F452404

General Info

Members Datasets Scaffolds Average Seq Length
481 245 962 281

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10052187|Ga0157372_100521872
Length 328
Sequence LWSPGGAGFIGSNFILQRMRDDSVSFDKLTYAGNPHNLERIAERSLMKVMIIGATGLLGKPLMRQWTGAELIGTGSRDLDIRDAAPVRDIIEKNHPDWIVLAGAYTDVDGCEKNPDLALAVNRDGAVNVANAAKSIRAKLLFLSSDYVFDGTKSTPYETNDARNPQSVYGRSKAEAELRLLEVLPDACIVRTSWLFGAGGKCFPDTILKLAATRPHLEVVNDQRGCPTYTVDLATAIIALCGKNASGLIHACNAGECTWFDFAREIVSSAGLKTEVRPVSSAQMARPAPRPTYSVLSATSLHRYGIVMPEWKDALRRYLDERQSVTGN

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
103 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
164 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.91
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10052187 3300013307 Unclassified 4552
2 MBSR1b_contig_9152771 2162886012 Bacteria 3738
3 LJNas_1000035 3300000546 Bacteria 18298
4 JGI24741J21665_1009632 3300001915 Bacteria 1766
5 JGI24752J21851_1000681 3300001976 Bacteria 4522
6 JGI24737J22298_10005894 3300001990 Bacteria 4218
7 JGI24743J22301_10000140 3300001991 Bacteria 7294
8 JGI24748J21848_1001088 3300002074 Bacteria 2960
9 JGI24034J26672_10001099 3300002239 Bacteria 3525
10 JGI24751J29686_10001011 3300002459 Bacteria 6176
11 Ga0065712_10095011 3300005290 Bacteria 2233
12 Ga0070658_10007968 3300005327 Bacteria 8526
13 Ga0070683_100113596 3300005329 Bacteria 2556
14 Ga0070670_100128612 3300005331 Bacteria 2186
15 Ga0070670_100238362 3300005331 Bacteria 1583
16 Ga0070666_10048630 3300005335 Bacteria 2850
17 Ga0070666_10175906 3300005335 Bacteria 1500
18 Ga0070680_100041430 3300005336 Bacteria 3734
19 Ga0070680_100057895 3300005336 Bacteria 3169
20 Ga0070680_100161320 3300005336 Bacteria 1884
21 Ga0070682_100012310 3300005337 Bacteria 4902
22 Ga0068868_100024126 3300005338 Bacteria 4611
23 Ga0068868_100227666 3300005338 Bacteria 1563
24 Ga0070660_100004713 3300005339 Bacteria 9440
25 Ga0070661_100033920 3300005344 Bacteria 3700
26 Ga0070668_100007721 3300005347 Bacteria 7982
27 Ga0070669_100006650 3300005353 Bacteria 8327
28 Ga0070675_100180811 3300005354 Bacteria 1823
29 Ga0070671_100064135 3300005355 Bacteria 3060
30 Ga0070673_100102446 3300005364 Bacteria 2360
31 Ga0070673_100535778 3300005364 Unclassified 1062
32 Ga0070688_100000704 3300005365 Bacteria 16473
33 Ga0070659_100003190 3300005366 Bacteria 11669
34 Ga0070709_10003408 3300005434 Bacteria 8535
35 Ga0070709_10056868 3300005434 Bacteria 2475
36 Ga0070709_10131674 3300005434 Bacteria 1708
37 Ga0070714_100000458 3300005435 Bacteria 29649
38 Ga0070714_100149357 3300005435 Bacteria 2104
39 Ga0070714_100312863 3300005435 Bacteria 1467
40 Ga0070714_100319767 3300005435 Bacteria 1451
41 Ga0070714_100514105 3300005435 Bacteria 1143
42 Ga0070713_100000021 3300005436 Bacteria 107806
43 Ga0070713_100000387 3300005436 Bacteria 28223
44 Ga0070713_100015849 3300005436 Bacteria 5650
45 Ga0070713_100020435 3300005436 Bacteria 5076
46 Ga0070713_100042864 3300005436 Bacteria 3696
47 Ga0070713_100045088 3300005436 Bacteria 3611
48 Ga0070713_100052228 3300005436 Unclassified 3384
49 Ga0070713_100053557 3300005436 Bacteria 3343
50 Ga0070713_100078282 3300005436 Bacteria 2814
51 Ga0070713_100094298 3300005436 Unclassified 2580
52 Ga0070713_100164443 3300005436 Bacteria 1983
53 Ga0070713_100190396 3300005436 Bacteria 1848
54 Ga0070710_10035715 3300005437 Bacteria 2712
55 Ga0070710_10046946 3300005437 Bacteria 2407
56 Ga0070711_100000213 3300005439 Bacteria 30586
57 Ga0070711_100000248 3300005439 Bacteria 27500
58 Ga0070711_100002260 3300005439 Bacteria 10929
59 Ga0070711_100092350 3300005439 Bacteria 2184
60 Ga0070711_100094017 3300005439 Unclassified 2166
61 Ga0070711_100193177 3300005439 Unclassified 1566
62 Ga0070708_100000532 3300005445 Bacteria 28686
63 Ga0070708_100043305 3300005445 Bacteria 3955
64 Ga0070663_100069629 3300005455 Bacteria 2556
65 Ga0070662_100186833 3300005457 Bacteria 1636
66 Ga0070662_100237560 3300005457 Bacteria 1460
67 Ga0070681_10000893 3300005458 Bacteria 25219
68 Ga0070681_10083868 3300005458 Bacteria 3140
69 Ga0070681_10119423 3300005458 Bacteria 2572
70 Ga0068867_100035486 3300005459 Bacteria 3617
71 Ga0070685_10004079 3300005466 Bacteria 7382
72 Ga0070706_100000534 3300005467 Bacteria 44214
73 Ga0070706_100100544 3300005467 Bacteria 2687
74 Ga0070706_100151958 3300005467 Bacteria 2161
75 Ga0070707_100000558 3300005468 Bacteria 37450
76 Ga0070707_100121657 3300005468 Bacteria 2534
77 Ga0070707_100339064 3300005468 Bacteria 1460
78 Ga0070698_100000989 3300005471 Bacteria 31283
79 Ga0070698_100061979 3300005471 Bacteria 3774
80 Ga0070699_100001581 3300005518 Bacteria 20812
