F452178

General Info

Members Datasets Scaffolds Average Seq Length
480 188 960 136

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101222181|Ga0070711_1012221811
Length 153
Sequence VSAPKAYFGRRYMLSASHRLNADSLSAAENLAAYGKCNNAYGHGHNYTVEVLIGGQVDPETGMVINLAELDEVVQRKVLDRFDHMNLNIDPFFENLVPTTENLCRTVFQIIKGALPAMELAHVRVEETENNFFQCFGSEDFEAANRQAAHQAT

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 4.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.5
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 15.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101222181 3300005439 Unclassified 650
2 rootH1_10151025 3300003323 Bacteria 1134
3 Ga0058862_12821944 3300004803 Unclassified 2084
4 Ga0070658_10070017 3300005327 Bacteria 2871
5 Ga0070658_10648746 3300005327 Bacteria 916
6 Ga0070658_11212421 3300005327 Unclassified 656
7 Ga0070676_10005917 3300005328 Bacteria 6528
8 Ga0070683_100023527 3300005329 Bacteria 5510
9 Ga0070683_100081436 3300005329 Bacteria 3031
10 Ga0070683_100119774 3300005329 Unclassified 2486
11 Ga0070683_100132018 3300005329 Bacteria 2364
12 Ga0070683_100185303 3300005329 Bacteria 1976
13 Ga0070683_100211522 3300005329 Bacteria 1842
14 Ga0070690_100589520 3300005330 Unclassified 842
15 Ga0070670_100010594 3300005331 Bacteria 7872
16 Ga0068869_100017699 3300005334 Bacteria 4838
17 Ga0070666_10028737 3300005335 Bacteria 3651
18 Ga0070680_100055469 3300005336 Bacteria 3238
19 Ga0070682_100141346 3300005337 Unclassified 1641
20 Ga0068868_100004476 3300005338 Bacteria 9800
21 Ga0068868_100015337 3300005338 Bacteria 5665
22 Ga0068868_100022297 3300005338 Bacteria 4776
23 Ga0070660_100006768 3300005339 Bacteria 7956
24 Ga0070660_100069979 3300005339 Bacteria 2737
25 Ga0070660_100101301 3300005339 Unclassified 2282
26 Ga0070660_100709456 3300005339 Unclassified 844
27 Ga0070689_100490055 3300005340 Unclassified 1051
28 Ga0070661_100004616 3300005344 Bacteria 9480
29 Ga0070661_100107987 3300005344 Bacteria 2076
30 Ga0070661_100191417 3300005344 Bacteria 1560
31 Ga0070668_100061780 3300005347 Bacteria 2903
32 Ga0070675_100025013 3300005354 Bacteria 4786
33 Ga0070671_100025737 3300005355 Bacteria 4831
34 Ga0070671_100027068 3300005355 Bacteria 4717
35 Ga0070671_100131020 3300005355 Bacteria 2112
36 Ga0070671_101543993 3300005355 Unclassified 588
37 Ga0070674_100279623 3300005356 Bacteria 1322
38 Ga0070673_100023375 3300005364 Bacteria 4516
39 Ga0070659_100358880 3300005366 Unclassified 1224
40 Ga0070667_100006815 3300005367 Bacteria 9489
41 Ga0070667_100049090 3300005367 Bacteria 3554
42 Ga0070709_10385238 3300005434 Unclassified 1043
43 Ga0070713_100010367 3300005436 Bacteria 6733
44 Ga0070713_100278744 3300005436 Bacteria 1533
45 Ga0070713_101225768 3300005436 Unclassified 726
46 Ga0070713_101801688 3300005436 Unclassified 594
47 Ga0070711_100102773 3300005439 Unclassified 2082
48 Ga0070711_100285151 3300005439 Bacteria 1308
49 Ga0070662_100082083 3300005457 Bacteria 2403
50 Ga0070681_10003755 3300005458 Bacteria 14254
51 Ga0068867_100111510 3300005459 Bacteria 2102
52 Ga0070707_100634266 3300005468 Bacteria 1031
53 Ga0070679_100112249 3300005530 Bacteria 2712
54 Ga0070679_100395794 3300005530 Bacteria 1328
55 Ga0070684_100002861 3300005535 Bacteria 12829
56 Ga0070684_100005055 3300005535 Bacteria 10070
57 Ga0070684_100021807 3300005535 Bacteria 5335
58 Ga0070684_100050758 3300005535 Bacteria 3604
59 Ga0070684_100210312 3300005535 Bacteria 1773
60 Ga0070684_100628123 3300005535 Bacteria 999
61 Ga0068853_100004104 3300005539 Bacteria 11220
62 Ga0068853_100044174 3300005539 Bacteria 3814
63 Ga0068853_100047503 3300005539 Bacteria 3683
64 Ga0068853_100084324 3300005539 Bacteria 2784
65 Ga0070672_100119666 3300005543 Unclassified 2154
66 Ga0070665_100171818 3300005548 Bacteria 2168
67 Ga0070665_100263048 3300005548 Bacteria 1726
68 Ga0068855_100000819 3300005563 Bacteria 38473
69 Ga0068855_100012254 3300005563 Bacteria 10363
70 Ga0068855_100014110 3300005563 Bacteria 9629
71 Ga0068855_100026325 3300005563 Bacteria 6958
72 Ga0068855_100057916 3300005563 Bacteria 4541
73 Ga0068855_100072112 3300005563 Bacteria 4015
74 Ga0068855_100152156 3300005563 Bacteria 2630
75 Ga0068855_100532933 3300005563 Bacteria 1273
76 Ga0070664_100136329 3300005564 Unclassified 2159
77 Ga0070664_100253364 3300005564 Bacteria 1583
78 Ga0070664_101173276 3300005564 Bacteria 724
79 Ga0068857_100001991 3300005577 Bacteria 16557
80 Ga0068857_100083477 3300005577 Bacteria 2854
81 Ga0068857_100335207 3300005577 Bacteria 1399
82 Ga0068857_102104193 3300005577 Unclassified 554
