0157378_10092472 Ga0157378_100924724 262
140 3300013307 Ga0157372_10001728 Ga0157372_1000172813 262
141 3300013307 Ga0157372_10138755 Ga0157372_101387552 262
142 3300014969 Ga0157376_10029837 Ga0157376_100298372 262
143 3300014969 Ga0157376_10350206 Ga0157376_103502061 262
144 3300025261 Ga0209233_1002755 Ga0209233_10027555 262
145 3300025912 Ga0207707_10298575 Ga0207707_102985752 262
146 3300025913 Ga0207695_10000032 Ga0207695_10000032186 262
147 3300025913 Ga0207695_10000256 Ga0207695_100002567 262
148 3300025914 Ga0207671_10061903 Ga0207671_100619031 262
149 3300025914 Ga0207671_10257638 Ga0207671_102576382 262
150 3300025920 Ga0207649_10001915 Ga0207649_100019154 262
151 3300025924 Ga0207694_10000926 Ga0207694_100009267 262
152 3300025924 Ga0207694_10001900 Ga0207694_100019004 262
153 3300025924 Ga0207694_10084565 Ga0207694_100845652 262
154 3300025933 Ga0207706_10304113 Ga0207706_103041132 262
155 3300025938 Ga0207704_10053131 Ga0207704_100531313 262
156 3300025940 Ga0207691_10032229 Ga0207691_100322294 262
157 3300025942 Ga0207689_10045113 Ga0207689_100451132 262
158 3300025942 Ga0207689_10059186 Ga0207689_100591863 262
159 3300025942 Ga0207689_10588044 Ga0207689_105880441 262
160 3300025945 Ga0207679_10095716 Ga0207679_100957164 262
161 3300025949 Ga0207667_10012246 Ga0207667_100122467 262
162 3300025949 Ga0207667_10329783 Ga0207667_103297832 262
163 3300025961 Ga0207712_10050533 Ga0207712_100505333 262
164 3300025972 Ga0207668_10099587 Ga0207668_100995871 262
165 3300026023 Ga0207677_10409442 Ga0207677_104094421 262
166 3300026041 Ga0207639_10000240 Ga0207639_1000024015 262
167 3300026041 Ga0207639_10004037 Ga0207639_100040376 262
168 3300026041 Ga0207639_10029851 Ga0207639_100298513 262
169 3300026041 Ga0207639_10440508 Ga0207639_104405082 262
170 3300026067 Ga0207678_10024086 Ga0207678_100240863 262
171 3300026067 Ga0207678_10058337 Ga0207678_100583373 262
172 3300026078 Ga0207702_10206904 Ga0207702_102069043 262
173 3300026088 Ga0207641_10060774 Ga0207641_100607741 262
174 3300026116 Ga0207674_10001361 Ga0207674_1000136131 262
175 3300026116 Ga0207674_10104996 Ga0207674_101049963 262
176 3300026142 Ga0207698_10010163 Ga0207698_100101634 262
177 3300026142 Ga0207698_10025694 Ga0207698_100256944 262
178 3300026142 Ga0207698_10045485 Ga0207698_100454854 262
179 3300028379 Ga0268266_10007656 Ga0268266_100076567 262
180 3300028381 Ga0268264_10009673 Ga0268264_100096734 262
181 3300031595 Ga0265313_10069956 Ga0265313_100699562 262
182 3300041451 Ga0451791_1508417 Ga0451791_1508417_460_1248 262
183 3300041452 Ga0451793_0903364 Ga0451793_0903364_796_1584 262
184 3300041460 Ga0451802_0737098 Ga0451802_0737098_710_1498 262
185 3300041463 Ga0451804_0231991 Ga0451804_0231991_1168_1956 262
186 3300041486 Ga0451807_2221165 Ga0451807_2221165_1354_2142 262
187 3300041512 Ga0451853_0205579 Ga0451853_0205579_1754_2542 262
188 3300045976 Ga0466967_0754887 Ga0466967_0754887_134_928 262
189 3300048905 Ga0496102_0295454 Ga0496102_0295454_674_1462 262
190 3300048920 Ga0496117_0136452 Ga0496117_0136452_558_1346 262
191 3300049568 Ga0501031_0003044 Ga0501031_0003044_6701_7522 262
192 3300049569 Ga0501032_0004115 Ga0501032_0004115_6157_6978 262
