F452266

General Info

Members Datasets Scaffolds Average Seq Length
480 224 960 66

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_2578539|Ga0451576_2578539_75_293
Length 72
Sequence MEPGDTDVGLKSFHLFFIAMSVILAAFTTAWSVTQYQAAPGANYLATGAVSALAGAALIVYGIKFQRRSARL

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.75
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 20.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_2578539 3300045051 Bacteria 518
2 Ga0058863_11729973 3300004799 Bacteria 1374
3 Ga0058863_11755142 3300004799 Bacteria 1012
4 Ga0058861_11530950 3300004800 Bacteria 681
5 Ga0058862_10011738 3300004803 Bacteria 1777
6 Ga0065712_10068138 3300005290 Bacteria 14057
7 Ga0065712_10603003 3300005290 Bacteria 589
8 Ga0065715_10127942 3300005293 Bacteria 2076
9 Ga0065715_10226643 3300005293 Bacteria 1250
10 Ga0065715_10268030 3300005293 Bacteria 1119
11 Ga0065715_10720516 3300005293 Bacteria 644
12 Ga0065707_10018539 3300005295 Bacteria 2200
13 Ga0065707_10172434 3300005295 Bacteria 1475
14 Ga0070658_11652700 3300005327 Bacteria 555
15 Ga0070676_10058633 3300005328 Bacteria 2282
16 Ga0070676_10727440 3300005328 Unclassified 727
17 Ga0070683_100763857 3300005329 Bacteria 926
18 Ga0070670_100108148 3300005331 Unclassified 2396
19 Ga0070670_100509237 3300005331 Bacteria 1071
20 Ga0070670_102085359 3300005331 Bacteria 522
21 Ga0068869_100926329 3300005334 Unclassified 755
22 Ga0068869_101373697 3300005334 Unclassified 625
23 Ga0070680_100068878 3300005336 Bacteria 2905
24 Ga0070680_100385219 3300005336 Bacteria 1194
25 Ga0070680_101435093 3300005336 Unclassified 598
26 Ga0070682_100022409 3300005337 Bacteria 3741
27 Ga0070682_100188575 3300005337 Bacteria 1446
28 Ga0068868_100139802 3300005338 Bacteria 1987
29 Ga0068868_100151003 3300005338 Bacteria 1913
30 Ga0068868_100552834 3300005338 Bacteria 1015
31 Ga0068868_100580591 3300005338 Bacteria 991
32 Ga0068868_100756185 3300005338 Bacteria 874
33 Ga0068868_100946745 3300005338 Unclassified 785
34 Ga0068868_102071493 3300005338 Bacteria 541
35 Ga0070660_100043306 3300005339 Bacteria 3440
36 Ga0070660_100201902 3300005339 Bacteria 1613
37 Ga0070689_101849889 3300005340 Unclassified 551
38 Ga0070691_10800362 3300005341 Unclassified 574
39 Ga0070661_100180735 3300005344 Bacteria 1605
40 Ga0070668_100193989 3300005347 Bacteria 1665
41 Ga0070668_100208643 3300005347 Bacteria 1606
42 Ga0070668_101477117 3300005347 Bacteria 621
43 Ga0070669_100053128 3300005353 Bacteria 2965
44 Ga0070669_101037296 3300005353 Bacteria 705
45 Ga0070669_101408032 3300005353 Unclassified 605
46 Ga0070669_101789907 3300005353 Viruses 536
47 Ga0070675_100581764 3300005354 Bacteria 1014
48 Ga0070671_100164038 3300005355 Bacteria 1878
49 Ga0070671_101648399 3300005355 Bacteria 569
50 Ga0070674_100222142 3300005356 Unclassified 1470
51 Ga0070673_100071637 3300005364 Bacteria 2785
52 Ga0070673_100314590 3300005364 Bacteria 1382
53 Ga0070673_100519255 3300005364 Bacteria 1079
54 Ga0070688_100125104 3300005365 Unclassified 1727
55 Ga0070688_100173387 3300005365 Bacteria 1490
56 Ga0070659_100462281 3300005366 Bacteria 1078
57 Ga0070659_100513808 3300005366 Unclassified 1022
58 Ga0070710_10583381 3300005437 Bacteria 776
59 Ga0070701_10818216 3300005438 Bacteria 637
60 Ga0070701_10959129 3300005438 Bacteria 594
61 Ga0070705_100617303 3300005440 Unclassified 841
62 Ga0070700_100911703 3300005441 Bacteria 716
63 Ga0070694_100013422 3300005444 Bacteria 5115
64 Ga0070708_101405133 3300005445 Unclassified 651
65 Ga0070708_101794373 3300005445 Bacteria 569
66 Ga0070663_100996616 3300005455 Bacteria 728
67 Ga0070663_101290457 3300005455 Bacteria 644
68 Ga0070663_101652617 3300005455 Bacteria 572
69 Ga0070678_100335578 3300005456 Bacteria 1295
70 Ga0070681_10096194 3300005458 Bacteria 2910
71 Ga0070681_10131107 3300005458 Bacteria 2439
72 Ga0070681_10717508 3300005458 Bacteria 916
73 Ga0068867_100186083 3300005459 Bacteria 1654
74 Ga0068867_100286765 3300005459 Bacteria 1352
75 Ga0068867_101622944 3300005459 Unclassified 605
76 Ga0070685_10359941 3300005466 Bacteria 997
77 Ga0070706_100274232 3300005467 Bacteria 1574
78 Ga0070706_102026538 3300005467 Unclassified 521
79 Ga0070707_100121089 3300005468 Bacteria 2541
80 Ga0070707_100250411 3300005468 Bacteria 1724
81 Ga0070707_101176476 3300005468 Unclassified 733
82 Ga0070698_100026990 3300005471 Bacteria 5972
83 Ga0070698_100469264 3300005471 Bacteria 1195
84 Ga0070699_100252524 3300005518 Bacteria 1576
85 Ga0070699_100524050 3300005518 Unclassified 1078
86 Ga0070679_100015797 3300005530 Bacteria 7262