81 Ga0070699_100132393 3300005518 Unclassified 2198
82 Ga0070679_100008906 3300005530 Bacteria 9472
83 Ga0070679_100080060 3300005530 Bacteria 3256
84 Ga0070679_100597710 3300005530 Bacteria 1047
85 Ga0070684_100007319 3300005535 Bacteria 8579
86 Ga0070684_100049838 3300005535 Bacteria 3636
87 Ga0070684_100110463 3300005535 Bacteria 2465
88 Ga0070697_100000045 3300005536 Bacteria 92181
89 Ga0070697_100000241 3300005536 Bacteria 44319
90 Ga0070697_100003698 3300005536 Bacteria 11757
91 Ga0068853_100043151 3300005539 Bacteria 3858
92 Ga0068853_100098634 3300005539 Bacteria 2580
93 Ga0070672_100002788 3300005543 Bacteria 11204
94 Ga0068855_100000785 3300005563 Bacteria 39253
95 Ga0070664_100025165 3300005564 Bacteria 4931
96 Ga0068857_100017337 3300005577 Bacteria 6309
97 Ga0068854_100033657 3300005578 Bacteria 3574
98 Ga0068854_100048113 3300005578 Bacteria 3041
99 Ga0068854_100065804 3300005578 Bacteria 2636
100 Ga0068854_100283844 3300005578 Unclassified 1334
101 Ga0068856_100001627 3300005614 Bacteria 23529
102 Ga0068856_100001628 3300005614 Bacteria 23525
103 Ga0068856_100009846 3300005614 Bacteria 9282
104 Ga0068856_100016266 3300005614 Bacteria 7197
105 Ga0068856_100024387 3300005614 Bacteria 5887
106 Ga0068856_100185623 3300005614 Unclassified 2093
107 Ga0068856_100251539 3300005614 Bacteria 1782
108 Ga0068856_100264945 3300005614 Unclassified 1734
109 Ga0068852_100088961 3300005616 Bacteria 2759
110 Ga0068859_100117914 3300005617 Bacteria 2720
111 Ga0068864_100008949 3300005618 Bacteria 8254
112 Ga0068866_10003545 3300005718 Bacteria 6393
113 Ga0068866_10019450 3300005718 Unclassified 3092
114 Ga0068851_10007704 3300005834 Bacteria 4951
115 Ga0068870_10001697 3300005840 Bacteria 9006
116 Ga0068863_100009907 3300005841 Bacteria 9280
117 Ga0068863_100013923 3300005841 Bacteria 7754
118 Ga0068863_100100778 3300005841 Unclassified 2745
119 Ga0068858_100012851 3300005842 Bacteria 7896
120 Ga0068858_100064147 3300005842 Bacteria 3399
121 Ga0068860_100032222 3300005843 Bacteria 5038
122 Ga0068860_100090942 3300005843 Bacteria 2907
123 Ga0068860_100100035 3300005843 Bacteria 2766
124 Ga0068862_100080732 3300005844 Bacteria 2821
125 Ga0068862_100115533 3300005844 Bacteria 2360
126 Ga0070717_10002716 3300006028 Bacteria 12485
127 Ga0070717_10017085 3300006028 Bacteria 5636
128 Ga0070717_10024264 3300006028 Bacteria 4813
129 Ga0070717_10054635 3300006028 Unclassified 3294
130 Ga0070717_10065583 3300006028 Bacteria 3018
131 Ga0070717_10161392 3300006028 Unclassified 1945
132 Ga0070717_10170375 3300006028 Bacteria 1893
133 Ga0070717_10179600 3300006028 Bacteria 1844
134 Ga0070717_10215719 3300006028 Bacteria 1685
135 Ga0070717_10432234 3300006028 Unclassified 1185
136 Ga0070715_10000351 3300006163 Bacteria 11514
137 Ga0070715_10036291 3300006163 Bacteria 2032
138 Ga0070715_10123915 3300006163 Unclassified 1235
139 Ga0070716_100016402 3300006173 Bacteria 3822
140 Ga0070716_100025589 3300006173 Bacteria 3151
141 Ga0070716_100102908 3300006173 Bacteria 1755
142 Ga0070716_100177429 3300006173 Unclassified 1396
143 Ga0070716_100297312 3300006173 Unclassified 1121
144 Ga0070712_100000509 3300006175 Bacteria 22272
145 Ga0070712_100000556 3300006175 Bacteria 21655
146 Ga0070712_100000601 3300006175 Bacteria 21098
147 Ga0070712_100002473 3300006175 Bacteria 11390
148 Ga0070712_100024385 3300006175 Bacteria 4008
149 Ga0070712_100033177 3300006175 Unclassified 3491
150 Ga0070712_100251292 3300006175 Bacteria 1413
151 Ga0097621_100000715 3300006237 Bacteria 23264
152 Ga0097621_100001284 3300006237 Bacteria 17270
153 Ga0097621_100035397 3300006237 Unclassified 3989
154 Ga0097621_100075895 3300006237 Bacteria 2787
155 Ga0097621_100143926 3300006237 Bacteria 2039
156 Ga0068871_100001334 3300006358 Bacteria 16521
157 Ga0068871_100077798 3300006358 Bacteria 2742
158 Ga0068871_100085589 3300006358 Bacteria 2618
159 Ga0068871_100096958 3300006358 Bacteria 2464
160 Ga0075433_10003377 3300006852 Bacteria 12335
161 Ga0075434_100000585 3300006871 Bacteria 28096
162 Ga0068865_100081788 3300006881 Bacteria 2320
163 Ga0075436_100003816 3300006914 Bacteria 10340
164 Ga0075436_100006611 3300006914 Bacteria 7946
165 Ga0097620_100117915 3300006931 Bacteria 2720
166 Ga0075435_100000769 3300007076 Bacteria 19886
167 Ga0075435_100005998 3300007076 Bacteria 8553
168 Ga0099794_10003820 3300007265 Bacteria 5818
169 Ga0105240_10018728 3300009093 Bacteria 9276
170 Ga0105240_10021080 3300009093 Bacteria 8674
171 Ga0105240_10023633 3300009093 Bacteria 8120
172 Ga0105240_10050573 3300009093 Bacteria 5238
173 Ga0105240_10308232 3300009093 Bacteria 1809