83 Ga0068854_100050763 3300005578 Bacteria 2970
84 Ga0068854_100058150 3300005578 Unclassified 2790
85 Ga0068854_100368625 3300005578 Unclassified 1180
86 Ga0068856_100001782 3300005614 Bacteria 22500
87 Ga0068856_100008091 3300005614 Bacteria 10266
88 Ga0068856_100011451 3300005614 Bacteria 8606
89 Ga0068856_100015606 3300005614 Bacteria 7344
90 Ga0068856_100060352 3300005614 Bacteria 3746
91 Ga0068856_100096510 3300005614 Bacteria 2944
92 Ga0068856_101273779 3300005614 Unclassified 751
93 Ga0068852_100003017 3300005616 Bacteria 11711
94 Ga0068852_100003172 3300005616 Bacteria 11474
95 Ga0068852_100003318 3300005616 Bacteria 11236
96 Ga0068852_100008628 3300005616 Bacteria 7527
97 Ga0068852_100087380 3300005616 Bacteria 2782
98 Ga0068852_100209058 3300005616 Bacteria 1850
99 Ga0068859_100083756 3300005617 Bacteria 3233
100 Ga0068864_100001011 3300005618 Bacteria 23500
101 Ga0068864_100150477 3300005618 Bacteria 2108
102 Ga0068861_100796862 3300005719 Unclassified 886
103 Ga0068851_10016720 3300005834 Bacteria 3515
104 Ga0068851_10092843 3300005834 Bacteria 1591
105 Ga0068863_100001678 3300005841 Bacteria 21916
106 Ga0068863_100007398 3300005841 Bacteria 10747
107 Ga0068858_100003486 3300005842 Bacteria 15597
108 Ga0068858_100203322 3300005842 Bacteria 1873
109 Ga0068860_100007224 3300005843 Bacteria 11106
110 Ga0068860_100023371 3300005843 Bacteria 5974
111 Ga0068862_100244391 3300005844 Bacteria 1633
112 Ga0070717_10216768 3300006028 Bacteria 1681
113 Ga0070712_100082293 3300006175 Unclassified 2335
114 Ga0097621_100003579 3300006237 Bacteria 10736
115 Ga0097621_100039628 3300006237 Bacteria 3785
116 Ga0097621_100666811 3300006237 Unclassified 955
117 Ga0068871_100003833 3300006358 Bacteria 10365
118 Ga0068871_100020118 3300006358 Bacteria 5107
119 Ga0068871_100028898 3300006358 Bacteria 4351
120 Ga0068865_100054112 3300006881 Bacteria 2787
121 Ga0097620_100083764 3300006931 Bacteria 3233
122 Ga0105240_10003431 3300009093 Bacteria 24635
123 Ga0105240_10009850 3300009093 Bacteria 13489
124 Ga0105240_10015189 3300009093 Bacteria 10478
125 Ga0105240_10015938 3300009093 Bacteria 10194
126 Ga0105240_10034845 3300009093 Bacteria 6490
127 Ga0105240_10045449 3300009093 Bacteria 5570
128 Ga0105240_10054107 3300009093 Bacteria 5031
129 Ga0105240_10084928 3300009093 Bacteria 3880
130 Ga0105240_10232022 3300009093 Bacteria 2144
131 Ga0105240_10311733 3300009093 Bacteria 1797
132 Ga0105240_10549288 3300009093 Bacteria 1278
133 Ga0105245_10002580 3300009098 Bacteria 16317
134 Ga0105245_10006340 3300009098 Bacteria 10409
135 Ga0105245_10152482 3300009098 Bacteria 2186
136 Ga0105247_10016685 3300009101 Bacteria 4404
137 Ga0105247_10094104 3300009101 Bacteria 1906
138 Ga0105247_10168380 3300009101 Unclassified 1455
139 Ga0105247_10237364 3300009101 Bacteria 1241
140 Ga0105243_10283629 3300009148 Bacteria 1493
141 Ga0105241_10000199 3300009174 Bacteria 44908
142 Ga0105241_10002734 3300009174 Bacteria 13219
143 Ga0105241_10013210 3300009174 Bacteria 6053
144 Ga0105241_10018485 3300009174 Bacteria 5127
145 Ga0105242_10273003 3300009176 Bacteria 1532
146 Ga0105248_10000004 3300009177 Bacteria 695244
147 Ga0105248_10000255 3300009177 Bacteria 62145
148 Ga0105248_10093925 3300009177 Bacteria 3378
149 Ga0105248_10205747 3300009177 Bacteria 2218
150 Ga0105248_10400748 3300009177 Bacteria 1545
151 Ga0105248_11044186 3300009177 Bacteria 923
152 Ga0105237_10003805 3300009545 Bacteria 17734
153 Ga0105237_10019484 3300009545 Bacteria 7007
154 Ga0105237_10050367 3300009545 Bacteria 4184
155 Ga0105237_10230918 3300009545 Bacteria 1851
156 Ga0105237_10265446 3300009545 Bacteria 1720
157 Ga0105237_10335127 3300009545 Bacteria 1517
158 Ga0105237_10932060 3300009545 Bacteria 875
159 Ga0105238_10000262 3300009551 Bacteria 58846
160 Ga0105238_10000292 3300009551 Bacteria 55692
161 Ga0105238_10001340 3300009551 Bacteria 24728
162 Ga0105238_10007813 3300009551 Bacteria 10696
163 Ga0105238_10052982 3300009551 Bacteria 4078
164 Ga0105238_10230330 3300009551 Bacteria 1830
165 Ga0105249_10064494 3300009553 Bacteria 3368
166 Ga0105239_10001873 3300010375 Bacteria 27535
167 Ga0105239_10004032 3300010375 Bacteria 17766
168 Ga0105239_10007426 3300010375 Bacteria 12574
169 Ga0105239_10054842 3300010375 Bacteria 4373
170 Ga0105239_10096949 3300010375 Bacteria 3258
171 Ga0105239_10337112 3300010375 Bacteria 1701
172 Ga0105246_10006772 3300011119 Bacteria 7006
173 Ga0157371_10636039 3300013102 Bacteria 795
174 Ga0157371_11376216 3300013102 Unclassified 548
175 Ga0157370_10000107 3300013104 Bacteria 95413
176 Ga0157370_10011099 3300013104 Bacteria 9444