87 Ga0070679_100017287 3300005530 Bacteria 6979
88 Ga0070679_100037637 3300005530 Bacteria 4807
89 Ga0070679_100317276 3300005530 Bacteria 1508
90 Ga0070672_100016241 3300005543 Bacteria 5325
91 Ga0070672_100313248 3300005543 Unclassified 1333
92 Ga0070672_100699775 3300005543 Bacteria 887
93 Ga0070672_100816294 3300005543 Unclassified 821
94 Ga0070686_100296220 3300005544 Bacteria 1198
95 Ga0070686_101849984 3300005544 Unclassified 515
96 Ga0070695_100003699 3300005545 Bacteria 8913
97 Ga0070695_100350344 3300005545 Bacteria 1106
98 Ga0070695_101904596 3300005545 Unclassified 500
99 Ga0070696_100064335 3300005546 Bacteria 2569
100 Ga0070696_100127485 3300005546 Bacteria 1848
101 Ga0070696_100322121 3300005546 Unclassified 1190
102 Ga0070696_100417052 3300005546 Bacteria 1053
103 Ga0070696_100710741 3300005546 Bacteria 820
104 Ga0070693_101369045 3300005547 Bacteria 549
105 Ga0070704_100020400 3300005549 Bacteria 4272
106 Ga0070704_101460885 3300005549 Unclassified 628
107 Ga0068855_100023932 3300005563 Bacteria 7314
108 Ga0068855_100331808 3300005563 Bacteria 1679
109 Ga0070664_101667472 3300005564 Bacteria 604
110 Ga0070664_101874630 3300005564 Unclassified 569
111 Ga0068857_100161381 3300005577 Bacteria 2034
112 Ga0068857_100187475 3300005577 Bacteria 1883
113 Ga0068854_100112789 3300005578 Bacteria 2053
114 Ga0068856_100428366 3300005614 Bacteria 1343
115 Ga0070702_100715207 3300005615 Bacteria 765
116 Ga0070702_101506619 3300005615 Bacteria 553
117 Ga0068852_100244313 3300005616 Bacteria 1717
118 Ga0068859_100116866 3300005617 Bacteria 2732
119 Ga0068859_100195942 3300005617 Bacteria 2105
120 Ga0068859_100442464 3300005617 Bacteria 1396
121 Ga0068859_100573098 3300005617 Bacteria 1223
122 Ga0068859_100667479 3300005617 Unclassified 1131
123 Ga0068859_100874003 3300005617 Bacteria 984
124 Ga0068859_101646651 3300005617 Unclassified 709
125 Ga0068864_100453971 3300005618 Bacteria 1226
126 Ga0068864_100542723 3300005618 Bacteria 1123
127 Ga0068864_101475696 3300005618 Bacteria 683
128 Ga0068864_102377822 3300005618 Bacteria 536
129 Ga0068864_102489722 3300005618 Bacteria 524
130 Ga0068861_100158990 3300005719 Bacteria 1862
131 Ga0068861_100620735 3300005719 Unclassified 995
132 Ga0068861_100644034 3300005719 Bacteria 978
133 Ga0068863_100079860 3300005841 Unclassified 3098
134 Ga0068863_100234144 3300005841 Bacteria 1772
135 Ga0068863_100338870 3300005841 Bacteria 1463
136 Ga0068863_101242254 3300005841 Bacteria 751
137 Ga0068863_101584446 3300005841 Bacteria 664
138 Ga0068863_102626076 3300005841 Bacteria 513
139 Ga0068858_100161492 3300005842 Unclassified 2110
140 Ga0068858_100172126 3300005842 Bacteria 2042
141 Ga0068858_100182129 3300005842 Bacteria 1984
142 Ga0068858_100292522 3300005842 Bacteria 1553
143 Ga0068858_100348855 3300005842 Bacteria 1417
144 Ga0068858_100389537 3300005842 Bacteria 1338
145 Ga0068858_100637942 3300005842 Bacteria 1035
146 Ga0068858_102352027 3300005842 Unclassified 527
147 Ga0068860_100079376 3300005843 Bacteria 3120
148 Ga0068860_100250765 3300005843 Bacteria 1724
149 Ga0068860_100416062 3300005843 Unclassified 1332
150 Ga0068860_100725367 3300005843 Bacteria 1005
151 Ga0068860_101214656 3300005843 Bacteria 774
152 Ga0068860_101596057 3300005843 Bacteria 674
153 Ga0068860_102738983 3300005843 Bacteria 511
154 Ga0068862_100143380 3300005844 Bacteria 2121
155 Ga0068862_100940443 3300005844 Bacteria 852
156 Ga0081455_10042166 3300005937 Bacteria 4006
157 Ga0070717_11790810 3300006028 Bacteria 555
158 Ga0070715_10675705 3300006163 Unclassified 614
159 Ga0097621_100213675 3300006237 Bacteria 1678
160 Ga0097621_100286538 3300006237 Bacteria 1451
161 Ga0097621_100606472 3300006237 Bacteria 1001
162 Ga0097621_101166136 3300006237 Bacteria 725
163 Ga0068871_100107765 3300006358 Bacteria 2341
164 Ga0075428_100116199 3300006844 Bacteria 2914
165 Ga0075428_100480489 3300006844 Bacteria 1330
166 Ga0075428_100727492 3300006844 Bacteria 1056
167 Ga0075428_100917232 3300006844 Bacteria 929
168 Ga0075430_100740215 3300006846 Unclassified 810
169 Ga0075433_10103062 3300006852 Bacteria 2527
170 Ga0075433_10264412 3300006852 Unclassified 1525
171 Ga0075433_10371612 3300006852 Bacteria 1263
172 Ga0075434_100021223 3300006871 Bacteria 6312
173 Ga0075434_100108885 3300006871 Bacteria 2781
174 Ga0075434_100291108 3300006871 Bacteria 1653
175 Ga0075434_100644387 3300006871 Bacteria 1078
176 Ga0075434_100881889 3300006871 Bacteria 910
177 Ga0075434_100916316 3300006871 Bacteria 891
178 Ga0075434_100965621 3300006871 Bacteria 866
179 Ga0075434_101027273 3300006871 Bacteria 838