174 Ga0105240_10393420 3300009093 Bacteria 1563
175 Ga0105245_10001518 3300009098 Bacteria 21005
176 Ga0105245_10013328 3300009098 Bacteria 7163
177 Ga0105247_10003571 3300009101 Bacteria 10104
178 Ga0105241_10000584 3300009174 Bacteria 27506
179 Ga0105241_10104689 3300009174 Bacteria 2255
180 Ga0105242_10012582 3300009176 Bacteria 6515
181 Ga0105242_10038000 3300009176 Bacteria 3869
182 Ga0105248_10010549 3300009177 Bacteria 10179
183 Ga0105248_10010729 3300009177 Bacteria 10114
184 Ga0105248_10012550 3300009177 Bacteria 9345
185 Ga0105248_10411918 3300009177 Bacteria 1522
186 Ga0105237_10023686 3300009545 Bacteria 6286
187 Ga0105237_10037805 3300009545 Bacteria 4877
188 Ga0105237_10074608 3300009545 Bacteria 3384
189 Ga0105237_10136089 3300009545 Bacteria 2451
190 Ga0105237_10172764 3300009545 Bacteria 2161
191 Ga0105238_10002218 3300009551 Bacteria 19604
192 Ga0105238_10115316 3300009551 Bacteria 2666
193 Ga0105249_10134532 3300009553 Bacteria 2364
194 Ga0105239_10020594 3300010375 Bacteria 7277
195 Ga0105239_10026356 3300010375 Bacteria 6397
196 Ga0105239_10356491 3300010375 Unclassified 1651
197 Ga0105246_10020614 3300011119 Bacteria 4230
198 Ga0157373_10008984 3300013100 Bacteria 7394
199 Ga0157371_10005140 3300013102 Bacteria 11159
200 Ga0157370_10025118 3300013104 Bacteria 5898
201 Ga0157370_10191852 3300013104 Bacteria 1896
202 Ga0157369_10000133 3300013105 Bacteria 105997
203 Ga0157369_10002110 3300013105 Bacteria 23979
204 Ga0157369_10033265 3300013105 Bacteria 5666
205 Ga0157369_10100107 3300013105 Bacteria 3090
206 Ga0157369_10112958 3300013105 Bacteria 2886
207 Ga0157374_10000812 3300013296 Bacteria 27383
208 Ga0157374_10002896 3300013296 Bacteria 14389
209 Ga0157378_10000023 3300013297 Bacteria 129977
210 Ga0157378_10000291 3300013297 Bacteria 49026
211 Ga0157378_10288619 3300013297 Bacteria 1584
212 Ga0163162_10087315 3300013306 Bacteria 3197
213 Ga0163162_10087748 3300013306 Bacteria 3190
214 Ga0157372_10002040 3300013307 Bacteria 21959
215 Ga0157372_10003103 3300013307 Bacteria 17900
216 Ga0157372_10006261 3300013307 Bacteria 12659
217 Ga0157372_10007576 3300013307 Bacteria 11544
218 Ga0157372_10009330 3300013307 Bacteria 10440
219 Ga0157372_10012968 3300013307 Bacteria 8889
220 Ga0157372_10023137 3300013307 Bacteria 6733
221 Ga0157372_10101016 3300013307 Bacteria 3292
222 Ga0157372_10286866 3300013307 Bacteria 1914
223 Ga0157375_10145730 3300013308 Bacteria 2499
224 Ga0157375_10381710 3300013308 Bacteria 1576
225 Ga0163163_10002263 3300014325 Bacteria 16230
226 Ga0157380_10063818 3300014326 Bacteria 2954
227 Ga0157377_10011251 3300014745 Bacteria 4460
228 Ga0157379_10015269 3300014968 Bacteria 6736
229 Ga0157376_10002940 3300014969 Bacteria 11697
230 Ga0157376_10003681 3300014969 Bacteria 10583
231 Ga0157376_10046353 3300014969 Bacteria 3585
232 Ga0157376_10049857 3300014969 Bacteria 3470
233 Ga0157376_10152250 3300014969 Bacteria 2087
234 Ga0182007_10020489 3300015262 Bacteria 2363
235 Ga0163161_10027836 3300017792 Bacteria 4010
236 Ga0224570_100172 3300022730 Bacteria 4444
237 Ga0224569_100080 3300022732 Bacteria 6418
238 Ga0224572_1004107 3300024225 Bacteria 2511
239 Ga0228598_1000805 3300024227 Bacteria 6765
240 Ga0228598_1007115 3300024227 Bacteria 2292
241 Ga0207697_10005710 3300025315 Bacteria 5738
242 Ga0207656_10002411 3300025321 Bacteria 6295
243 Ga0207692_10016675 3300025898 Bacteria 3260
244 Ga0207642_10012896 3300025899 Bacteria 3032
245 Ga0207710_10018653 3300025900 Bacteria 2953
246 Ga0207688_10017845 3300025901 Bacteria 3862
247 Ga0207680_10101206 3300025903 Bacteria 1852
248 Ga0207647_10001155 3300025904 Bacteria 20341
249 Ga0207685_10031429 3300025905 Bacteria 1901
250 Ga0207699_10008043 3300025906 Bacteria 5181
251 Ga0207699_10008054 3300025906 Bacteria 5179
252 Ga0207699_10255358 3300025906 Bacteria 1210
253 Ga0207645_10000656 3300025907 Bacteria 28723
254 Ga0207684_10000229 3300025910 Bacteria 85591
255 Ga0207684_10073602 3300025910 Bacteria 2902
256 Ga0207654_10054896 3300025911 Bacteria 2304
257 Ga0207707_10002372 3300025912 Bacteria 16975
258 Ga0207695_10002410 3300025913 Bacteria 27685
259 Ga0207695_10021527 3300025913 Bacteria 7353
260 Ga0207695_10257392 3300025913 Bacteria 1644
261 Ga0207671_10076298 3300025914 Bacteria 2508
262 Ga0207671_10088446 3300025914 Bacteria 2330
263 Ga0207693_10000047 3300025915 Bacteria 100876
264 Ga0207693_10000050 3300025915 Bacteria 100076
265 Ga0207693_10003903 3300025915 Bacteria 12694
266 Ga0207693_10014124 3300025915 Bacteria 6430
267 Ga0207693_10030897 3300025915 Bacteria 4231
268 Ga0207663_10000679 3300025916 Bacteria 15066
269 Ga0207663_10011996 3300025916 Bacteria 4672
