F451886

General Info

Members Datasets Scaffolds Average Seq Length
478 205 956 144

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10627320|Ga0207695_106273202
Length 167
Sequence MEVNFEIGLGLRNKAAAFFGWSNTELFERHTRRAVDFDPIFHFVLFAVLVINLIVAVLYLIHNPGFHGAWLVVLSIAAFLLVFKVRLYPLKVQDRVIRLEERLRLQALAPAEWHTQIYRLNEDQLVGLRFAGDTEVVELAKQALEHNLNRKQIKERIKDWRADEFRV

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.93
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 28.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10627320 3300025913 Unclassified 956
2 Ga0065712_10381625 3300005290 Bacteria 751
3 Ga0070658_10015493 3300005327 Bacteria 6099
4 Ga0070658_10547913 3300005327 Unclassified 1001
5 Ga0070683_100000282 3300005329 Bacteria 34970
6 Ga0070683_100048840 3300005329 Bacteria 3912
7 Ga0070683_100067405 3300005329 Unclassified 3334
8 Ga0070683_100260996 3300005329 Unclassified 1648
9 Ga0070670_100208956 3300005331 Bacteria 1697
10 Ga0068869_100012168 3300005334 Bacteria 5675
11 Ga0070666_10033382 3300005335 Bacteria 3404
12 Ga0070680_100002690 3300005336 Bacteria 13176
13 Ga0070682_100243579 3300005337 Unclassified 1292
14 Ga0068868_100021039 3300005338 Bacteria 4911
15 Ga0068868_100024338 3300005338 Bacteria 4594
16 Ga0068868_100095100 3300005338 Unclassified 2404
17 Ga0070660_100001506 3300005339 Bacteria 15965
18 Ga0070691_10351605 3300005341 Unclassified 818
19 Ga0070661_100089769 3300005344 Bacteria 2276
20 Ga0070661_100130293 3300005344 Archaea 1888
21 Ga0070661_100280089 3300005344 Bacteria 1293
22 Ga0070661_100703925 3300005344 Unclassified 823
23 Ga0070692_10465804 3300005345 Unclassified 812
24 Ga0070668_100063224 3300005347 Bacteria 2869
25 Ga0070669_100250422 3300005353 Bacteria 1410
26 Ga0070675_100077649 3300005354 Unclassified 2764
27 Ga0070671_100146884 3300005355 Bacteria 1990
28 Ga0070671_100160141 3300005355 Bacteria 1903
29 Ga0070673_100003419 3300005364 Bacteria 9885
30 Ga0070659_100129655 3300005366 Bacteria 2047
31 Ga0070659_100840306 3300005366 Unclassified 800
32 Ga0070667_100014923 3300005367 Bacteria 6417
33 Ga0070667_100084215 3300005367 Bacteria 2725
34 Ga0070714_100166142 3300005435 Bacteria 2000
35 Ga0070714_100270596 3300005435 Bacteria 1575
36 Ga0070714_101448340 3300005435 Unclassified 671
37 Ga0070713_100056223 3300005436 Unclassified 3273
38 Ga0070713_100083023 3300005436 Bacteria 2738
39 Ga0070713_100888444 3300005436 Unclassified 857
40 Ga0070710_10331497 3300005437 Unclassified 1002
41 Ga0070711_100428550 3300005439 Bacteria 1079
42 Ga0070708_100087711 3300005445 Bacteria 2828
43 Ga0070678_100011300 3300005456 Bacteria 5501
44 Ga0070662_100034137 3300005457 Bacteria 3586
45 Ga0070681_10002976 3300005458 Bacteria 15719
46 Ga0070679_100003299 3300005530 Bacteria 14769
47 Ga0070684_100000597 3300005535 Bacteria 24821
48 Ga0070684_100041695 3300005535 Bacteria 3959
49 Ga0070684_100059769 3300005535 Bacteria 3333
50 Ga0070684_100166680 3300005535 Archaea 2000
51 Ga0070684_101482049 3300005535 Unclassified 639
52 Ga0068853_100011945 3300005539 Bacteria 7064