180 Ga0075429_100388746 3300006880 Unclassified 1221
181 Ga0068865_100222078 3300006881 Bacteria 1478
182 Ga0075436_100010393 3300006914 Bacteria 6379
183 Ga0097620_100116871 3300006931 Bacteria 2732
184 Ga0097620_100195915 3300006931 Bacteria 2105
185 Ga0097620_100442529 3300006931 Bacteria 1396
186 Ga0097620_100573076 3300006931 Bacteria 1223
187 Ga0097620_100667416 3300006931 Unclassified 1131
188 Ga0097620_100873968 3300006931 Bacteria 984
189 Ga0097620_101646906 3300006931 Unclassified 709
190 Ga0075435_100022377 3300007076 Bacteria 4877
191 Ga0075435_100300095 3300007076 Bacteria 1374
192 Ga0075435_100932175 3300007076 Bacteria 758
193 Ga0099794_10424616 3300007265 Archaea 696
194 Ga0105240_10423430 3300009093 Bacteria 1495
195 Ga0105240_11876436 3300009093 Unclassified 624
196 Ga0111539_10308794 3300009094 Bacteria 1841
197 Ga0111539_10330530 3300009094 Bacteria 1774
198 Ga0111539_12058753 3300009094 Unclassified 662
199 Ga0111539_13176905 3300009094 Bacteria 530
200 Ga0105245_10338044 3300009098 Bacteria 1488
201 Ga0105245_11991908 3300009098 Unclassified 634
202 Ga0105245_12383033 3300009098 Bacteria 583
203 Ga0105247_10017382 3300009101 Bacteria 4319
204 Ga0114129_10022782 3300009147 Bacteria 8880
205 Ga0114129_10113164 3300009147 Bacteria 3742
206 Ga0114129_10114829 3300009147 Bacteria 3712
207 Ga0114129_10133655 3300009147 Bacteria 3406
208 Ga0114129_10359676 3300009147 Bacteria 1926
209 Ga0114129_10610939 3300009147 Bacteria 1412
210 Ga0114129_10778029 3300009147 Bacteria 1223
211 Ga0105243_10924509 3300009148 Bacteria 869
212 Ga0105243_11221434 3300009148 Unclassified 766
213 Ga0105241_10866044 3300009174 Bacteria 837
214 Ga0105241_11236981 3300009174 Bacteria 709
215 Ga0105242_10096165 3300009176 Bacteria 2501
216 Ga0105242_10454430 3300009176 Bacteria 1208
217 Ga0105242_12198883 3300009176 Bacteria 597
218 Ga0105248_10024770 3300009177 Bacteria 6674
219 Ga0105248_10030747 3300009177 Bacteria 5998
220 Ga0105248_10032706 3300009177 Bacteria 5809
221 Ga0105248_10089169 3300009177 Bacteria 3472
222 Ga0105248_10219667 3300009177 Bacteria 2140
223 Ga0105248_10294126 3300009177 Unclassified 1829
224 Ga0105248_10398291 3300009177 Unclassified 1550
225 Ga0105248_11859685 3300009177 Bacteria 683
226 Ga0105248_12335764 3300009177 Bacteria 609
227 Ga0105248_12814025 3300009177 Unclassified 555
228 Ga0105237_11166632 3300009545 Bacteria 777
229 Ga0105238_10414072 3300009551 Bacteria 1342
230 Ga0105238_10529330 3300009551 Bacteria 1182
231 Ga0105238_11876035 3300009551 Bacteria 632
232 Ga0105249_10281932 3300009553 Bacteria 1660
233 Ga0105249_10387892 3300009553 Bacteria 1424
234 Ga0099796_10374355 3300010159 Unclassified 619
235 Ga0105246_10301302 3300011119 Bacteria 1294
236 Ga0157374_10138351 3300013296 Bacteria 2362
237 Ga0157374_10607758 3300013296 Bacteria 1104
238 Ga0157374_11137245 3300013296 Bacteria 801
239 Ga0157378_10066721 3300013297 Bacteria 3223
240 Ga0157378_10966072 3300013297 Bacteria 885
241 Ga0157378_11198882 3300013297 Unclassified 798
242 Ga0157378_12544807 3300013297 Bacteria 564
243 Ga0157378_12850382 3300013297 Bacteria 536
244 Ga0163162_10068005 3300013306 Bacteria 3613
245 Ga0163162_10970650 3300013306 Bacteria 960
246 Ga0163162_12822687 3300013306 Bacteria 559
247 Ga0163162_13233836 3300013306 Unclassified 523
248 Ga0157372_10889709 3300013307 Bacteria 1033
249 Ga0157375_10111312 3300013308 Bacteria 2837
250 Ga0157375_10165006 3300013308 Bacteria 2359
251 Ga0157375_10923574 3300013308 Bacteria 1016
252 Ga0157375_11049439 3300013308 Bacteria 953
253 Ga0157375_11602660 3300013308 Bacteria 770
254 Ga0157375_12459114 3300013308 Unclassified 622
255 Ga0157375_13191305 3300013308 Unclassified 547
256 Ga0163163_10029543 3300014325 Bacteria 5274
257 Ga0163163_11508432 3300014325 Bacteria 733
258 Ga0163163_11660478 3300014325 Bacteria 700
259 Ga0157380_10114317 3300014326 Bacteria 2274
260 Ga0157380_11605355 3300014326 Bacteria 706
261 Ga0157377_10516322 3300014745 Bacteria 838
262 Ga0157379_10008200 3300014968 Bacteria 9072
263 Ga0157379_10043440 3300014968 Bacteria 4012
264 Ga0157376_10164451 3300014969 Bacteria 2015
265 Ga0157376_10983208 3300014969 Bacteria 866
266 Ga0163161_10134671 3300017792 Bacteria 1867
267 Ga0213876_10131823 3300021384 Bacteria 1328
268 Ga0207692_10337789 3300025898 Bacteria 926
269 Ga0207642_11135692 3300025899 Unclassified 506
270 Ga0207710_10172163 3300025900 Bacteria 1059
271 Ga0207688_10174519 3300025901 Bacteria 1279
272 Ga0207645_10091823 3300025907 Bacteria 1953
273 Ga0207645_10595195 3300025907 Bacteria 751
274 Ga0207684_10534403 3300025910 Bacteria 1004