270 Ga0207663_10058042 3300025916 Bacteria 2441
271 Ga0207663_10076949 3300025916 Unclassified 2170
272 Ga0207663_10287084 3300025916 Bacteria 1224
273 Ga0207660_10207773 3300025917 Bacteria 1532
274 Ga0207662_10015593 3300025918 Unclassified 4278
275 Ga0207657_10001040 3300025919 Bacteria 29368
276 Ga0207649_10001970 3300025920 Bacteria 11707
277 Ga0207652_10006609 3300025921 Bacteria 9345
278 Ga0207646_10001797 3300025922 Bacteria 25930
279 Ga0207646_10036984 3300025922 Bacteria 4403
280 Ga0207646_10327313 3300025922 Bacteria 1384
281 Ga0207681_10049624 3300025923 Bacteria 2837
282 Ga0207694_10007077 3300025924 Bacteria 8520
283 Ga0207694_10342717 3300025924 Unclassified 1236
284 Ga0207650_10000053 3300025925 Bacteria 164599
285 Ga0207650_10184981 3300025925 Bacteria 1662
286 Ga0207659_10061656 3300025926 Bacteria 2704
287 Ga0207687_10113302 3300025927 Bacteria 2017
288 Ga0207700_10000069 3300025928 Bacteria 63176
289 Ga0207700_10000828 3300025928 Bacteria 17894
290 Ga0207700_10013515 3300025928 Bacteria 5316
291 Ga0207700_10022713 3300025928 Bacteria 4308
292 Ga0207700_10031641 3300025928 Bacteria 3762
293 Ga0207700_10097710 3300025928 Bacteria 2334
294 Ga0207700_10114211 3300025928 Bacteria 2178
295 Ga0207700_10148055 3300025928 Bacteria 1937
296 Ga0207700_10203517 3300025928 Unclassified 1669
297 Ga0207700_10352064 3300025928 Bacteria 1283
298 Ga0207700_10566883 3300025928 Unclassified 1009
299 Ga0207664_10000483 3300025929 Bacteria 28328
300 Ga0207664_10009056 3300025929 Bacteria 6972
301 Ga0207664_10059477 3300025929 Bacteria 3043
302 Ga0207664_10083637 3300025929 Bacteria 2602
303 Ga0207664_10097323 3300025929 Bacteria 2424
304 Ga0207664_10164850 3300025929 Bacteria 1892
305 Ga0207664_10548868 3300025929 Unclassified 1037
306 Ga0207644_10023832 3300025931 Bacteria 4196
307 Ga0207644_10144709 3300025931 Bacteria 1834
308 Ga0207690_10057690 3300025932 Bacteria 2624
309 Ga0207706_10000229 3300025933 Bacteria 61238
310 Ga0207670_10030583 3300025936 Bacteria 3440
311 Ga0207669_10052455 3300025937 Bacteria 2450
312 Ga0207665_10004295 3300025939 Bacteria 9474
313 Ga0207665_10026095 3300025939 Bacteria 3855
314 Ga0207665_10137992 3300025939 Bacteria 1736
315 Ga0207665_10147873 3300025939 Bacteria 1680
316 Ga0207691_10000728 3300025940 Bacteria 32517
317 Ga0207711_10011298 3300025941 Bacteria 7418
318 Ga0207711_10028227 3300025941 Bacteria 4721
319 Ga0207689_10000106 3300025942 Bacteria 68440
320 Ga0207661_10012411 3300025944 Bacteria 6190
321 Ga0207679_10000110 3300025945 Bacteria 66700
322 Ga0207667_10001768 3300025949 Bacteria 27203
323 Ga0207667_10016459 3300025949 Bacteria 8356
324 Ga0207667_10047455 3300025949 Bacteria 4546
325 Ga0207651_10258001 3300025960 Bacteria 1429
326 Ga0207712_10082930 3300025961 Bacteria 2338
327 Ga0207658_10005683 3300025986 Bacteria 8527
328 Ga0207677_10014683 3300026023 Bacteria 4583
329 Ga0207677_10028618 3300026023 Bacteria 3527
330 Ga0207703_10042236 3300026035 Bacteria 3657
331 Ga0207703_10057157 3300026035 Bacteria 3180
332 Ga0207639_10071585 3300026041 Bacteria 2712
333 Ga0207639_10148946 3300026041 Bacteria 1958
334 Ga0207678_10001229 3300026067 Bacteria 23586
335 Ga0207702_10001329 3300026078 Bacteria 24736
336 Ga0207702_10005470 3300026078 Bacteria 11109
337 Ga0207702_10035207 3300026078 Unclassified 4186
338 Ga0207702_10044942 3300026078 Bacteria 3714
339 Ga0207702_10216073 3300026078 Bacteria 1785
340 Ga0207702_10239169 3300026078 Bacteria 1700
341 Ga0207641_10000104 3300026088 Bacteria 122307
342 Ga0207641_10014494 3300026088 Bacteria 6460
343 Ga0207676_10000288 3300026095 Bacteria 43440
344 Ga0207674_10000092 3300026116 Bacteria 99761
345 Ga0207674_10015673 3300026116 Bacteria 8321
346 Ga0207675_100009325 3300026118 Bacteria 9200
347 Ga0207698_10078346 3300026142 Bacteria 2653
348 Ga0209588_1000275 3300027671 Bacteria 13650
349 Ga0265354_1006485 3300028016 Unclassified 1161
350 Ga0265356_1000608 3300028017 Bacteria 6267
351 Ga0268266_10003317 3300028379 Bacteria 16159
352 Ga0268265_10002886 3300028380 Bacteria 12625
353 Ga0268264_10032774 3300028381 Bacteria 4263
354 Ga0268264_10125158 3300028381 Bacteria 2271
355 Ga0265338_10002238 3300028800 Bacteria 29484
356 Ga0265338_10024605 3300028800 Bacteria 6145
357 Ga0265762_1000378 3300030760 Bacteria 7635
358 Ga0265762_1009406 3300030760 Bacteria 1743
359 Ga0265770_1002239 3300030878 Bacteria 2632
360 Ga0265770_1005373 3300030878 Bacteria 1762
361 Ga0265765_1002679 3300030879 Unclassified 1740
362 Ga0265760_10003584 3300031090 Bacteria 4505
363 Ga0265760_10047412 3300031090 Bacteria 1290
364 Ga0265325_10011898 3300031241 Bacteria 4989