193 3300049571 Ga0501034_0022631 Ga0501034_0022631_3714_4535 262
194 3300049572 Ga0501036_0149893 Ga0501036_0149893_1126_1947 262
195 3300049574 Ga0501038_0007689 Ga0501038_0007689_4025_4846 262
196 3300049575 Ga0501039_0025605 Ga0501039_0025605_1034_1855 262
197 3300049579 Ga0501043_0032194 Ga0501043_0032194_149_970 262
198 3300049580 Ga0501046_0006043 Ga0501046_0006043_333_1154 262
199 3300049581 Ga0501047_0033493 Ga0501047_0033493_3509_4330 262
200 3300049582 Ga0501048_0091969 Ga0501048_0091969_70_891 262
201 3300049587 Ga0501071_0319436 Ga0501071_0319436_110_931 262
202 3300049589 Ga0501073_0013036 Ga0501073_0013036_3012_3833 262
203 3300049742 Ga0501080_0016268 Ga0501080_0016268_5330_6151 262
204 3300049742 Ga0501080_0258360 Ga0501080_0258360_64_855 262
205 3300049822 Ga0501035_0032049 Ga0501035_0032049_383_1204 262
206 3300005329 Ga0070683_100155257 Ga0070683_1001552573 263
207 3300005331 Ga0070670_100270805 Ga0070670_1002708053 263
208 3300005335 Ga0070666_10000350 Ga0070666_1000035015 263
209 3300005335 Ga0070666_10004180 Ga0070666_100041808 263
210 3300005335 Ga0070666_10010272 Ga0070666_100102724 263
211 3300005338 Ga0068868_100027431 Ga0068868_1000274313 263
212 3300005338 Ga0068868_100106401 Ga0068868_1001064013 263
213 3300005344 Ga0070661_100145344 Ga0070661_1001453442 263
214 3300005355 Ga0070671_100031998 Ga0070671_1000319984 263
215 3300005364 Ga0070673_100432451 Ga0070673_1004324512 263
216 3300005367 Ga0070667_100013185 Ga0070667_1000131853 263
217 3300005367 Ga0070667_100020046 Ga0070667_1000200463 263
218 3300005367 Ga0070667_100133516 Ga0070667_1001335161 263
219 3300005367 Ga0070667_100302831 Ga0070667_1003028312 263
220 3300005455 Ga0070663_100000029 Ga0070663_10000002935 263
221 3300005455 Ga0070663_100054907 Ga0070663_1000549073 263
222 3300005455 Ga0070663_100175004 Ga0070663_1001750042 263
223 3300005456 Ga0070678_100052598 Ga0070678_1000525984 263
224 3300005457 Ga0070662_100004053 Ga0070662_1000040535 263
225 3300005459 Ga0068867_100019447 Ga0068867_1000194475 263
226 3300005535 Ga0070684_100156920 Ga0070684_1001569203 263
227 3300005539 Ga0068853_100002537 Ga0068853_1000025373 263
228 3300005547 Ga0070693_100261801 Ga0070693_1002618011 263
229 3300005548 Ga0070665_100000026 Ga0070665_100000026217 263
230 3300005548 Ga0070665_100006914 Ga0070665_1000069147 263
231 3300005548 Ga0070665_100023347 Ga0070665_1000233473 263
232 3300005548 Ga0070665_100089521 Ga0070665_1000895212 263
233 3300005548 Ga0070665_100117982 Ga0070665_1001179823 263
234 3300005548 Ga0070665_100500887 Ga0070665_1005008872 263
235 3300005563 Ga0068855_101080304 Ga0068855_1010803041 263
236 3300005564 Ga0070664_100067718 Ga0070664_1000677184 263
237 3300005578 Ga0068854_100012520 Ga0068854_1000125205 263
238 3300005614 Ga0068856_100156288 Ga0068856_1001562883 263
239 3300005617 Ga0068859_100001840 Ga0068859_10000184014 263
240 3300005617 Ga0068859_100035642 Ga0068859_1000356424 263
241 3300005618 Ga0068864_100007613 Ga0068864_1000076138 263
242 3300005618 Ga0068864_100060869 Ga0068864_1000608693 263
243 3300005719 Ga0068861_100016689 Ga0068861_1000166893 263
244 3300005834 Ga0068851_10000257 Ga0068851_100002573 263