275 Ga0207707_10073908 3300025912 Bacteria 2973
276 Ga0207707_10140018 3300025912 Bacteria 2116
277 Ga0207707_11467257 3300025912 Unclassified 542
278 Ga0207695_10284341 3300025913 Bacteria 1547
279 Ga0207663_11740537 3300025916 Bacteria 501
280 Ga0207660_10094485 3300025917 Bacteria 2222
281 Ga0207660_10140718 3300025917 Bacteria 1845
282 Ga0207660_11297239 3300025917 Unclassified 591
283 Ga0207662_10108916 3300025918 Bacteria 1725
284 Ga0207657_10043378 3300025919 Bacteria 3962
285 Ga0207657_10185837 3300025919 Bacteria 1678
286 Ga0207649_10231823 3300025920 Bacteria 1321
287 Ga0207652_10089341 3300025921 Bacteria 2705
288 Ga0207652_10166557 3300025921 Bacteria 1976
289 Ga0207652_10215250 3300025921 Bacteria 1730
290 Ga0207652_10671846 3300025921 Unclassified 925
291 Ga0207646_10101300 3300025922 Bacteria 2582
292 Ga0207646_10578118 3300025922 Bacteria 1009
293 Ga0207646_10630876 3300025922 Unclassified 961
294 Ga0207681_10009213 3300025923 Bacteria 6033
295 Ga0207681_11538885 3300025923 Viruses 557
296 Ga0207694_10205150 3300025924 Bacteria 1605
297 Ga0207650_10249277 3300025925 Bacteria 1437
298 Ga0207659_10556033 3300025926 Bacteria 976
299 Ga0207687_10663231 3300025927 Unclassified 883
300 Ga0207644_10031442 3300025931 Bacteria 3698
301 Ga0207690_10953073 3300025932 Unclassified 713
302 Ga0207690_11203965 3300025932 Bacteria 632
303 Ga0207706_10345551 3300025933 Bacteria 1294
304 Ga0207706_10599034 3300025933 Bacteria 947
305 Ga0207686_10502985 3300025934 Bacteria 940
306 Ga0207686_11321246 3300025934 Bacteria 592
307 Ga0207670_10055732 3300025936 Bacteria 2673
308 Ga0207670_11217794 3300025936 Bacteria 637
309 Ga0207669_11441873 3300025937 Bacteria 587
310 Ga0207704_10191611 3300025938 Bacteria 1488
311 Ga0207704_10384704 3300025938 Bacteria 1102
312 Ga0207704_11822530 3300025938 Unclassified 523
313 Ga0207691_10027126 3300025940 Bacteria 5374
314 Ga0207691_10367543 3300025940 Unclassified 1229
315 Ga0207691_10630847 3300025940 Bacteria 906
316 Ga0207691_10722165 3300025940 Unclassified 840
317 Ga0207711_10019243 3300025941 Bacteria 5684
318 Ga0207711_10185737 3300025941 Bacteria 1892
319 Ga0207711_10259594 3300025941 Bacteria 1596
320 Ga0207711_10378444 3300025941 Bacteria 1313
321 Ga0207711_10765891 3300025941 Unclassified 899
322 Ga0207689_10190367 3300025942 Bacteria 1693
323 Ga0207689_10549232 3300025942 Bacteria 970
324 Ga0207689_10871425 3300025942 Unclassified 760
325 Ga0207661_11412864 3300025944 Unclassified 639
326 Ga0207679_11992151 3300025945 Unclassified 529
327 Ga0207667_10073060 3300025949 Bacteria 3564
328 Ga0207651_10275714 3300025960 Bacteria 1387
329 Ga0207651_11512461 3300025960 Unclassified 604
330 Ga0207712_10348784 3300025961 Bacteria 1230
331 Ga0207712_12085096 3300025961 Unclassified 507
332 Ga0207668_10190408 3300025972 Bacteria 1625
333 Ga0207668_10853050 3300025972 Bacteria 809
334 Ga0207640_10082191 3300025981 Bacteria 2205
335 Ga0207640_11402811 3300025981 Unclassified 626
336 Ga0207640_11972443 3300025981 Unclassified 529
337 Ga0207677_10108020 3300026023 Bacteria 2065
338 Ga0207677_10324864 3300026023 Bacteria 1280
339 Ga0207677_10843022 3300026023 Bacteria 823
340 Ga0207703_10042300 3300026035 Bacteria 3654
341 Ga0207703_10088300 3300026035 Bacteria 2602
342 Ga0207703_10250595 3300026035 Bacteria 1596
343 Ga0207703_10275782 3300026035 Bacteria 1525
344 Ga0207703_10904002 3300026035 Bacteria 845
345 Ga0207703_11907126 3300026035 Unclassified 570
346 Ga0207678_11534014 3300026067 Bacteria 588
347 Ga0207702_10576783 3300026078 Bacteria 1102
348 Ga0207702_11154618 3300026078 Bacteria 769
349 Ga0207641_10002008 3300026088 Bacteria 19393
350 Ga0207641_10150847 3300026088 Bacteria 2105
351 Ga0207648_10201095 3300026089 Bacteria 1767
352 Ga0207648_10397428 3300026089 Bacteria 1248
353 Ga0207648_10473156 3300026089 Bacteria 1143
354 Ga0207648_10587326 3300026089 Bacteria 1026
355 Ga0207648_10980220 3300026089 Bacteria 791
356 Ga0207676_10036797 3300026095 Bacteria 3726
357 Ga0207676_10302538 3300026095 Bacteria 1461
358 Ga0207674_10200004 3300026116 Bacteria 1948
359 Ga0207675_100070825 3300026118 Bacteria 3259
360 Ga0207675_100150562 3300026118 Bacteria 2214
361 Ga0207675_100781281 3300026118 Bacteria 967
362 Ga0207683_10443354 3300026121 Bacteria 1196
363 Ga0207698_11945713 3300026142 Unclassified 602
364 Ga0207428_10064026 3300027907 Bacteria 2904
365 Ga0268266_10689578 3300028379 Bacteria 984
366 Ga0268265_10096270 3300028380 Unclassified 2379
367 Ga0268265_10619423 3300028380 Bacteria 1037
368 Ga0268265_11001273 3300028380 Bacteria 825