365 Ga0265339_10099160 3300031249 Bacteria 1519
366 Ga0265339_10128690 3300031249 Bacteria 1296
367 Ga0265316_10020186 3300031344 Bacteria 5677
368 Ga0265316_10033629 3300031344 Bacteria 4173
369 Ga0373923_0059979 3300035111 Bacteria 1614
370 Ga0373936_0013168 3300035113 Bacteria 3155
371 Ga0373945_0000345 3300035116 Bacteria 13252
372 Ga0373953_0140441 3300035117 Unclassified 1033
373 Ga0373956_0009018 3300035119 Bacteria 4044
374 Ga0373943_0001549 3300035170 Bacteria 10420
375 Ga0373943_0092207 3300035170 Unclassified 1571
376 Ga0373946_0014558 3300035171 Bacteria 2968
377 Ga0373946_0106842 3300035171 Bacteria 1262
378 Ga0373955_0054212 3300035172 Bacteria 2192
379 Ga0373955_0253828 3300035172 Unclassified 1055
380 Ga0373924_0007505 3300035410 Bacteria 3939
381 Ga0373935_0003361 3300035692 Bacteria 9273
382 Ga0373935_0058121 3300035692 Bacteria 2469
383 Ga0373935_0176628 3300035692 Bacteria 1464
384 Ga0373927_0000300 3300035695 Bacteria 38888
385 Ga0373927_0021821 3300035695 Bacteria 4196
386 Ga0373927_0082257 3300035695 Bacteria 2087
387 Ga0373927_0111701 3300035695 Unclassified 1781
388 Ga0373933_0260880 3300035724 Bacteria 1117
389 Ga0373947_0001619 3300035725 Bacteria 13813
390 Ga0373947_0006438 3300035725 Bacteria 6822
391 Ga0373947_0205404 3300035725 Unclassified 1290
392 Ga0373937_0030154 3300036401 Bacteria 4913
393 Ga0373937_0154365 3300036401 Bacteria 2151
394 Ga0373937_0228061 3300036401 Bacteria 1754
395 Ga0373937_0275478 3300036401 Bacteria 1588
396 Ga0373925_0000279 3300037068 Bacteria 53371
397 Ga0373925_0002512 3300037068 Bacteria 14655
398 Ga0373925_0023043 3300037068 Bacteria 4544
399 Ga0373925_0431968 3300037068 Bacteria 1077
400 Ga0436364_1006062 3300037853 Bacteria 3050
401 Ga0436363_0716994 3300039450 Bacteria 2873
402 Ga0436362_0753973 3300039453 Bacteria 8413
403 Ga0466966_0323450 3300044684 Bacteria 927
404 Ga0466964_0066649 3300044706 Unclassified 1511
405 Ga0466967_0230276 3300045976 Bacteria 1764
406 Ga0466967_0359869 3300045976 Unclassified 1410
407 Ga0495590_0039097 3300046457 Unclassified 1655
408 Ga0495651_0267739 3300046462 Bacteria 1160
409 Ga0495580_0000206 3300046472 Bacteria 45509
410 Ga0495580_0002259 3300046472 Bacteria 16819
411 Ga0495580_0091793 3300046472 Bacteria 2113
412 Ga0495582_0000677 3300046473 Bacteria 18749
413 Ga0495630_0071554 3300046517 Bacteria 2610
414 Ga0495630_0192127 3300046517 Bacteria 1557
415 Ga0495630_0263459 3300046517 Bacteria 1317
416 Ga0495630_0534088 3300046517 Unclassified 899
417 Ga0495666_0037892 3300046526 Bacteria 2345
418 Ga0495665_0007648 3300046531 Bacteria 5849
419 Ga0495665_0096477 3300046531 Bacteria 1553
420 Ga0495665_0185238 3300046531 Bacteria 1081
421 Ga0495604_0344156 3300047317 Bacteria 992
422 Ga0495674_0095164 3300047319 Bacteria 2540
423 Ga0495674_0110088 3300047319 Bacteria 2336
424 Ga0495674_0116038 3300047319 Bacteria 2265
425 Ga0495674_0213586 3300047319 Unclassified 1597
426 Ga0495675_0034804 3300047444 Bacteria 3216
427 Ga0495602_0052293 3300048088 Bacteria 3630
428 Ga0495602_0153169 3300048088 Bacteria 1809
429 Ga0495602_0154001 3300048088 Bacteria 1803
430 Ga0495614_0112379 3300048089 Unclassified 1197
431 Ga0496101_0255270 3300048904 Bacteria 1367
432 Ga0496103_0067054 3300048906 Bacteria 2241
433 Ga0496104_0450825 3300048907 Bacteria 1198
434 Ga0496107_0072493 3300048910 Bacteria 2504
435 Ga0496108_0000129 3300048911 Bacteria 74408
436 Ga0496109_0000124 3300048912 Bacteria 78766
437 Ga0496110_0002198 3300048913 Bacteria 14571
438 Ga0496111_0029223 3300048914 Bacteria 3913
439 Ga0496112_0000109 3300048915 Bacteria 51364
440 Ga0496112_0003682 3300048915 Bacteria 12780
441 Ga0496112_0009094 3300048915 Bacteria 8927
442 Ga0496113_0001117 3300048916 Bacteria 14559
443 Ga0496113_0249479 3300048916 Bacteria 1417
444 Ga0496115_0003383 3300048918 Bacteria 11447
445 Ga0501031_0000340 3300049568 Bacteria 27085
446 Ga0501031_0003318 3300049568 Bacteria 10326
447 Ga0501032_0014722 3300049569 Bacteria 5535
448 Ga0501032_0098778 3300049569 Bacteria 1934
449 Ga0501036_0021460 3300049572 Bacteria 5430
450 Ga0501037_0005782 3300049573 Bacteria 9033
451 Ga0501037_0007939 3300049573 Bacteria 7775
452 Ga0501038_0004170 3300049574 Bacteria 13442
453 Ga0501039_0000324 3300049575 Bacteria 33955
454 Ga0501039_0003394 3300049575 Bacteria 11907
455 Ga0501040_0005381 3300049576 Bacteria 8279
456 Ga0501040_0094288 3300049576 Bacteria 2082
457 Ga0501041_0009428 3300049577 Bacteria 5755
458 Ga0501041_0051776 3300049577 Bacteria 2502
459 Ga0501042_0005007 3300049578 Bacteria 8486
460 Ga0501042_0010084 3300049578 Bacteria 6317