177 Ga0157370_10628620 3300013104 Bacteria 982
178 Ga0157369_10000275 3300013105 Bacteria 69270
179 Ga0157369_10002075 3300013105 Bacteria 24207
180 Ga0157369_10003741 3300013105 Bacteria 18074
181 Ga0157369_10014204 3300013105 Bacteria 8996
182 Ga0157369_10017062 3300013105 Bacteria 8157
183 Ga0157369_10021414 3300013105 Bacteria 7232
184 Ga0157369_10099468 3300013105 Bacteria 3101
185 Ga0157369_10112954 3300013105 Bacteria 2886
186 Ga0157374_10009059 3300013296 Bacteria 8529
187 Ga0157374_10009888 3300013296 Bacteria 8185
188 Ga0157374_10043879 3300013296 Bacteria 4131
189 Ga0157374_10076869 3300013296 Bacteria 3157
190 Ga0157374_10216396 3300013296 Unclassified 1879
191 Ga0157374_10220706 3300013296 Bacteria 1860
192 Ga0157374_10281361 3300013296 Bacteria 1642
193 Ga0157378_10017511 3300013297 Bacteria 6289
194 Ga0157378_10029194 3300013297 Bacteria 4868
195 Ga0157378_10078165 3300013297 Bacteria 2984
196 Ga0157378_10200606 3300013297 Bacteria 1887
197 Ga0163162_10046586 3300013306 Bacteria 4346
198 Ga0163162_10050845 3300013306 Unclassified 4157
199 Ga0157372_10000127 3300013307 Bacteria 82699
200 Ga0157372_10001526 3300013307 Bacteria 25177
201 Ga0157372_10023808 3300013307 Bacteria 6643
202 Ga0157372_10024442 3300013307 Bacteria 6562
203 Ga0157372_10096852 3300013307 Unclassified 3363
204 Ga0157372_10099093 3300013307 Bacteria 3324
205 Ga0157372_10112432 3300013307 Bacteria 3120
206 Ga0157372_10140757 3300013307 Bacteria 2779
207 Ga0157372_10659316 3300013307 Bacteria 1218
208 Ga0157372_11170114 3300013307 Unclassified 889
209 Ga0157372_11216116 3300013307 Bacteria 870
210 Ga0157375_10011935 3300013308 Bacteria 7687
211 Ga0157375_10015926 3300013308 Bacteria 6742
212 Ga0157375_10032288 3300013308 Bacteria 4964
213 Ga0163163_10065040 3300014325 Bacteria 3619
214 Ga0163163_10122743 3300014325 Bacteria 2632
215 Ga0157379_10005183 3300014968 Bacteria 11193
216 Ga0157379_10018173 3300014968 Bacteria 6195
217 Ga0157379_10074904 3300014968 Bacteria 3030
218 Ga0157379_10140759 3300014968 Bacteria 2175
219 Ga0157376_10001195 3300014969 Bacteria 17141
220 Ga0157376_10104173 3300014969 Bacteria 2486
221 Ga0157376_10451857 3300014969 Bacteria 1253
222 Ga0157376_10783365 3300014969 Bacteria 965
223 Ga0157376_11427551 3300014969 Bacteria 724
224 Ga0197907_10267824 3300020069 Bacteria 1015
225 Ga0197907_11423606 3300020069 Bacteria 1838
226 Ga0206356_10472776 3300020070 Bacteria 1015
227 Ga0206356_11265128 3300020070 Bacteria 1042
228 Ga0206349_1043956 3300020075 Bacteria 1092
229 Ga0206355_1296097 3300020076 Bacteria 963
230 Ga0206351_10793572 3300020077 Bacteria 1776
231 Ga0206350_10409333 3300020080 Bacteria 1605
232 Ga0206350_10415166 3300020080 Unclassified 835
233 Ga0206350_10468688 3300020080 Unclassified 582
234 Ga0206350_10594951 3300020080 Bacteria 2041
235 Ga0206350_10734905 3300020080 Bacteria 911
236 Ga0206354_11255689 3300020081 Bacteria 801
237 Ga0154015_1017332 3300020610 Bacteria 926
238 Ga0154015_1346029 3300020610 Bacteria 1302
239 Ga0224712_10042657 3300022467 Bacteria 1720
240 Ga0224712_10047145 3300022467 Bacteria 1657
241 Ga0224712_10183636 3300022467 Bacteria 943
242 Ga0207697_10026675 3300025315 Bacteria 2362
243 Ga0207656_10029705 3300025321 Bacteria 2253
244 Ga0207656_10039750 3300025321 Bacteria 1991
245 Ga0207656_10057652 3300025321 Bacteria 1695
246 Ga0207710_10008632 3300025900 Bacteria 4296
247 Ga0207710_10432714 3300025900 Unclassified 678
248 Ga0207688_10034034 3300025901 Bacteria 2820
249 Ga0207680_10056777 3300025903 Bacteria 2366
250 Ga0207647_10046122 3300025904 Bacteria 2716
251 Ga0207699_10188194 3300025906 Bacteria 1392
252 Ga0207645_10005882 3300025907 Bacteria 8836
253 Ga0207705_10051275 3300025909 Bacteria 2970
254 Ga0207705_10859516 3300025909 Unclassified 703
255 Ga0207705_10949577 3300025909 Unclassified 665
256 Ga0207654_10000219 3300025911 Bacteria 35241
257 Ga0207654_10006439 3300025911 Bacteria 5911
258 Ga0207654_10123076 3300025911 Bacteria 1632
259 Ga0207654_10130565 3300025911 Unclassified 1590
260 Ga0207707_10030886 3300025912 Bacteria 4686
261 Ga0207695_10000233 3300025913 Bacteria 147498
262 Ga0207695_10000258 3300025913 Bacteria 134197
263 Ga0207695_10000501 3300025913 Bacteria 83342
264 Ga0207695_10005107 3300025913 Bacteria 17581
265 Ga0207695_10089803 3300025913 Bacteria 3089
266 Ga0207695_10095375 3300025913 Bacteria 2979
267 Ga0207695_10137036 3300025913 Bacteria 2400
268 Ga0207695_10155027 3300025913 Bacteria 2226
269 Ga0207695_10585786 3300025913 Bacteria 997
270 Ga0207671_10000022 3300025914 Bacteria 277803