369 Ga0268264_10487846 3300028381 Bacteria 1199
370 Ga0268264_10549327 3300028381 Bacteria 1133
371 Ga0268264_10614107 3300028381 Bacteria 1073
372 Ga0268264_12597362 3300028381 Unclassified 511
373 Ga0265318_10171638 3300028577 Unclassified 794
374 Ga0265332_10058879 3300031238 Bacteria 1644
375 Ga0265331_10242797 3300031250 Unclassified 808
376 Ga0307408_100265710 3300031548 Unclassified 1422
377 Ga0265314_10038728 3300031711 Bacteria 3442
378 Ga0373958_0050662 3300034819 Bacteria 876
379 Ga0373938_0044575 3300034957 Bacteria 996
380 Ga0373928_0265978 3300035084 Bacteria 515
381 Ga0373929_0162192 3300035085 Bacteria 606
382 Ga0373949_0064445 3300035090 Unclassified 949
383 Ga0373939_0132347 3300035114 Bacteria 891
384 Ga0373945_0395378 3300035116 Bacteria 605
385 Ga0373956_0531438 3300035119 Bacteria 561
386 Ga0373943_0465892 3300035170 Unclassified 736
387 Ga0373943_0763380 3300035170 Unclassified 575
388 Ga0373955_0058325 3300035172 Bacteria 2124
389 Ga0373955_0801855 3300035172 Unclassified 579
390 Ga0373942_0127861 3300035207 Bacteria 799
391 Ga0373962_0027962 3300035242 Bacteria 1528
392 Ga0373931_0109925 3300035691 Bacteria 1563
393 Ga0373935_0517699 3300035692 Bacteria 867
394 Ga0373927_0396943 3300035695 Bacteria 910
395 Ga0373933_1128194 3300035724 Bacteria 517
396 Ga0373947_0222847 3300035725 Bacteria 1240
397 Ga0373937_0450073 3300036401 Bacteria 1223
398 Ga0373937_0516671 3300036401 Bacteria 1135
399 Ga0373937_0532251 3300036401 Bacteria 1116
400 Ga0373937_2137446 3300036401 Unclassified 506
401 Ga0373925_1167529 3300037068 Unclassified 633
402 Ga0395905_1904456 3300037471 Bacteria 501
403 Ga0436365_0545354 3300039437 Bacteria 1280
404 Ga0495580_0122005 3300046472 Bacteria 1809
405 Ga0495580_0417607 3300046472 Bacteria 903
406 Ga0495618_0590400 3300046514 Unclassified 662
407 Ga0495618_0810241 3300046514 Bacteria 545
408 Ga0495628_0290045 3300046516 Bacteria 1213
409 Ga0495666_0254260 3300046526 Unclassified 800
410 Ga0495640_0129003 3300046533 Bacteria 1638
411 Ga0495586_0156258 3300046535 Bacteria 1285
412 Ga0495586_0243616 3300046535 Bacteria 1025
413 Ga0495656_0281557 3300046615 Bacteria 848
414 Ga0495634_0736394 3300046642 Unclassified 565
415 Ga0495659_0447588 3300046664 Unclassified 562
416 Ga0495599_0586619 3300046678 Unclassified 650
417 Ga0495658_0298471 3300046683 Bacteria 1019
418 Ga0495658_0529134 3300046683 Bacteria 755
419 Ga0495669_0030510 3300046684 Bacteria 2367
420 Ga0495604_0559065 3300047317 Bacteria 737
421 Ga0495604_0827463 3300047317 Unclassified 582
422 Ga0495674_0295378 3300047319 Bacteria 1324
423 Ga0495680_0787266 3300047322 Bacteria 622
424 Ga0495602_0242158 3300048088 Bacteria 1349
425 Ga0496100_0466227 3300048903 Bacteria 970
426 Ga0496101_0554893 3300048904 Bacteria 908
427 Ga0496101_1216569 3300048904 Bacteria 590
428 Ga0496102_0338690 3300048905 Bacteria 1417
429 Ga0496102_0548491 3300048905 Bacteria 1079
430 Ga0496102_1671484 3300048905 Bacteria 555
431 Ga0496104_1026799 3300048907 Bacteria 728
432 Ga0496106_0526660 3300048909 Unclassified 949
433 Ga0496108_0585435 3300048911 Bacteria 973
434 Ga0496109_0056363 3300048912 Bacteria 3587
435 Ga0496109_0881507 3300048912 Bacteria 833
436 Ga0496109_1447560 3300048912 Bacteria 622
437 Ga0496110_0584500 3300048913 Bacteria 1014
438 Ga0496112_0091143 3300048915 Bacteria 3017
439 Ga0496112_0903907 3300048915 Bacteria 805
440 Ga0496113_0499378 3300048916 Bacteria 977
441 Ga0496113_1583677 3300048916 Bacteria 504
442 Ga0496114_1076553 3300048917 Unclassified 688
443 Ga0501031_0584616 3300049568 Unclassified 719
444 Ga0501072_0985918 3300049588 Unclassified 657
445 Ga0501075_1466597 3300049591 Unclassified 517
446 Ga0501076_0485759 3300049592 Bacteria 1018
447 Ga0501079_0792713 3300049741 Bacteria 746
448 nmdc:mga05p37_11606_c1 3300050507 Bacteria 10499
449 nmdc:mga05p37_16703_c1 3300050507 Bacteria 8845
450 nmdc:mga05p37_22585_c1 3300050507 Bacteria 7629
451 nmdc:mga05p37_247875_c1 3300050507 Bacteria 2138
452 nmdc:mga05p37_657644_c1 3300050507 Bacteria 1172
453 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
454 nmdc:mga05p37_993178_c1 3300050507 Bacteria 893
455 nmdc:mga08y16_1331998_c1 3300050511 Unclassified 683
456 nmdc:mga08y16_1684125_c1 3300050511 Unclassified 590
457 nmdc:mga08y16_2029888_c1 3300050511 Bacteria 524
458 nmdc:mga08y16_346005_c1 3300050511 Bacteria 1528
459 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
460 nmdc:mga0n895_1012759_c1 3300050512 Bacteria 811
461 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
462 nmdc:mga0n895_1718130_c1 3300050512 Unclassified 590