461 Ga0501043_0119157 3300049579 Bacteria 2070
462 Ga0501046_0000857 3300049580 Bacteria 29579
463 Ga0501046_0003690 3300049580 Bacteria 14028
464 Ga0501048_0006194 3300049582 Bacteria 9103
465 Ga0501071_0060441 3300049587 Bacteria 2743
466 Ga0501072_0111939 3300049588 Bacteria 2173
467 Ga0501072_0285625 3300049588 Bacteria 1312
468 Ga0501074_0070451 3300049590 Bacteria 2514
469 Ga0501075_0073541 3300049591 Bacteria 2585
470 Ga0501076_0017046 3300049592 Bacteria 5516
471 Ga0501079_0079890 3300049741 Bacteria 2529
472 Ga0501035_0004990 3300049822 Bacteria 12571
473 Ga0501045_0192856 3300049824 Bacteria 1518
474 nmdc:mga0n895_4994_c1 3300050512 Bacteria 11003
475 nmdc:mga0rr50_1309_c1 3300050513 Bacteria 13581
476 nmdc:mga0rr50_27647_c1 3300050513 Bacteria 3975
477 nmdc:mga0rr50_356_c1 3300050513 Bacteria 24892
478 nmdc:mga08x19_1564_c1 3300050514 Bacteria 14197
479 nmdc:mga0a205_4620_c1 3300050515 Bacteria 12345
480 Ga0495619_0282233 3300053085 Bacteria 1151
481 Ga0501084_0327531 3300054114 Bacteria 1294
482 Ga0157372_10052187
483 MBSR1b_contig_9152771
484 LJNas_1000035
485 JGI24741J21665_1009632
486 JGI24752J21851_1000681
487 JGI24737J22298_10005894
488 JGI24743J22301_10000140
489 JGI24748J21848_1001088
490 JGI24034J26672_10001099
491 JGI24751J29686_10001011
492 Ga0065712_10095011
493 Ga0070658_10007968
494 Ga0070683_100113596
495 Ga0070670_100128612
496 Ga0070670_100238362
497 Ga0070666_10048630
498 Ga0070666_10175906
499 Ga0070680_100041430
500 Ga0070680_100057895
501 Ga0070680_100161320
502 Ga0070682_100012310
503 Ga0068868_100024126
504 Ga0068868_100227666
505 Ga0070660_100004713
506 Ga0070661_100033920
507 Ga0070668_100007721
508 Ga0070669_100006650
509 Ga0070675_100180811
510 Ga0070671_100064135
511 Ga0070673_100102446
512 Ga0070673_100535778
513 Ga0070688_100000704
514 Ga0070659_100003190
515 Ga0070709_10003408
516 Ga0070709_10056868
517 Ga0070709_10131674
518 Ga0070714_100000458
519 Ga0070714_100149357
520 Ga0070714_100312863
521 Ga0070714_100319767
522 Ga0070714_100514105
523 Ga0070713_100000021
524 Ga0070713_100000387
525 Ga0070713_100015849
526 Ga0070713_100020435
527 Ga0070713_100042864
528 Ga0070713_100045088
529 Ga0070713_100052228
530 Ga0070713_100053557
531 Ga0070713_100078282
532 Ga0070713_100094298
533 Ga0070713_100164443
534 Ga0070713_100190396
535 Ga0070710_10035715
536 Ga0070710_10046946
537 Ga0070711_100000213
538 Ga0070711_100000248
539 Ga0070711_100002260
540 Ga0070711_100092350
541 Ga0070711_100094017
542 Ga0070711_100193177
543 Ga0070708_100000532
544 Ga0070708_100043305
545 Ga0070663_100069629
546 Ga0070662_100186833
547 Ga0070662_100237560
548 Ga0070681_10000893
549 Ga0070681_10083868
550 Ga0070681_10119423
551 Ga0068867_100035486
552 Ga0070685_10004079
553 Ga0070706_100000534
554 Ga0070706_100100544
555 Ga0070706_100151958
556 Ga0070707_100000558
557 Ga0070707_100121657
558 Ga0070707_100339064
559 Ga0070698_100000989
560 Ga0070698_100061979
561 Ga0070699_100001581
562 Ga0070699_100132393
563 Ga0070679_100008906
564 Ga0070679_100080060
565 Ga0070679_100597710
566 Ga0070684_100007319
567 Ga0070684_100049838
568 Ga0070684_100110463
569 Ga0070697_100000045
570 Ga0070697_100000241
571 Ga0070697_100003698
572 Ga0068853_100043151
573 Ga0068853_100098634
574 Ga0070672_100002788
575 Ga0068855_100000785
576 Ga0070664_100025165
577 Ga0068857_100017337
578 Ga0068854_100033657
579 Ga0068854_100048113
580 Ga0068854_100065804
581 Ga0068854_100283844
582 Ga0068856_100001627
583 Ga0068856_100001628
584 Ga0068856_100009846
585 Ga0068856_100016266
586 Ga0068856_100024387
587 Ga0068856_100185623
588 Ga0068856_100251539
589 Ga0068856_100264945
590 Ga0068852_100088961
591 Ga0068859_100117914
592 Ga0068864_100008949
593 Ga0068866_10003545
594 Ga0068866_10019450
595 Ga0068851_10007704
596 Ga0068870_10001697
597 Ga0068863_100009907
598 Ga0068863_100013923
599 Ga0068863_100100778
600 Ga0068858_100012851
601 Ga0068858_100064147
602 Ga0068860_100032222
603 Ga0068860_100090942
604 Ga0068860_100100035
605 Ga0068862_100080732
606 Ga0068862_100115533
607 Ga0070717_10002716
608 Ga0070717_10017085
609 Ga0070717_10024264
610 Ga0070717_10054635
611 Ga0070717_10065583
612 Ga0070717_10161392
613 Ga0070717_10170375
614 Ga0070717_10179600
615 Ga0070717_10215719
616 Ga0070717_10432234
617 Ga0070715_10000351
618 Ga0070715_10036291
619 Ga0070715_10123915
620 Ga0070716_100016402
621 Ga0070716_100025589
622 Ga0070716_100102908
623 Ga0070716_100177429
624 Ga0070716_100297312
625 Ga0070712_100000509
626 Ga0070712_100000556
627 Ga0070712_100000601
628 Ga0070712_100002473
629 Ga0070712_100024385
630 Ga0070712_100033177
631 Ga0070712_100251292
632 Ga0097621_100000715