271 Ga0207671_10001087 3300025914 Bacteria 32869
272 Ga0207671_10123056 3300025914 Unclassified 1984
273 Ga0207671_10194123 3300025914 Bacteria 1584
274 Ga0207671_10511822 3300025914 Bacteria 957
275 Ga0207663_10084866 3300025916 Unclassified 2084
276 Ga0207660_11530257 3300025917 Bacteria 539
277 Ga0207657_10018488 3300025919 Bacteria 6648
278 Ga0207657_10107475 3300025919 Bacteria 2308
279 Ga0207649_10014261 3300025920 Bacteria 4447
280 Ga0207649_10275862 3300025920 Bacteria 1220
281 Ga0207652_10399520 3300025921 Bacteria 1240
282 Ga0207694_10000009 3300025924 Bacteria 460687
283 Ga0207694_10000682 3300025924 Bacteria 30458
284 Ga0207694_10001146 3300025924 Bacteria 23003
285 Ga0207694_10078940 3300025924 Bacteria 2581
286 Ga0207694_10383834 3300025924 Bacteria 1166
287 Ga0207694_10426113 3300025924 Bacteria 1106
288 Ga0207650_10093216 3300025925 Bacteria 2305
289 Ga0207659_10110682 3300025926 Bacteria 2087
290 Ga0207687_10112375 3300025927 Bacteria 2024
291 Ga0207700_10002175 3300025928 Bacteria 11231
292 Ga0207700_11015879 3300025928 Bacteria 742
293 Ga0207664_10593772 3300025929 Bacteria 994
294 Ga0207664_11513500 3300025929 Unclassified 593
295 Ga0207644_10240824 3300025931 Bacteria 1440
296 Ga0207644_10772030 3300025931 Bacteria 803
297 Ga0207706_10013501 3300025933 Bacteria 7423
298 Ga0207691_10010218 3300025940 Bacteria 9004
299 Ga0207711_10000008 3300025941 Bacteria 597686
300 Ga0207711_10000010 3300025941 Bacteria 557970
301 Ga0207711_10016171 3300025941 Bacteria 6194
302 Ga0207711_10053830 3300025941 Bacteria 3452
303 Ga0207711_10184420 3300025941 Bacteria 1899
304 Ga0207711_10445447 3300025941 Unclassified 1205
305 Ga0207711_11124914 3300025941 Unclassified 726
306 Ga0207689_10000543 3300025942 Bacteria 35857
307 Ga0207689_10028697 3300025942 Bacteria 4654
308 Ga0207661_10002791 3300025944 Bacteria 12045
309 Ga0207661_10017763 3300025944 Bacteria 5271
310 Ga0207661_10074641 3300025944 Bacteria 2780
311 Ga0207661_10111456 3300025944 Unclassified 2315
312 Ga0207661_10149798 3300025944 Bacteria 2016
313 Ga0207661_10164465 3300025944 Bacteria 1927
314 Ga0207679_10050554 3300025945 Bacteria 3039
315 Ga0207679_10259251 3300025945 Bacteria 1482
316 Ga0207679_10549772 3300025945 Unclassified 1036
317 Ga0207679_11362932 3300025945 Bacteria 651
318 Ga0207667_10000930 3300025949 Bacteria 37351
319 Ga0207667_10007052 3300025949 Bacteria 13580
320 Ga0207667_10007746 3300025949 Bacteria 12837
321 Ga0207667_10011149 3300025949 Bacteria 10463
322 Ga0207667_10034303 3300025949 Bacteria 5450
323 Ga0207667_10090955 3300025949 Bacteria 3153
324 Ga0207667_11131028 3300025949 Unclassified 765
325 Ga0207667_11635279 3300025949 Unclassified 612
326 Ga0207651_10055776 3300025960 Bacteria 2716
327 Ga0207712_10078847 3300025961 Bacteria 2391
328 Ga0207640_10042322 3300025981 Unclassified 2904
329 Ga0207640_11021407 3300025981 Unclassified 728
330 Ga0207658_10048455 3300025986 Unclassified 3115
331 Ga0207677_10002256 3300026023 Bacteria 10115
332 Ga0207677_10026651 3300026023 Bacteria 3629
333 Ga0207677_10137836 3300026023 Bacteria 1863
334 Ga0207703_10059545 3300026035 Bacteria 3119
335 Ga0207639_10002669 3300026041 Bacteria 11977
336 Ga0207639_10067330 3300026041 Bacteria 2786
337 Ga0207639_10126360 3300026041 Bacteria 2110
338 Ga0207639_10155986 3300026041 Bacteria 1918
339 Ga0207639_10388829 3300026041 Bacteria 1254
340 Ga0207678_10407698 3300026067 Bacteria 1177
341 Ga0207678_10433022 3300026067 Bacteria 1141
342 Ga0207678_10541288 3300026067 Bacteria 1018
343 Ga0207702_10008532 3300026078 Bacteria 8638
344 Ga0207702_10026962 3300026078 Bacteria 4770
345 Ga0207702_10032700 3300026078 Bacteria 4340
346 Ga0207702_10227246 3300026078 Unclassified 1742
347 Ga0207702_10426695 3300026078 Bacteria 1283
348 Ga0207702_11953066 3300026078 Unclassified 578
349 Ga0207641_10077999 3300026088 Bacteria 2868
350 Ga0207648_10085315 3300026089 Bacteria 2755
351 Ga0207676_10002800 3300026095 Bacteria 12398
352 Ga0207676_10087223 3300026095 Bacteria 2552
353 Ga0207674_10001761 3300026116 Bacteria 27686
354 Ga0207674_10003906 3300026116 Bacteria 18131
355 Ga0207674_10054691 3300026116 Bacteria 4063
356 Ga0207674_10348926 3300026116 Bacteria 1431
357 Ga0207674_12204808 3300026116 Unclassified 514
358 Ga0207675_100410887 3300026118 Unclassified 1335
359 Ga0207683_10000329 3300026121 Bacteria 43154
360 Ga0207698_10000109 3300026142 Bacteria 51574
361 Ga0207698_10002320 3300026142 Bacteria 11270
362 Ga0207698_10099352 3300026142 Bacteria 2407
363 Ga0207698_10107593 3300026142 Bacteria 2328