245 3300005841 Ga0068863_100015047 Ga0068863_1000150475 263
246 3300005841 Ga0068863_100032202 Ga0068863_1000322024 263
247 3300005841 Ga0068863_100166170 Ga0068863_1001661704 263
248 3300005843 Ga0068860_100060657 Ga0068860_1000606571 263
249 3300005843 Ga0068860_100115366 Ga0068860_1001153662 263
250 3300005844 Ga0068862_100000185 Ga0068862_10000018529 263
251 3300005937 Ga0081455_10090524 Ga0081455_100905241 263
252 3300005983 Ga0081540_1013631 Ga0081540_10136313 263
253 3300006028 Ga0070717_10463329 Ga0070717_104633292 263
254 3300006175 Ga0070712_100387365 Ga0070712_1003873651 263
255 3300006237 Ga0097621_100226603 Ga0097621_1002266031 263
256 3300006358 Ga0068871_100040939 Ga0068871_1000409394 263
257 3300006358 Ga0068871_100073237 Ga0068871_1000732372 263
258 3300006358 Ga0068871_100087030 Ga0068871_1000870304 263
259 3300006881 Ga0068865_100018474 Ga0068865_1000184742 263
260 3300006931 Ga0097620_100001840 Ga0097620_10000184014 263
261 3300006931 Ga0097620_100035641 Ga0097620_1000356414 263
262 3300009093 Ga0105240_10066951 Ga0105240_100669514 263
263 3300009098 Ga0105245_10295514 Ga0105245_102955143 263
264 3300009174 Ga0105241_10050290 Ga0105241_100502903 263
265 3300009174 Ga0105241_10148384 Ga0105241_101483842 263
266 3300009174 Ga0105241_10758279 Ga0105241_107582791 263
267 3300009176 Ga0105242_10137652 Ga0105242_101376522 263
268 3300009177 Ga0105248_10000246 Ga0105248_1000024615 263
269 3300009545 Ga0105237_10000231 Ga0105237_1000023144 263
270 3300009551 Ga0105238_10021215 Ga0105238_100212154 263
271 3300009551 Ga0105238_10312464 Ga0105238_103124642 263
272 3300009553 Ga0105249_10001225 Ga0105249_100012253 263
273 3300009553 Ga0105249_10003063 Ga0105249_100030638 263
274 3300010375 Ga0105239_10007220 Ga0105239_100072207 263
275 3300010375 Ga0105239_10145809 Ga0105239_101458092 263
276 3300011119 Ga0105246_10010675 Ga0105246_100106755 263
277 3300013100 Ga0157373_10134699 Ga0157373_101346992 263
278 3300013105 Ga0157369_10331284 Ga0157369_103312842 263
279 3300013296 Ga0157374_10050922 Ga0157374_100509225 263
280 3300013296 Ga0157374_10143304 Ga0157374_101433042 263
281 3300013297 Ga0157378_10088515 Ga0157378_100885153 263
282 3300013306 Ga0163162_10614302 Ga0163162_106143022 263
283 3300013307 Ga0157372_10011884 Ga0157372_100118849 263
284 3300013307 Ga0157372_10033755 Ga0157372_100337555 263
285 3300014325 Ga0163163_10001486 Ga0163163_100014865 263
286 3300014325 Ga0163163_10004834 Ga0163163_100048345 263
287 3300014325 Ga0163163_10492291 Ga0163163_104922912 263
288 3300014968 Ga0157379_10003069 Ga0157379_100030698 263
289 3300014968 Ga0157379_10127347 Ga0157379_101273473 263
290 3300014968 Ga0157379_10249583 Ga0157379_102495831 263
291 3300014969 Ga0157376_10065030 Ga0157376_100650304 263
292 3300025321 Ga0207656_10000343 Ga0207656_1000034314 263
293 3300025321 Ga0207656_10015685 Ga0207656_100156853 263
294 3300025321 Ga0207656_10046243 Ga0207656_100462433 263
295 3300025903 Ga0207680_10000092 Ga0207680_100000924 263
296 3300025903 Ga0207680_10005480 Ga0207680_100054804 263
297 3300025904 Ga0207647_10002348 Ga0207647_100023487 263
298 3300025913 Ga0207695_10071391 Ga0207695_100713912 263
299 3300025913 Ga0207695_10088961 Ga0207695_100889613 263