463 nmdc:mga0n895_28384_c1 3300050512 Bacteria 5322
464 nmdc:mga0n895_557251_c1 3300050512 Bacteria 1151
465 nmdc:mga0n895_587639_c1 3300050512 Bacteria 1117
466 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
467 nmdc:mga0rr50_240628_c1 3300050513 Bacteria 1500
468 nmdc:mga0rr50_838578_c1 3300050513 Bacteria 784
469 nmdc:mga08x19_263107_c1 3300050514 Bacteria 1193
470 nmdc:mga0a205_220261_c1 3300050515 Unclassified 1783
471 nmdc:mga0a205_2484_c1 3300050515 Bacteria 16260
472 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
473 Ga0495601_0100577 3300053077 Bacteria 1867
474 Ga0495601_0338959 3300053077 Unclassified 978
475 Ga0495612_0460017 3300053078 Unclassified 582
476 Ga0495612_0508087 3300053078 Bacteria 553
477 Ga0495619_0028066 3300053085 Bacteria 3629
478 Ga0495619_0130958 3300053085 Bacteria 1724
479 Ga0495619_0203498 3300053085 Bacteria 1371
480 Ga0501084_1509282 3300054114 Unclassified 562
481 Ga0451576_2578539
482 Ga0058863_11729973
483 Ga0058863_11755142
484 Ga0058861_11530950
485 Ga0058862_10011738
486 Ga0065712_10068138
487 Ga0065712_10603003
488 Ga0065715_10127942
489 Ga0065715_10226643
490 Ga0065715_10268030
491 Ga0065715_10720516
492 Ga0065707_10018539
493 Ga0065707_10172434
494 Ga0070658_11652700
495 Ga0070676_10058633
496 Ga0070676_10727440
497 Ga0070683_100763857
498 Ga0070670_100108148
499 Ga0070670_100509237
500 Ga0070670_102085359
501 Ga0068869_100926329
502 Ga0068869_101373697
503 Ga0070680_100068878
504 Ga0070680_100385219
505 Ga0070680_101435093
506 Ga0070682_100022409
507 Ga0070682_100188575
508 Ga0068868_100139802
509 Ga0068868_100151003
510 Ga0068868_100552834
511 Ga0068868_100580591
512 Ga0068868_100756185
513 Ga0068868_100946745
514 Ga0068868_102071493
515 Ga0070660_100043306
516 Ga0070660_100201902
517 Ga0070689_101849889
518 Ga0070691_10800362
519 Ga0070661_100180735
520 Ga0070668_100193989
521 Ga0070668_100208643
522 Ga0070668_101477117
523 Ga0070669_100053128
524 Ga0070669_101037296
525 Ga0070669_101408032
526 Ga0070669_101789907
527 Ga0070675_100581764
528 Ga0070671_100164038
529 Ga0070671_101648399
530 Ga0070674_100222142
531 Ga0070673_100071637
532 Ga0070673_100314590
533 Ga0070673_100519255
534 Ga0070688_100125104
535 Ga0070688_100173387
536 Ga0070659_100462281
537 Ga0070659_100513808
538 Ga0070710_10583381
539 Ga0070701_10818216
540 Ga0070701_10959129
541 Ga0070705_100617303
542 Ga0070700_100911703
543 Ga0070694_100013422
544 Ga0070708_101405133
545 Ga0070708_101794373
546 Ga0070663_100996616
547 Ga0070663_101290457
548 Ga0070663_101652617
549 Ga0070678_100335578
550 Ga0070681_10096194
551 Ga0070681_10131107
552 Ga0070681_10717508
553 Ga0068867_100186083
554 Ga0068867_100286765
555 Ga0068867_101622944
556 Ga0070685_10359941
557 Ga0070706_100274232
558 Ga0070706_102026538
559 Ga0070707_100121089
560 Ga0070707_100250411
561 Ga0070707_101176476
562 Ga0070698_100026990
563 Ga0070698_100469264
564 Ga0070699_100252524
565 Ga0070699_100524050
566 Ga0070679_100015797
567 Ga0070679_100017287
568 Ga0070679_100037637
569 Ga0070679_100317276
570 Ga0070672_100016241
571 Ga0070672_100313248
572 Ga0070672_100699775
573 Ga0070672_100816294
574 Ga0070686_100296220
575 Ga0070686_101849984
576 Ga0070695_100003699
577 Ga0070695_100350344
578 Ga0070695_101904596
579 Ga0070696_100064335
580 Ga0070696_100127485
581 Ga0070696_100322121
582 Ga0070696_100417052
583 Ga0070696_100710741
584 Ga0070693_101369045
585 Ga0070704_100020400
586 Ga0070704_101460885
587 Ga0068855_100023932
588 Ga0068855_100331808
589 Ga0070664_101667472
590 Ga0070664_101874630
591 Ga0068857_100161381
592 Ga0068857_100187475
593 Ga0068854_100112789
594 Ga0068856_100428366
595 Ga0070702_100715207
596 Ga0070702_101506619
597 Ga0068852_100244313
598 Ga0068859_100116866
599 Ga0068859_100195942
600 Ga0068859_100442464
601 Ga0068859_100573098
602 Ga0068859_100667479
603 Ga0068859_100874003
604 Ga0068859_101646651
605 Ga0068864_100453971
606 Ga0068864_100542723
607 Ga0068864_101475696
608 Ga0068864_102377822
609 Ga0068864_102489722
610 Ga0068861_100158990
611 Ga0068861_100620735
612 Ga0068861_100644034
613 Ga0068863_100079860
614 Ga0068863_100234144
615 Ga0068863_100338870
616 Ga0068863_101242254
617 Ga0068863_101584446
618 Ga0068863_102626076
619 Ga0068858_100161492
620 Ga0068858_100172126
621 Ga0068858_100182129
622 Ga0068858_100292522
623 Ga0068858_100348855
624 Ga0068858_100389537
625 Ga0068858_100637942
626 Ga0068858_102352027
627 Ga0068860_100079376
628 Ga0068860_100250765
629 Ga0068860_100416062
630 Ga0068860_100725367
631 Ga0068860_101214656
632 Ga0068860_101596057