364 Ga0207698_10287994 3300026142 Bacteria 1523
365 Ga0207698_10687859 3300026142 Unclassified 1017
366 Ga0207698_11642412 3300026142 Unclassified 658
367 Ga0268266_10014819 3300028379 Bacteria 6695
368 Ga0268266_10108658 3300028379 Bacteria 2455
369 Ga0268266_10159323 3300028379 Bacteria 2041
370 Ga0268265_10228555 3300028380 Bacteria 1633
371 Ga0268264_10025217 3300028381 Bacteria 4857
372 Ga0268264_10156792 3300028381 Bacteria 2047
373 Ga0265318_10045097 3300028577 Bacteria 1667
374 Ga0265318_10075307 3300028577 Bacteria 1249
375 Ga0265338_10027301 3300028800 Bacteria 5730
376 Ga0265338_10271109 3300028800 Bacteria 1244
377 Ga0265338_10862060 3300028800 Bacteria 618
378 Ga0265760_10061032 3300031090 Bacteria 1146
379 Ga0265330_10002436 3300031235 Bacteria 10138
380 Ga0265330_10023360 3300031235 Bacteria 2808
381 Ga0265330_10099791 3300031235 Unclassified 1243
382 Ga0265330_10211166 3300031235 Unclassified 820
383 Ga0265332_10081563 3300031238 Bacteria 1372
384 Ga0265328_10026137 3300031239 Bacteria 2196
385 Ga0265325_10000115 3300031241 Bacteria 54808
386 Ga0265325_10016335 3300031241 Bacteria 4151
387 Ga0265325_10038953 3300031241 Bacteria 2505
388 Ga0265325_10039205 3300031241 Bacteria 2496
389 Ga0265325_10069413 3300031241 Bacteria 1772
390 Ga0265325_10133480 3300031241 Bacteria 1187
391 Ga0265325_10300878 3300031241 Unclassified 716
392 Ga0265329_10038904 3300031242 Bacteria 1530
393 Ga0265340_10011351 3300031247 Bacteria 4736
394 Ga0265340_10076277 3300031247 Bacteria 1583
395 Ga0265340_10183842 3300031247 Bacteria 944
396 Ga0265340_10186772 3300031247 Bacteria 936
397 Ga0265339_10000557 3300031249 Bacteria 29155
398 Ga0265339_10000694 3300031249 Bacteria 26062
399 Ga0265339_10073954 3300031249 Bacteria 1811
400 Ga0265339_10115569 3300031249 Bacteria 1384
401 Ga0265339_10178398 3300031249 Bacteria 1059
402 Ga0265316_10001818 3300031344 Bacteria 22421
403 Ga0265316_10016452 3300031344 Bacteria 6414
404 Ga0265316_10067550 3300031344 Bacteria 2764
405 Ga0265316_10092590 3300031344 Bacteria 2304
406 Ga0265316_10151408 3300031344 Bacteria 1738
407 Ga0265316_10184800 3300031344 Bacteria 1551
408 Ga0265316_10195559 3300031344 Bacteria 1501
409 Ga0265316_10379797 3300031344 Bacteria 1019
410 Ga0265316_10625101 3300031344 Bacteria 762
411 Ga0265316_10867674 3300031344 Bacteria 631
412 Ga0265316_10974559 3300031344 Bacteria 591
413 Ga0265313_10003472 3300031595 Bacteria 12727
414 Ga0265313_10011695 3300031595 Bacteria 5435
415 Ga0265313_10095748 3300031595 Bacteria 1325
416 Ga0265313_10097836 3300031595 Bacteria 1307
417 Ga0265313_10151303 3300031595 Bacteria 991
418 Ga0265314_10000081 3300031711 Bacteria 143776
419 Ga0265314_10106077 3300031711 Bacteria 1796
420 Ga0265314_10277204 3300031711 Unclassified 950
421 Ga0265314_10379889 3300031711 Unclassified 769
422 Ga0265342_10001506 3300031712 Bacteria 21599
423 Ga0265342_10004150 3300031712 Bacteria 11533
424 Ga0265342_10009471 3300031712 Bacteria 6858
425 Ga0265342_10018805 3300031712 Bacteria 4466
426 Ga0265342_10041111 3300031712 Bacteria 2801
427 Ga0265342_10087771 3300031712 Bacteria 1787
428 Ga0265342_10098523 3300031712 Bacteria 1668
429 Ga0265342_10154162 3300031712 Bacteria 1274
430 Ga0265342_10256064 3300031712 Unclassified 933
431 Ga0373954_0076840 3300035118 Bacteria 1592
432 Ga0373957_0194809 3300035120 Unclassified 843
433 Ga0373924_0209670 3300035410 Bacteria 860
434 Ga0373933_0039060 3300035724 Unclassified 2791
435 Ga0373933_0434519 3300035724 Unclassified 858
436 Ga0373933_0488710 3300035724 Bacteria 806
437 Ga0373937_0350370 3300036401 Bacteria 1399
438 Ga0373937_1249489 3300036401 Unclassified 691
439 Ga0373937_1699522 3300036401 Unclassified 578
440 Ga0373925_0958434 3300037068 Unclassified 705
441 Ga0451839_0442806 3300041496 Bacteria 770
442 Ga0439448_0157294 3300042005 Bacteria 790
443 Ga0466969_0086927 3300044656 Bacteria 1485
444 Ga0466961_0279632 3300044693 Bacteria 1021
445 Ga0466961_0329083 3300044693 Bacteria 931
446 Ga0466963_0000873 3300044694 Bacteria 15279
447 Ga0466970_0710099 3300044765 Unclassified 586
448 Ga0466958_0563442 3300045836 Unclassified 740
449 Ga0466967_0003352 3300045976 Bacteria 10415
450 Ga0495603_0036976 3300046455 Bacteria 2930
451 Ga0495629_0030602 3300046459 Bacteria 3816
452 Ga0495629_0229166 3300046459 Bacteria 1281
453 Ga0495580_0342020 3300046472 Bacteria 1015
454 Ga0495580_0525451 3300046472 Bacteria 788
455 Ga0495582_0288496 3300046473 Bacteria 943
456 Ga0495662_0253924 3300046476 Unclassified 866
457 Ga0495645_0051474 3300046543 Bacteria 2996