300 3300025914 Ga0207671_10004399 Ga0207671_1000439912 263
301 3300025914 Ga0207671_10169072 Ga0207671_101690722 263
302 3300025914 Ga0207671_10445363 Ga0207671_104453632 263
303 3300025916 Ga0207663_10101082 Ga0207663_101010824 263
304 3300025920 Ga0207649_10031448 Ga0207649_100314483 263
305 3300025920 Ga0207649_10170402 Ga0207649_101704022 263
306 3300025924 Ga0207694_10001219 Ga0207694_1000121914 263
307 3300025925 Ga0207650_10237735 Ga0207650_102377352 263
308 3300025933 Ga0207706_10004125 Ga0207706_100041257 263
309 3300025938 Ga0207704_10028670 Ga0207704_100286704 263
310 3300025941 Ga0207711_10002283 Ga0207711_1000228313 263
311 3300025941 Ga0207711_10054511 Ga0207711_100545114 263
312 3300025942 Ga0207689_10028174 Ga0207689_100281745 263
313 3300025949 Ga0207667_10217811 Ga0207667_102178113 263
314 3300025961 Ga0207712_10000189 Ga0207712_100001895 263
315 3300025961 Ga0207712_10016011 Ga0207712_100160112 263
316 3300025972 Ga0207668_10029954 Ga0207668_100299543 263
317 3300025972 Ga0207668_10120103 Ga0207668_101201032 263
318 3300025981 Ga0207640_10018023 Ga0207640_100180232 263
319 3300025986 Ga0207658_10000013 Ga0207658_10000013175 263
320 3300025986 Ga0207658_10020312 Ga0207658_100203122 263
321 3300025986 Ga0207658_10138888 Ga0207658_101388882 263
322 3300026023 Ga0207677_10114115 Ga0207677_101141152 263
323 3300026035 Ga0207703_10070886 Ga0207703_100708864 263
324 3300026041 Ga0207639_10005312 Ga0207639_100053127 263
325 3300026041 Ga0207639_10645109 Ga0207639_106451091 263
326 3300026067 Ga0207678_10000035 Ga0207678_1000003566 263
327 3300026067 Ga0207678_10033873 Ga0207678_100338735 263
328 3300026078 Ga0207702_10026249 Ga0207702_100262495 263
329 3300026088 Ga0207641_10028141 Ga0207641_100281415 263
330 3300026088 Ga0207641_10056047 Ga0207641_100560474 263
331 3300026089 Ga0207648_10057420 Ga0207648_100574203 263
332 3300026095 Ga0207676_10004232 Ga0207676_1000423210 263
333 3300026095 Ga0207676_10060746 Ga0207676_100607463 263
334 3300026118 Ga0207675_100039837 Ga0207675_1000398371 263
335 3300026121 Ga0207683_10026726 Ga0207683_100267264 263
336 3300026121 Ga0207683_10127298 Ga0207683_101272982 263
337 3300028379 Ga0268266_10000001 Ga0268266_100000011053 263
338 3300028379 Ga0268266_10000013 Ga0268266_10000013308 263
339 3300028379 Ga0268266_10077773 Ga0268266_100777733 263
340 3300028379 Ga0268266_10693524 Ga0268266_106935242 263
341 3300028380 Ga0268265_10001042 Ga0268265_100010429 263
342 3300028381 Ga0268264_10016619 Ga0268264_100166196 263
343 3300028381 Ga0268264_10135281 Ga0268264_101352812 263
344 3300028381 Ga0268264_10601653 Ga0268264_106016532 263
345 3300041507 Ga0451851_0669231 Ga0451851_0669231_197_991 263
346 3300047472 Ga0495686_0003123 Ga0495686_0003123_2689_3486 263
347 3300048904 Ga0496101_0233336 Ga0496101_0233336_302_1123 263
348 3300048918 Ga0496115_0137912 Ga0496115_0137912_421_1212 263
349 3300048920 Ga0496117_0072554 Ga0496117_0072554_1174_1965 263
350 3300048920 Ga0496117_0307559 Ga0496117_0307559_17_814 263
351 3300048921 Ga0496118_0000356 Ga0496118_0000356_65273_66064 263
352 3300048924 Ga0496121_0042942 Ga0496121_0042942_1503_2294 263
353 3300048925 Ga0496122_0000062 Ga0496122_0000062_229503_230300 263