633 Ga0068860_102738983
634 Ga0068862_100143380
635 Ga0068862_100940443
636 Ga0081455_10042166
637 Ga0070717_11790810
638 Ga0070715_10675705
639 Ga0097621_100213675
640 Ga0097621_100286538
641 Ga0097621_100606472
642 Ga0097621_101166136
643 Ga0068871_100107765
644 Ga0075428_100116199
645 Ga0075428_100480489
646 Ga0075428_100727492
647 Ga0075428_100917232
648 Ga0075430_100740215
649 Ga0075433_10103062
650 Ga0075433_10264412
651 Ga0075433_10371612
652 Ga0075434_100021223
653 Ga0075434_100108885
654 Ga0075434_100291108
655 Ga0075434_100644387
656 Ga0075434_100881889
657 Ga0075434_100916316
658 Ga0075434_100965621
659 Ga0075434_101027273
660 Ga0075429_100388746
661 Ga0068865_100222078
662 Ga0075436_100010393
663 Ga0097620_100116871
664 Ga0097620_100195915
665 Ga0097620_100442529
666 Ga0097620_100573076
667 Ga0097620_100667416
668 Ga0097620_100873968
669 Ga0097620_101646906
670 Ga0075435_100022377
671 Ga0075435_100300095
672 Ga0075435_100932175
673 Ga0099794_10424616
674 Ga0105240_10423430
675 Ga0105240_11876436
676 Ga0111539_10308794
677 Ga0111539_10330530
678 Ga0111539_12058753
679 Ga0111539_13176905
680 Ga0105245_10338044
681 Ga0105245_11991908
682 Ga0105245_12383033
683 Ga0105247_10017382
684 Ga0114129_10022782
685 Ga0114129_10113164
686 Ga0114129_10114829
687 Ga0114129_10133655
688 Ga0114129_10359676
689 Ga0114129_10610939
690 Ga0114129_10778029
691 Ga0105243_10924509
692 Ga0105243_11221434
693 Ga0105241_10866044
694 Ga0105241_11236981
695 Ga0105242_10096165
696 Ga0105242_10454430
697 Ga0105242_12198883
698 Ga0105248_10024770
699 Ga0105248_10030747
700 Ga0105248_10032706
701 Ga0105248_10089169
702 Ga0105248_10219667
703 Ga0105248_10294126
704 Ga0105248_10398291
705 Ga0105248_11859685
706 Ga0105248_12335764
707 Ga0105248_12814025
708 Ga0105237_11166632
709 Ga0105238_10414072
710 Ga0105238_10529330
711 Ga0105238_11876035
712 Ga0105249_10281932
713 Ga0105249_10387892
714 Ga0099796_10374355
715 Ga0105246_10301302
716 Ga0157374_10138351
717 Ga0157374_10607758
718 Ga0157374_11137245
719 Ga0157378_10066721
720 Ga0157378_10966072
721 Ga0157378_11198882
722 Ga0157378_12544807
723 Ga0157378_12850382
724 Ga0163162_10068005
725 Ga0163162_10970650
726 Ga0163162_12822687
727 Ga0163162_13233836
728 Ga0157372_10889709
729 Ga0157375_10111312
730 Ga0157375_10165006
731 Ga0157375_10923574
732 Ga0157375_11049439
733 Ga0157375_11602660
734 Ga0157375_12459114
735 Ga0157375_13191305
736 Ga0163163_10029543
737 Ga0163163_11508432
738 Ga0163163_11660478
739 Ga0157380_10114317
740 Ga0157380_11605355
741 Ga0157377_10516322
742 Ga0157379_10008200
743 Ga0157379_10043440
744 Ga0157376_10164451
745 Ga0157376_10983208
746 Ga0163161_10134671
747 Ga0213876_10131823
748 Ga0207692_10337789
749 Ga0207642_11135692
750 Ga0207710_10172163
751 Ga0207688_10174519
752 Ga0207645_10091823
753 Ga0207645_10595195
754 Ga0207684_10534403
755 Ga0207707_10073908
756 Ga0207707_10140018
757 Ga0207707_11467257
758 Ga0207695_10284341
759 Ga0207663_11740537
760 Ga0207660_10094485
761 Ga0207660_10140718
762 Ga0207660_11297239
763 Ga0207662_10108916
764 Ga0207657_10043378
765 Ga0207657_10185837
766 Ga0207649_10231823
767 Ga0207652_10089341
768 Ga0207652_10166557
769 Ga0207652_10215250
770 Ga0207652_10671846
771 Ga0207646_10101300
772 Ga0207646_10578118
773 Ga0207646_10630876
774 Ga0207681_10009213
775 Ga0207681_11538885
776 Ga0207694_10205150
777 Ga0207650_10249277
778 Ga0207659_10556033
779 Ga0207687_10663231
780 Ga0207644_10031442
781 Ga0207690_10953073
782 Ga0207690_11203965
783 Ga0207706_10345551
784 Ga0207706_10599034
785 Ga0207686_10502985
786 Ga0207686_11321246
787 Ga0207670_10055732
788 Ga0207670_11217794
789 Ga0207669_11441873
790 Ga0207704_10191611
791 Ga0207704_10384704
792 Ga0207704_11822530
793 Ga0207691_10027126
794 Ga0207691_10367543
795 Ga0207691_10630847
796 Ga0207691_10722165
797 Ga0207711_10019243
798 Ga0207711_10185737
799 Ga0207711_10259594
800 Ga0207711_10378444
801 Ga0207711_10765891
802 Ga0207689_10190367
803 Ga0207689_10549232
804 Ga0207689_10871425
805 Ga0207661_11412864
806 Ga0207679_11992151
807 Ga0207667_10073060
808 Ga0207651_10275714
809 Ga0207651_11512461
810 Ga0207712_10348784
811 Ga0207712_12085096
812 Ga0207668_10190408
813 Ga0207668_10853050
814 Ga0207640_10082191
815 Ga0207640_11402811
816 Ga0207640_11972443
817 Ga0207677_10108020
818 Ga0207677_10324864
819 Ga0207677_10843022
820 Ga0207703_10042300
821 Ga0207703_10088300
822 Ga0207703_10250595
823 Ga0207703_10275782
824 Ga0207703_10904002
825 Ga0207703_11907126
826 Ga0207678_11534014
827 Ga0207702_10576783
828 Ga0207702_11154618
829 Ga0207641_10002008