458 Ga0495623_0215749 3300046679 Bacteria 1096
459 Ga0495669_0264642 3300046684 Bacteria 826
460 Ga0495613_0348890 3300046689 Bacteria 1017
461 Ga0495613_1026911 3300046689 Bacteria 529
462 Ga0495676_0647637 3300047321 Unclassified 686
463 Ga0495602_0513917 3300048088 Unclassified 835
464 Ga0496101_0297462 3300048904 Bacteria 1264
465 Ga0496105_0076727 3300048908 Bacteria 2760
466 Ga0496105_0415183 3300048908 Unclassified 1066
467 Ga0496106_0045792 3300048909 Bacteria 3287
468 Ga0496107_0260916 3300048910 Bacteria 1289
469 Ga0496108_0244276 3300048911 Bacteria 1562
470 Ga0496114_0516949 3300048917 Bacteria 1056
471 Ga0496114_0650020 3300048917 Bacteria 927
472 Ga0496114_0739394 3300048917 Unclassified 861
473 Ga0496115_0124505 3300048918 Bacteria 2123
474 Ga0496115_0130462 3300048918 Bacteria 2071
475 Ga0496115_0644991 3300048918 Unclassified 837
476 Ga0496126_0015586 3300048929 Bacteria 7638
477 Ga0501080_0492444 3300049742 Bacteria 1096
478 Ga0495601_0105045 3300053077 Unclassified 1826
479 Ga0495619_0057510 3300053085 Bacteria 2581
480 Ga0500644_0063631 3300053088 Bacteria 1308
481 Ga0070711_101222181
482 rootH1_10151025
483 Ga0058862_12821944
484 Ga0070658_10070017
485 Ga0070658_10648746
486 Ga0070658_11212421
487 Ga0070676_10005917
488 Ga0070683_100023527
489 Ga0070683_100081436
490 Ga0070683_100119774
491 Ga0070683_100132018
492 Ga0070683_100185303
493 Ga0070683_100211522
494 Ga0070690_100589520
495 Ga0070670_100010594
496 Ga0068869_100017699
497 Ga0070666_10028737
498 Ga0070680_100055469
499 Ga0070682_100141346
500 Ga0068868_100004476
501 Ga0068868_100015337
502 Ga0068868_100022297
503 Ga0070660_100006768
504 Ga0070660_100069979
505 Ga0070660_100101301
506 Ga0070660_100709456
507 Ga0070689_100490055
508 Ga0070661_100004616
509 Ga0070661_100107987
510 Ga0070661_100191417
511 Ga0070668_100061780
512 Ga0070675_100025013
513 Ga0070671_100025737
514 Ga0070671_100027068
515 Ga0070671_100131020
516 Ga0070671_101543993
517 Ga0070674_100279623
518 Ga0070673_100023375
519 Ga0070659_100358880
520 Ga0070667_100006815
521 Ga0070667_100049090
522 Ga0070709_10385238
523 Ga0070713_100010367
524 Ga0070713_100278744
525 Ga0070713_101225768
526 Ga0070713_101801688
527 Ga0070711_100102773
528 Ga0070711_100285151
529 Ga0070662_100082083
530 Ga0070681_10003755
531 Ga0068867_100111510
532 Ga0070707_100634266
533 Ga0070679_100112249
534 Ga0070679_100395794
535 Ga0070684_100002861
536 Ga0070684_100005055
537 Ga0070684_100021807
538 Ga0070684_100050758
539 Ga0070684_100210312
540 Ga0070684_100628123
541 Ga0068853_100004104
542 Ga0068853_100044174
543 Ga0068853_100047503
544 Ga0068853_100084324
545 Ga0070672_100119666
546 Ga0070665_100171818
547 Ga0070665_100263048
548 Ga0068855_100000819
549 Ga0068855_100012254
550 Ga0068855_100014110
551 Ga0068855_100026325
552 Ga0068855_100057916
553 Ga0068855_100072112
554 Ga0068855_100152156
555 Ga0068855_100532933
556 Ga0070664_100136329
557 Ga0070664_100253364
558 Ga0070664_101173276
559 Ga0068857_100001991
560 Ga0068857_100083477
561 Ga0068857_100335207
562 Ga0068857_102104193
563 Ga0068854_100050763
564 Ga0068854_100058150
565 Ga0068854_100368625
566 Ga0068856_100001782
567 Ga0068856_100008091
568 Ga0068856_100011451
569 Ga0068856_100015606
570 Ga0068856_100060352
571 Ga0068856_100096510
572 Ga0068856_101273779
573 Ga0068852_100003017
574 Ga0068852_100003172
575 Ga0068852_100003318
576 Ga0068852_100008628
577 Ga0068852_100087380
578 Ga0068852_100209058
579 Ga0068859_100083756
580 Ga0068864_100001011
581 Ga0068864_100150477
582 Ga0068861_100796862
583 Ga0068851_10016720
584 Ga0068851_10092843
585 Ga0068863_100001678
586 Ga0068863_100007398
587 Ga0068858_100003486
588 Ga0068858_100203322
589 Ga0068860_100007224
590 Ga0068860_100023371
591 Ga0068862_100244391
592 Ga0070717_10216768
593 Ga0070712_100082293
594 Ga0097621_100003579
595 Ga0097621_100039628
596 Ga0097621_100666811
597 Ga0068871_100003833
598 Ga0068871_100020118
599 Ga0068871_100028898
600 Ga0068865_100054112
601 Ga0097620_100083764
602 Ga0105240_10003431
603 Ga0105240_10009850
604 Ga0105240_10015189
605 Ga0105240_10015938
606 Ga0105240_10034845
607 Ga0105240_10045449
608 Ga0105240_10054107
609 Ga0105240_10084928
610 Ga0105240_10232022
611 Ga0105240_10311733
612 Ga0105240_10549288
613 Ga0105245_10002580
614 Ga0105245_10006340
615 Ga0105245_10152482
616 Ga0105247_10016685
617 Ga0105247_10094104
618 Ga0105247_10168380
619 Ga0105247_10237364
620 Ga0105243_10283629
621 Ga0105241_10000199
622 Ga0105241_10002734
623 Ga0105241_10013210
624 Ga0105241_10018485
625 Ga0105242_10273003
626 Ga0105248_10000004