633 Ga0097621_100001284
634 Ga0097621_100035397
635 Ga0097621_100075895
636 Ga0097621_100143926
637 Ga0068871_100001334
638 Ga0068871_100077798
639 Ga0068871_100085589
640 Ga0068871_100096958
641 Ga0075433_10003377
642 Ga0075434_100000585
643 Ga0068865_100081788
644 Ga0075436_100003816
645 Ga0075436_100006611
646 Ga0097620_100117915
647 Ga0075435_100000769
648 Ga0075435_100005998
649 Ga0099794_10003820
650 Ga0105240_10018728
651 Ga0105240_10021080
652 Ga0105240_10023633
653 Ga0105240_10050573
654 Ga0105240_10308232
655 Ga0105240_10393420
656 Ga0105245_10001518
657 Ga0105245_10013328
658 Ga0105247_10003571
659 Ga0105241_10000584
660 Ga0105241_10104689
661 Ga0105242_10012582
662 Ga0105242_10038000
663 Ga0105248_10010549
664 Ga0105248_10010729
665 Ga0105248_10012550
666 Ga0105248_10411918
667 Ga0105237_10023686
668 Ga0105237_10037805
669 Ga0105237_10074608
670 Ga0105237_10136089
671 Ga0105237_10172764
672 Ga0105238_10002218
673 Ga0105238_10115316
674 Ga0105249_10134532
675 Ga0105239_10020594
676 Ga0105239_10026356
677 Ga0105239_10356491
678 Ga0105246_10020614
679 Ga0157373_10008984
680 Ga0157371_10005140
681 Ga0157370_10025118
682 Ga0157370_10191852
683 Ga0157369_10000133
684 Ga0157369_10002110
685 Ga0157369_10033265
686 Ga0157369_10100107
687 Ga0157369_10112958
688 Ga0157374_10000812
689 Ga0157374_10002896
690 Ga0157378_10000023
691 Ga0157378_10000291
692 Ga0157378_10288619
693 Ga0163162_10087315
694 Ga0163162_10087748
695 Ga0157372_10002040
696 Ga0157372_10003103
697 Ga0157372_10006261
698 Ga0157372_10007576
699 Ga0157372_10009330
700 Ga0157372_10012968
701 Ga0157372_10023137
702 Ga0157372_10101016
703 Ga0157372_10286866
704 Ga0157375_10145730
705 Ga0157375_10381710
706 Ga0163163_10002263
707 Ga0157380_10063818
708 Ga0157377_10011251
709 Ga0157379_10015269
710 Ga0157376_10002940
711 Ga0157376_10003681
712 Ga0157376_10046353
713 Ga0157376_10049857
714 Ga0157376_10152250
715 Ga0182007_10020489
716 Ga0163161_10027836
717 Ga0224570_100172
718 Ga0224569_100080
719 Ga0224572_1004107
720 Ga0228598_1000805
721 Ga0228598_1007115
722 Ga0207697_10005710
723 Ga0207656_10002411
724 Ga0207692_10016675
725 Ga0207642_10012896
726 Ga0207710_10018653
727 Ga0207688_10017845
728 Ga0207680_10101206
729 Ga0207647_10001155
730 Ga0207685_10031429
731 Ga0207699_10008043
732 Ga0207699_10008054
733 Ga0207699_10255358
734 Ga0207645_10000656
735 Ga0207684_10000229
736 Ga0207684_10073602
737 Ga0207654_10054896
738 Ga0207707_10002372
739 Ga0207695_10002410
740 Ga0207695_10021527
741 Ga0207695_10257392
742 Ga0207671_10076298
743 Ga0207671_10088446
744 Ga0207693_10000047
745 Ga0207693_10000050
746 Ga0207693_10003903
747 Ga0207693_10014124
748 Ga0207693_10030897
749 Ga0207663_10000679
750 Ga0207663_10011996
751 Ga0207663_10058042
752 Ga0207663_10076949
753 Ga0207663_10287084
754 Ga0207660_10207773
755 Ga0207662_10015593
756 Ga0207657_10001040
757 Ga0207649_10001970
758 Ga0207652_10006609
759 Ga0207646_10001797
760 Ga0207646_10036984
761 Ga0207646_10327313
762 Ga0207681_10049624
763 Ga0207694_10007077
764 Ga0207694_10342717
765 Ga0207650_10000053
766 Ga0207650_10184981
767 Ga0207659_10061656
768 Ga0207687_10113302
769 Ga0207700_10000069
770 Ga0207700_10000828
771 Ga0207700_10013515
772 Ga0207700_10022713
773 Ga0207700_10031641
774 Ga0207700_10097710
775 Ga0207700_10114211
776 Ga0207700_10148055
777 Ga0207700_10203517
778 Ga0207700_10352064
779 Ga0207700_10566883
780 Ga0207664_10000483
781 Ga0207664_10009056
782 Ga0207664_10059477
783 Ga0207664_10083637
784 Ga0207664_10097323
785 Ga0207664_10164850
786 Ga0207664_10548868
787 Ga0207644_10023832
788 Ga0207644_10144709
789 Ga0207690_10057690
790 Ga0207706_10000229
791 Ga0207670_10030583
792 Ga0207669_10052455
793 Ga0207665_10004295
794 Ga0207665_10026095
795 Ga0207665_10137992
796 Ga0207665_10147873
797 Ga0207691_10000728
798 Ga0207711_10011298
799 Ga0207711_10028227
800 Ga0207689_10000106
801 Ga0207661_10012411
802 Ga0207679_10000110
803 Ga0207667_10001768
804 Ga0207667_10016459
805 Ga0207667_10047455
806 Ga0207651_10258001
807 Ga0207712_10082930
808 Ga0207658_10005683
809 Ga0207677_10014683
810 Ga0207677_10028618
811 Ga0207703_10042236
812 Ga0207703_10057157
813 Ga0207639_10071585
814 Ga0207639_10148946
815 Ga0207678_10001229
816 Ga0207702_10001329
817 Ga0207702_10005470
818 Ga0207702_10035207
819 Ga0207702_10044942
820 Ga0207702_10216073
821 Ga0207702_10239169
822 Ga0207641_10000104
823 Ga0207641_10014494
824 Ga0207676_10000288
825 Ga0207674_10000092
826 Ga0207674_10015673
827 Ga0207675_100009325
828 Ga0207698_10078346
829 Ga0209588_1000275
830 Ga0265354_1006485
831 Ga0265356_1000608
832 Ga0268266_10003317