354 3300048926 Ga0496123_0004387 Ga0496123_0004387_9145_9942 263
355 3300048929 Ga0496126_0334182 Ga0496126_0334182_241_1032 263
356 3300049568 Ga0501031_0006995 Ga0501031_0006995_1882_2673 263
357 3300049568 Ga0501031_0200686 Ga0501031_0200686_244_1035 263
358 3300049569 Ga0501032_0000770 Ga0501032_0000770_10415_11206 263
359 3300049569 Ga0501032_0037713 Ga0501032_0037713_2021_2812 263
360 3300049569 Ga0501032_0043374 Ga0501032_0043374_739_1530 263
361 3300049569 Ga0501032_0053299 Ga0501032_0053299_1531_2322 263
362 3300049570 Ga0501033_0000634 Ga0501033_0000634_15436_16227 263
363 3300049570 Ga0501033_0107078 Ga0501033_0107078_805_1596 263
364 3300049571 Ga0501034_0001449 Ga0501034_0001449_23297_24088 263
365 3300049571 Ga0501034_0012545 Ga0501034_0012545_7704_8495 263
366 3300049571 Ga0501034_0405679 Ga0501034_0405679_184_1005 263
367 3300049572 Ga0501036_0010967 Ga0501036_0010967_959_1750 263
368 3300049572 Ga0501036_0052249 Ga0501036_0052249_2043_2834 263
369 3300049573 Ga0501037_0002152 Ga0501037_0002152_11124_11915 263
370 3300049573 Ga0501037_0063889 Ga0501037_0063889_293_1084 263
371 3300049574 Ga0501038_0141910 Ga0501038_0141910_201_992 263
372 3300049575 Ga0501039_0026347 Ga0501039_0026347_2754_3545 263
373 3300049578 Ga0501042_0186240 Ga0501042_0186240_401_1228 263
374 3300049579 Ga0501043_0010157 Ga0501043_0010157_6514_7305 263
375 3300049579 Ga0501043_0017476 Ga0501043_0017476_3710_4501 263
376 3300049579 Ga0501043_0041406 Ga0501043_0041406_1028_1819 263
377 3300049579 Ga0501043_0257395 Ga0501043_0257395_368_1189 263
378 3300049580 Ga0501046_0003892 Ga0501046_0003892_7474_8265 263
379 3300049580 Ga0501046_0004386 Ga0501046_0004386_10311_11102 263
380 3300049580 Ga0501046_0010702 Ga0501046_0010702_5562_6353 263
381 3300049580 Ga0501046_0110092 Ga0501046_0110092_428_1249 263
382 3300049581 Ga0501047_0000250 Ga0501047_0000250_39599_40390 263
383 3300049581 Ga0501047_0002878 Ga0501047_0002878_9928_10719 263
384 3300049581 Ga0501047_0017238 Ga0501047_0017238_4231_5022 263
385 3300049581 Ga0501047_0039356 Ga0501047_0039356_2347_3138 263
386 3300049581 Ga0501047_0110249 Ga0501047_0110249_1583_2404 263
387 3300049581 Ga0501047_0312048 Ga0501047_0312048_245_1036 263
388 3300049581 Ga0501047_0404307 Ga0501047_0404307_22_813 263
389 3300049582 Ga0501048_0024152 Ga0501048_0024152_990_1781 263
390 3300049582 Ga0501048_0032677 Ga0501048_0032677_2756_3547 263
391 3300049583 Ga0501067_0000659 Ga0501067_0000659_3342_4133 263
392 3300049583 Ga0501067_0008758 Ga0501067_0008758_4185_4976 263
393 3300049583 Ga0501067_0227735 Ga0501067_0227735_23_844 263
394 3300049584 Ga0501068_0024565 Ga0501068_0024565_1276_2067 263
395 3300049584 Ga0501068_0044203 Ga0501068_0044203_621_1412 263
396 3300049585 Ga0501069_0000156 Ga0501069_0000156_21301_22092 263
397 3300049585 Ga0501069_0005272 Ga0501069_0005272_4899_5690 263
398 3300049585 Ga0501069_0076598 Ga0501069_0076598_195_986 263
399 3300049586 Ga0501070_0022613 Ga0501070_0022613_3370_4161 263
400 3300049586 Ga0501070_0026522 Ga0501070_0026522_2831_3622 263
401 3300049586 Ga0501070_0043513 Ga0501070_0043513_2355_3146 263
402 3300049586 Ga0501070_0092526 Ga0501070_0092526_933_1724 263