627 Ga0105248_10000255
628 Ga0105248_10093925
629 Ga0105248_10205747
630 Ga0105248_10400748
631 Ga0105248_11044186
632 Ga0105237_10003805
633 Ga0105237_10019484
634 Ga0105237_10050367
635 Ga0105237_10230918
636 Ga0105237_10265446
637 Ga0105237_10335127
638 Ga0105237_10932060
639 Ga0105238_10000262
640 Ga0105238_10000292
641 Ga0105238_10001340
642 Ga0105238_10007813
643 Ga0105238_10052982
644 Ga0105238_10230330
645 Ga0105249_10064494
646 Ga0105239_10001873
647 Ga0105239_10004032
648 Ga0105239_10007426
649 Ga0105239_10054842
650 Ga0105239_10096949
651 Ga0105239_10337112
652 Ga0105246_10006772
653 Ga0157371_10636039
654 Ga0157371_11376216
655 Ga0157370_10000107
656 Ga0157370_10011099
657 Ga0157370_10628620
658 Ga0157369_10000275
659 Ga0157369_10002075
660 Ga0157369_10003741
661 Ga0157369_10014204
662 Ga0157369_10017062
663 Ga0157369_10021414
664 Ga0157369_10099468
665 Ga0157369_10112954
666 Ga0157374_10009059
667 Ga0157374_10009888
668 Ga0157374_10043879
669 Ga0157374_10076869
670 Ga0157374_10216396
671 Ga0157374_10220706
672 Ga0157374_10281361
673 Ga0157378_10017511
674 Ga0157378_10029194
675 Ga0157378_10078165
676 Ga0157378_10200606
677 Ga0163162_10046586
678 Ga0163162_10050845
679 Ga0157372_10000127
680 Ga0157372_10001526
681 Ga0157372_10023808
682 Ga0157372_10024442
683 Ga0157372_10096852
684 Ga0157372_10099093
685 Ga0157372_10112432
686 Ga0157372_10140757
687 Ga0157372_10659316
688 Ga0157372_11170114
689 Ga0157372_11216116
690 Ga0157375_10011935
691 Ga0157375_10015926
692 Ga0157375_10032288
693 Ga0163163_10065040
694 Ga0163163_10122743
695 Ga0157379_10005183
696 Ga0157379_10018173
697 Ga0157379_10074904
698 Ga0157379_10140759
699 Ga0157376_10001195
700 Ga0157376_10104173
701 Ga0157376_10451857
702 Ga0157376_10783365
703 Ga0157376_11427551
704 Ga0197907_10267824
705 Ga0197907_11423606
706 Ga0206356_10472776
707 Ga0206356_11265128
708 Ga0206349_1043956
709 Ga0206355_1296097
710 Ga0206351_10793572
711 Ga0206350_10409333
712 Ga0206350_10415166
713 Ga0206350_10468688
714 Ga0206350_10594951
715 Ga0206350_10734905
716 Ga0206354_11255689
717 Ga0154015_1017332
718 Ga0154015_1346029
719 Ga0224712_10042657
720 Ga0224712_10047145
721 Ga0224712_10183636
722 Ga0207697_10026675
723 Ga0207656_10029705
724 Ga0207656_10039750
725 Ga0207656_10057652
726 Ga0207710_10008632
727 Ga0207710_10432714
728 Ga0207688_10034034
729 Ga0207680_10056777
730 Ga0207647_10046122
731 Ga0207699_10188194
732 Ga0207645_10005882
733 Ga0207705_10051275
734 Ga0207705_10859516
735 Ga0207705_10949577
736 Ga0207654_10000219
737 Ga0207654_10006439
738 Ga0207654_10123076
739 Ga0207654_10130565
740 Ga0207707_10030886
741 Ga0207695_10000233
742 Ga0207695_10000258
743 Ga0207695_10000501
744 Ga0207695_10005107
745 Ga0207695_10089803
746 Ga0207695_10095375
747 Ga0207695_10137036
748 Ga0207695_10155027
749 Ga0207695_10585786
750 Ga0207671_10000022
751 Ga0207671_10001087
752 Ga0207671_10123056
753 Ga0207671_10194123
754 Ga0207671_10511822
755 Ga0207663_10084866
756 Ga0207660_11530257
757 Ga0207657_10018488
758 Ga0207657_10107475
759 Ga0207649_10014261
760 Ga0207649_10275862
761 Ga0207652_10399520
762 Ga0207694_10000009
763 Ga0207694_10000682
764 Ga0207694_10001146
765 Ga0207694_10078940
766 Ga0207694_10383834
767 Ga0207694_10426113
768 Ga0207650_10093216
769 Ga0207659_10110682
770 Ga0207687_10112375
771 Ga0207700_10002175
772 Ga0207700_11015879
773 Ga0207664_10593772
774 Ga0207664_11513500
775 Ga0207644_10240824
776 Ga0207644_10772030
777 Ga0207706_10013501
778 Ga0207691_10010218
779 Ga0207711_10000008
780 Ga0207711_10000010
781 Ga0207711_10016171
782 Ga0207711_10053830
783 Ga0207711_10184420
784 Ga0207711_10445447
785 Ga0207711_11124914
786 Ga0207689_10000543
787 Ga0207689_10028697
788 Ga0207661_10002791
789 Ga0207661_10017763
790 Ga0207661_10074641
791 Ga0207661_10111456
792 Ga0207661_10149798
793 Ga0207661_10164465
794 Ga0207679_10050554
795 Ga0207679_10259251
796 Ga0207679_10549772
797 Ga0207679_11362932
798 Ga0207667_10000930
799 Ga0207667_10007052
800 Ga0207667_10007746
801 Ga0207667_10011149
802 Ga0207667_10034303
803 Ga0207667_10090955
804 Ga0207667_11131028
805 Ga0207667_11635279
806 Ga0207651_10055776
807 Ga0207712_10078847
808 Ga0207640_10042322
809 Ga0207640_11021407
810 Ga0207658_10048455
811 Ga0207677_10002256
812 Ga0207677_10026651
813 Ga0207677_10137836
814 Ga0207703_10059545
815 Ga0207639_10002669
816 Ga0207639_10067330
817 Ga0207639_10126360
818 Ga0207639_10155986
819 Ga0207639_10388829
820 Ga0207678_10407698
821 Ga0207678_10433022
822 Ga0207678_10541288
823 Ga0207702_10008532
824 Ga0207702_10026962