833 Ga0268265_10002886
834 Ga0268264_10032774
835 Ga0268264_10125158
836 Ga0265338_10002238
837 Ga0265338_10024605
838 Ga0265762_1000378
839 Ga0265762_1009406
840 Ga0265770_1002239
841 Ga0265770_1005373
842 Ga0265765_1002679
843 Ga0265760_10003584
844 Ga0265760_10047412
845 Ga0265325_10011898
846 Ga0265339_10099160
847 Ga0265339_10128690
848 Ga0265316_10020186
849 Ga0265316_10033629
850 Ga0373923_0059979
851 Ga0373936_0013168
852 Ga0373945_0000345
853 Ga0373953_0140441
854 Ga0373956_0009018
855 Ga0373943_0001549
856 Ga0373943_0092207
857 Ga0373946_0014558
858 Ga0373946_0106842
859 Ga0373955_0054212
860 Ga0373955_0253828
861 Ga0373924_0007505
862 Ga0373935_0003361
863 Ga0373935_0058121
864 Ga0373935_0176628
865 Ga0373927_0000300
866 Ga0373927_0021821
867 Ga0373927_0082257
868 Ga0373927_0111701
869 Ga0373933_0260880
870 Ga0373947_0001619
871 Ga0373947_0006438
872 Ga0373947_0205404
873 Ga0373937_0030154
874 Ga0373937_0154365
875 Ga0373937_0228061
876 Ga0373937_0275478
877 Ga0373925_0000279
878 Ga0373925_0002512
879 Ga0373925_0023043
880 Ga0373925_0431968
881 Ga0436364_1006062
882 Ga0436363_0716994
883 Ga0436362_0753973
884 Ga0466966_0323450
885 Ga0466964_0066649
886 Ga0466967_0230276
887 Ga0466967_0359869
888 Ga0495590_0039097
889 Ga0495651_0267739
890 Ga0495580_0000206
891 Ga0495580_0002259
892 Ga0495580_0091793
893 Ga0495582_0000677
894 Ga0495630_0071554
895 Ga0495630_0192127
896 Ga0495630_0263459
897 Ga0495630_0534088
898 Ga0495666_0037892
899 Ga0495665_0007648
900 Ga0495665_0096477
901 Ga0495665_0185238
902 Ga0495604_0344156
903 Ga0495674_0095164
904 Ga0495674_0110088
905 Ga0495674_0116038
906 Ga0495674_0213586
907 Ga0495675_0034804
908 Ga0495602_0052293
909 Ga0495602_0153169
910 Ga0495602_0154001
911 Ga0495614_0112379
912 Ga0496101_0255270
913 Ga0496103_0067054
914 Ga0496104_0450825
915 Ga0496107_0072493
916 Ga0496108_0000129
917 Ga0496109_0000124
918 Ga0496110_0002198
919 Ga0496111_0029223
920 Ga0496112_0000109
921 Ga0496112_0003682
922 Ga0496112_0009094
923 Ga0496113_0001117
924 Ga0496113_0249479
925 Ga0496115_0003383
926 Ga0501031_0000340
927 Ga0501031_0003318
928 Ga0501032_0014722
929 Ga0501032_0098778
930 Ga0501036_0021460
931 Ga0501037_0005782
932 Ga0501037_0007939
933 Ga0501038_0004170
934 Ga0501039_0000324
935 Ga0501039_0003394
936 Ga0501040_0005381
937 Ga0501040_0094288
938 Ga0501041_0009428
939 Ga0501041_0051776
940 Ga0501042_0005007
941 Ga0501042_0010084
942 Ga0501043_0119157
943 Ga0501046_0000857
944 Ga0501046_0003690
945 Ga0501048_0006194
946 Ga0501071_0060441
947 Ga0501072_0111939
948 Ga0501072_0285625
949 Ga0501074_0070451
950 Ga0501075_0073541
951 Ga0501076_0017046
952 Ga0501079_0079890
953 Ga0501035_0004990
954 Ga0501045_0192856
955 nmdc:mga0n895_4994_c1
956 nmdc:mga0rr50_1309_c1
957 nmdc:mga0rr50_27647_c1
958 nmdc:mga0rr50_356_c1
959 nmdc:mga08x19_1564_c1
960 nmdc:mga0a205_4620_c1
961 Ga0495619_0282233
962 Ga0501084_0327531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

47

324

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

75

183

0.95

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

49

255

0.86

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

78

196

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.974 1 278
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9705 1 278
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9692 2 275
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9587 2 275
3sc6-assembly2.cif.gz_B 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.956 2 275
ID Description Score Start End Superfamily
1vl0C02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9661 157 274 3.90.25.10
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9478 2 207 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9293 1 276 3.40.50.720
af_A0A1D6HPY3_156_346_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 102 274 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9197 1 276 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A845TX95-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.992 1 277 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A2V9UV66-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9899 1 277 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A7J5W8R0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9865 52 276 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A315ZSX1-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9863 1 274 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A845TX95-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9849 1 277 GO:0005829
GO:0008831
GO:0019305
GO:0045226

Map