830 Ga0207641_10150847
831 Ga0207648_10201095
832 Ga0207648_10397428
833 Ga0207648_10473156
834 Ga0207648_10587326
835 Ga0207648_10980220
836 Ga0207676_10036797
837 Ga0207676_10302538
838 Ga0207674_10200004
839 Ga0207675_100070825
840 Ga0207675_100150562
841 Ga0207675_100781281
842 Ga0207683_10443354
843 Ga0207698_11945713
844 Ga0207428_10064026
845 Ga0268266_10689578
846 Ga0268265_10096270
847 Ga0268265_10619423
848 Ga0268265_11001273
849 Ga0268264_10487846
850 Ga0268264_10549327
851 Ga0268264_10614107
852 Ga0268264_12597362
853 Ga0265318_10171638
854 Ga0265332_10058879
855 Ga0265331_10242797
856 Ga0307408_100265710
857 Ga0265314_10038728
858 Ga0373958_0050662
859 Ga0373938_0044575
860 Ga0373928_0265978
861 Ga0373929_0162192
862 Ga0373949_0064445
863 Ga0373939_0132347
864 Ga0373945_0395378
865 Ga0373956_0531438
866 Ga0373943_0465892
867 Ga0373943_0763380
868 Ga0373955_0058325
869 Ga0373955_0801855
870 Ga0373942_0127861
871 Ga0373962_0027962
872 Ga0373931_0109925
873 Ga0373935_0517699
874 Ga0373927_0396943
875 Ga0373933_1128194
876 Ga0373947_0222847
877 Ga0373937_0450073
878 Ga0373937_0516671
879 Ga0373937_0532251
880 Ga0373937_2137446
881 Ga0373925_1167529
882 Ga0395905_1904456
883 Ga0436365_0545354
884 Ga0495580_0122005
885 Ga0495580_0417607
886 Ga0495618_0590400
887 Ga0495618_0810241
888 Ga0495628_0290045
889 Ga0495666_0254260
890 Ga0495640_0129003
891 Ga0495586_0156258
892 Ga0495586_0243616
893 Ga0495656_0281557
894 Ga0495634_0736394
895 Ga0495659_0447588
896 Ga0495599_0586619
897 Ga0495658_0298471
898 Ga0495658_0529134
899 Ga0495669_0030510
900 Ga0495604_0559065
901 Ga0495604_0827463
902 Ga0495674_0295378
903 Ga0495680_0787266
904 Ga0495602_0242158
905 Ga0496100_0466227
906 Ga0496101_0554893
907 Ga0496101_1216569
908 Ga0496102_0338690
909 Ga0496102_0548491
910 Ga0496102_1671484
911 Ga0496104_1026799
912 Ga0496106_0526660
913 Ga0496108_0585435
914 Ga0496109_0056363
915 Ga0496109_0881507
916 Ga0496109_1447560
917 Ga0496110_0584500
918 Ga0496112_0091143
919 Ga0496112_0903907
920 Ga0496113_0499378
921 Ga0496113_1583677
922 Ga0496114_1076553
923 Ga0501031_0584616
924 Ga0501072_0985918
925 Ga0501075_1466597
926 Ga0501076_0485759
927 Ga0501079_0792713
928 nmdc:mga05p37_11606_c1
929 nmdc:mga05p37_16703_c1
930 nmdc:mga05p37_22585_c1
931 nmdc:mga05p37_247875_c1
932 nmdc:mga05p37_657644_c1
933 nmdc:mga05p37_78239_c1
934 nmdc:mga05p37_993178_c1
935 nmdc:mga08y16_1331998_c1
936 nmdc:mga08y16_1684125_c1
937 nmdc:mga08y16_2029888_c1
938 nmdc:mga08y16_346005_c1
939 nmdc:mga08y16_7157_c1
940 nmdc:mga0n895_1012759_c1
941 nmdc:mga0n895_108320_c1
942 nmdc:mga0n895_1718130_c1
943 nmdc:mga0n895_28384_c1
944 nmdc:mga0n895_557251_c1
945 nmdc:mga0n895_587639_c1
946 nmdc:mga0rr50_22625_c1
947 nmdc:mga0rr50_240628_c1
948 nmdc:mga0rr50_838578_c1
949 nmdc:mga08x19_263107_c1
950 nmdc:mga0a205_220261_c1
951 nmdc:mga0a205_2484_c1
952 nmdc:mga0a205_59591_c1
953 Ga0495601_0100577
954 Ga0495601_0338959
955 Ga0495612_0460017
956 Ga0495612_0508087
957 Ga0495619_0028066
958 Ga0495619_0130958
959 Ga0495619_0203498
960 Ga0501084_1509282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3va9-assembly1.cif.gz_A crystal structure of the rhodopseudomonas palustris histidine kinase hk9 sensor domain 0.9611 7 57
5ee0-assembly1.cif.gz_A crystal structure of osychf1 at ph 6.5 0.9484 3 51
1y47-assembly2.cif.gz_B structural studies of designed alpha-helical hairpins 0.9431 10 53
8bhf-assembly1.cif.gz_n1 cryo-em structure of stalled rabbit 80s ribosomes in complex with human ccr4-not and cnot4 0.9158 4 65
8cok-assembly1.cif.gz_B structural analysis of ing3 protein and its binding to histone h3 0.9148 4 65
ID Description Score Start End Superfamily
1jm0A00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9732 10 54 1.20.5.420
af_A0A0R0GET6_7_150_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9641 11 61 1.20.140.40
1hr5B00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.961 10 54 1.20.5.420
5ee0A03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Obg-related GTPase Ych/YyaF, coiled-coil domain 0.9484 3 51 1.10.150.300
af_K7M4G7_29_136_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9467 1 62 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A7V5C6X4-F1-model_v4 HepT-like domain-containing protein 0.9908 4 58
AF-A0A3M1XU42-F1-model_v4 Uncharacterized protein 0.9876 1 64 GO:0016020
AF-A0A2T9ZF77-F1-model_v4 Transmembrane protein 188 0.9849 4 64 GO:0016020
AF-A0A2E5U4Y1-F1-model_v4 Uncharacterized protein 0.9836 1 64 GO:0016020
AF-A0A2V8DD83-F1-model_v4 Uncharacterized protein 0.9818 1 62 GO:0016020

Map