403 3300049586 Ga0501070_0099763 Ga0501070_0099763_551_1342 263
404 3300049586 Ga0501070_0250960 Ga0501070_0250960_556_1377 263
405 3300049587 Ga0501071_0018579 Ga0501071_0018579_1231_2022 263
406 3300049588 Ga0501072_0033160 Ga0501072_0033160_2627_3418 263
407 3300049589 Ga0501073_0047353 Ga0501073_0047353_868_1689 263
408 3300049589 Ga0501073_0052804 Ga0501073_0052804_1599_2390 263
409 3300049589 Ga0501073_0060721 Ga0501073_0060721_1363_2154 263
410 3300049589 Ga0501073_0111391 Ga0501073_0111391_767_1558 263
411 3300049589 Ga0501073_0145754 Ga0501073_0145754_706_1497 263
412 3300049590 Ga0501074_0008498 Ga0501074_0008498_1486_2277 263
413 3300049590 Ga0501074_0013651 Ga0501074_0013651_3623_4414 263
414 3300049590 Ga0501074_0048284 Ga0501074_0048284_1619_2410 263
415 3300049590 Ga0501074_0051069 Ga0501074_0051069_418_1209 263
416 3300049590 Ga0501074_0051608 Ga0501074_0051608_593_1384 263
417 3300049590 Ga0501074_0056382 Ga0501074_0056382_991_1782 263
418 3300049741 Ga0501079_0073754 Ga0501079_0073754_1330_2121 263
419 3300049741 Ga0501079_0092873 Ga0501079_0092873_1087_1878 263
420 3300049741 Ga0501079_0130367 Ga0501079_0130367_817_1608 263
421 3300049741 Ga0501079_0311509 Ga0501079_0311509_132_953 263
422 3300049742 Ga0501080_0000306 Ga0501080_0000306_29453_30244 263
423 3300049742 Ga0501080_0000320 Ga0501080_0000320_25592_26383 263
424 3300049742 Ga0501080_0004331 Ga0501080_0004331_9791_10582 263
425 3300049742 Ga0501080_0060745 Ga0501080_0060745_165_956 263
426 3300049742 Ga0501080_0161159 Ga0501080_0161159_778_1569 263
427 3300049744 Ga0501083_0003228 Ga0501083_0003228_3892_4683 263
428 3300049744 Ga0501083_0027898 Ga0501083_0027898_962_1753 263
429 3300049744 Ga0501083_0097391 Ga0501083_0097391_256_1077 263
430 3300049744 Ga0501083_0140153 Ga0501083_0140153_301_1092 263
431 3300049822 Ga0501035_0007087 Ga0501035_0007087_2767_3558 263
432 3300049822 Ga0501035_0057411 Ga0501035_0057411_2412_3203 263
433 3300049822 Ga0501035_0122672 Ga0501035_0122672_1181_1972 263
434 3300049823 Ga0501044_0009241 Ga0501044_0009241_7704_8495 263
435 3300049823 Ga0501044_0034783 Ga0501044_0034783_3997_4788 263
436 3300049823 Ga0501044_0036920 Ga0501044_0036920_645_1436 263
437 3300049823 Ga0501044_0183059 Ga0501044_0183059_760_1551 263
438 3300049823 Ga0501044_0187056 Ga0501044_0187056_185_1006 263
439 3300049823 Ga0501044_0391209 Ga0501044_0391209_499_1290 263
440 3300049824 Ga0501045_0008982 Ga0501045_0008982_2720_3511 263
441 3300049824 Ga0501045_0505480 Ga0501045_0505480_90_881 263
442 3300053079 Ga0500610_0005485 Ga0500610_0005485_3686_4627 263
443 3300053093 Ga0500651_0034143 Ga0500651_0034143_788_1591 263
444 3300053120 Ga0500597_000019 Ga0500597_000019_25170_25967 263
445 3300053139 Ga0500568_0001625 Ga0500568_0001625_10580_11371 263
446 3300054114 Ga0501084_0050991 Ga0501084_0050991_1878_2699 263
447 3300054114 Ga0501084_0161105 Ga0501084_0161105_631_1422 263
448 3300060353 Ga0501082_0000394 Ga0501082_0000394_4328_5149 263
449 3300060353 Ga0501082_0015773 Ga0501082_0015773_533_1324 263
450 3300060353 Ga0501082_0147684 Ga0501082_0147684_85_876 263
451 3300061734 Ga0530510_0264118 Ga0530510_0264118_268_1068 263