825 Ga0207702_10032700
826 Ga0207702_10227246
827 Ga0207702_10426695
828 Ga0207702_11953066
829 Ga0207641_10077999
830 Ga0207648_10085315
831 Ga0207676_10002800
832 Ga0207676_10087223
833 Ga0207674_10001761
834 Ga0207674_10003906
835 Ga0207674_10054691
836 Ga0207674_10348926
837 Ga0207674_12204808
838 Ga0207675_100410887
839 Ga0207683_10000329
840 Ga0207698_10000109
841 Ga0207698_10002320
842 Ga0207698_10099352
843 Ga0207698_10107593
844 Ga0207698_10287994
845 Ga0207698_10687859
846 Ga0207698_11642412
847 Ga0268266_10014819
848 Ga0268266_10108658
849 Ga0268266_10159323
850 Ga0268265_10228555
851 Ga0268264_10025217
852 Ga0268264_10156792
853 Ga0265318_10045097
854 Ga0265318_10075307
855 Ga0265338_10027301
856 Ga0265338_10271109
857 Ga0265338_10862060
858 Ga0265760_10061032
859 Ga0265330_10002436
860 Ga0265330_10023360
861 Ga0265330_10099791
862 Ga0265330_10211166
863 Ga0265332_10081563
864 Ga0265328_10026137
865 Ga0265325_10000115
866 Ga0265325_10016335
867 Ga0265325_10038953
868 Ga0265325_10039205
869 Ga0265325_10069413
870 Ga0265325_10133480
871 Ga0265325_10300878
872 Ga0265329_10038904
873 Ga0265340_10011351
874 Ga0265340_10076277
875 Ga0265340_10183842
876 Ga0265340_10186772
877 Ga0265339_10000557
878 Ga0265339_10000694
879 Ga0265339_10073954
880 Ga0265339_10115569
881 Ga0265339_10178398
882 Ga0265316_10001818
883 Ga0265316_10016452
884 Ga0265316_10067550
885 Ga0265316_10092590
886 Ga0265316_10151408
887 Ga0265316_10184800
888 Ga0265316_10195559
889 Ga0265316_10379797
890 Ga0265316_10625101
891 Ga0265316_10867674
892 Ga0265316_10974559
893 Ga0265313_10003472
894 Ga0265313_10011695
895 Ga0265313_10095748
896 Ga0265313_10097836
897 Ga0265313_10151303
898 Ga0265314_10000081
899 Ga0265314_10106077
900 Ga0265314_10277204
901 Ga0265314_10379889
902 Ga0265342_10001506
903 Ga0265342_10004150
904 Ga0265342_10009471
905 Ga0265342_10018805
906 Ga0265342_10041111
907 Ga0265342_10087771
908 Ga0265342_10098523
909 Ga0265342_10154162
910 Ga0265342_10256064
911 Ga0373954_0076840
912 Ga0373957_0194809
913 Ga0373924_0209670
914 Ga0373933_0039060
915 Ga0373933_0434519
916 Ga0373933_0488710
917 Ga0373937_0350370
918 Ga0373937_1249489
919 Ga0373937_1699522
920 Ga0373925_0958434
921 Ga0451839_0442806
922 Ga0439448_0157294
923 Ga0466969_0086927
924 Ga0466961_0279632
925 Ga0466961_0329083
926 Ga0466963_0000873
927 Ga0466970_0710099
928 Ga0466958_0563442
929 Ga0466967_0003352
930 Ga0495603_0036976
931 Ga0495629_0030602
932 Ga0495629_0229166
933 Ga0495580_0342020
934 Ga0495580_0525451
935 Ga0495582_0288496
936 Ga0495662_0253924
937 Ga0495645_0051474
938 Ga0495623_0215749
939 Ga0495669_0264642
940 Ga0495613_0348890
941 Ga0495613_1026911
942 Ga0495676_0647637
943 Ga0495602_0513917
944 Ga0496101_0297462
945 Ga0496105_0076727
946 Ga0496105_0415183
947 Ga0496106_0045792
948 Ga0496107_0260916
949 Ga0496108_0244276
950 Ga0496114_0516949
951 Ga0496114_0650020
952 Ga0496114_0739394
953 Ga0496115_0124505
954 Ga0496115_0130462
955 Ga0496115_0644991
956 Ga0496126_0015586
957 Ga0501080_0492444
958 Ga0495601_0105045
959 Ga0495619_0057510
960 Ga0500644_0063631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

8

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9113 2 124
2dtt-assembly2.cif.gz_D crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9087 31 124
2dtt-assembly2.cif.gz_F crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8969 31 124
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.8965 2 123
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.8961 2 124
ID Description Score Start End Superfamily
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9087 31 124 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8897 2 124 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8782 2 124 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.877 2 124 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8069 2 124 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A2Z5G7B0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9541 38 124 GO:0046872
GO:0070497
AF-A0A2D4K2E0-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase (EC 4.2.3.12) 0.9522 33 124 GO:0003874
GO:0005739
GO:0006729
GO:0046872
AF-A0A2V7EY97-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9503 36 124 GO:0046872
GO:0070497
AF-A0A673IJ26-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase (EC 4.2.3.12) 0.9468 35 124 GO:0003874
GO:0005739
GO:0006729
GO:0046872
AF-A0A6B0RJG8-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase (EC 4.2.3.12) 0.9369 28 124 GO:0003874
GO:0005739
GO:0006729
GO:0046872

Map