452 3300005327 Ga0070658_10055376 Ga0070658_100553763 264
453 3300005335 Ga0070666_10040713 Ga0070666_100407133 264
454 3300005340 Ga0070689_100162476 Ga0070689_1001624761 264
455 3300005353 Ga0070669_100012211 Ga0070669_1000122114 264
456 3300005354 Ga0070675_100026753 Ga0070675_1000267533 264
457 3300005364 Ga0070673_100021166 Ga0070673_1000211665 264
458 3300005367 Ga0070667_100035954 Ga0070667_1000359543 264
459 3300005456 Ga0070678_100059527 Ga0070678_1000595274 264
460 3300005548 Ga0070665_100014732 Ga0070665_1000147324 264
461 3300005617 Ga0068859_100091736 Ga0068859_1000917363 264
462 3300006237 Ga0097621_100138095 Ga0097621_1001380953 264
463 3300006881 Ga0068865_100006246 Ga0068865_1000062465 264
464 3300006931 Ga0097620_100091732 Ga0097620_1000917322 264
465 3300009174 Ga0105241_10022873 Ga0105241_100228734 264
466 3300009545 Ga0105237_10066189 Ga0105237_100661894 264
467 3300009551 Ga0105238_10062903 Ga0105238_100629032 264
468 3300009553 Ga0105249_10062410 Ga0105249_100624103 264
469 3300010375 Ga0105239_10095752 Ga0105239_100957521 264
470 3300013105 Ga0157369_10000001 Ga0157369_1000000116 264
471 3300025315 Ga0207697_10034652 Ga0207697_100346523 264
472 3300025907 Ga0207645_10004975 Ga0207645_100049756 264
473 3300025909 Ga0207705_10043041 Ga0207705_100430413 264
474 3300025911 Ga0207654_10029181 Ga0207654_100291813 264
475 3300025913 Ga0207695_10148675 Ga0207695_101486753 264
476 3300025914 Ga0207671_10051190 Ga0207671_100511903 264
477 3300025916 Ga0207663_10133130 Ga0207663_101331301 264
478 3300025924 Ga0207694_10046534 Ga0207694_100465344 264
479 3300025926 Ga0207659_10041806 Ga0207659_100418063 264
480 3300025938 Ga0207704_10008111 Ga0207704_100081114 264
481 3300025940 Ga0207691_10089244 Ga0207691_100892443 264
482 3300025961 Ga0207712_10023327 Ga0207712_100233273 264
483 3300025972 Ga0207668_10004626 Ga0207668_100046264 264
484 3300026023 Ga0207677_10235524 Ga0207677_102355241 264
485 3300026121 Ga0207683_10029550 Ga0207683_100295504 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

89

312

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9358 21 261
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9327 21 261
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9261 21 261
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9246 21 261
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9216 21 261
ID Description Score Start End Superfamily
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9326 21 261 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9215 21 261 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9014 21 261 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8989 19 259 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8966 23 261 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0H2X7E6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9728 21 262 GO:0016787
AF-A0A6N3UBH8-F1-model_v4 deleted 0.971 98 261
AF-W4SH93-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9706 22 261 GO:0008806
AF-H8FID6-F1-model_v4 deleted 0.9697 40 262
AF-A0A0L7TIQ4-F1-model_v4 DeoR faimly transcriptional regulator 0.968 142 260 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map