53 Ga0068853_100103590 3300005539 Bacteria 2519
54 Ga0068853_101139797 3300005539 Bacteria 752
55 Ga0068853_101434694 3300005539 Unclassified 668
56 Ga0070672_100001524 3300005543 Bacteria 14352
57 Ga0070672_100075971 3300005543 Bacteria 2683
58 Ga0070665_100146867 3300005548 Bacteria 2361
59 Ga0068855_100007984 3300005563 Bacteria 12783
60 Ga0068855_100170459 3300005563 Archaea 2465
61 Ga0068855_100178255 3300005563 Unclassified 2403
62 Ga0068855_100596137 3300005563 Unclassified 1192
63 Ga0070664_100008968 3300005564 Bacteria 8113
64 Ga0070664_100084447 3300005564 Bacteria 2741
65 Ga0068857_100001190 3300005577 Bacteria 20329
66 Ga0068857_100002013 3300005577 Bacteria 16481
67 Ga0068857_100136231 3300005577 Bacteria 2217
68 Ga0068857_100230371 3300005577 Bacteria 1694
69 Ga0068854_100071772 3300005578 Unclassified 2534
70 Ga0068854_100236576 3300005578 Unclassified 1452
71 Ga0068854_100354124 3300005578 Bacteria 1202
72 Ga0068854_101960240 3300005578 Unclassified 539
73 Ga0068856_100008160 3300005614 Bacteria 10211
74 Ga0068856_100021854 3300005614 Bacteria 6218
75 Ga0068856_100045251 3300005614 Bacteria 4332
76 Ga0068856_100061266 3300005614 Bacteria 3716
77 Ga0068856_100068151 3300005614 Bacteria 3517
78 Ga0068856_100474231 3300005614 Unclassified 1272
79 Ga0068856_100797567 3300005614 Unclassified 964
80 Ga0068852_100000017 3300005616 Bacteria 132313
81 Ga0068852_100022418 3300005616 Bacteria 5065
82 Ga0068852_100055306 3300005616 Bacteria 3425
83 Ga0068852_100150766 3300005616 Bacteria 2162
84 Ga0068852_100517163 3300005616 Unclassified 1191
85 Ga0068859_100002738 3300005617 Bacteria 17886
86 Ga0068864_100038590 3300005618 Bacteria 4080
87 Ga0068864_100357797 3300005618 Unclassified 1379
88 Ga0068866_10051896 3300005718 Bacteria 2090
89 Ga0068861_100299566 3300005719 Bacteria 1392
90 Ga0068851_10008211 3300005834 Bacteria 4819
91 Ga0068851_10025255 3300005834 Bacteria 2914
92 Ga0068851_10063861 3300005834 Unclassified 1891
93 Ga0068851_10067316 3300005834 Unclassified 1847
94 Ga0068863_100003883 3300005841 Bacteria 14785
95 Ga0068863_100015945 3300005841 Bacteria 7206
96 Ga0068858_100024002 3300005842 Bacteria 5681
97 Ga0068858_100073478 3300005842 Bacteria 3174
98 Ga0068858_101263643 3300005842 Unclassified 726
99 Ga0068860_100008090 3300005843 Bacteria 10471
100 Ga0068860_100184304 3300005843 Bacteria 2018
101 Ga0068862_100433098 3300005844 Unclassified 1236
102 Ga0081539_10018234 3300005985 Bacteria 4881
103 Ga0070717_10703325 3300006028 Unclassified 918
104 Ga0097621_100050872 3300006237 Bacteria 3370
105 Ga0068871_100001265 3300006358 Bacteria 16909
106 Ga0068871_100078360 3300006358 Bacteria 2732
107 Ga0097620_100002738 3300006931 Bacteria 17886
108 Ga0105250_10512914 3300009092 Unclassified 545
109 Ga0105240_10000110 3300009093 Bacteria 171018
110 Ga0105240_10000480 3300009093 Bacteria 73703
111 Ga0105240_10002039 3300009093 Bacteria 33267
112 Ga0105240_10002142 3300009093 Bacteria 32242
113 Ga0105240_10005844 3300009093 Bacteria 18243
114 Ga0105240_10007039 3300009093 Bacteria 16410
115 Ga0105240_10053490 3300009093 Bacteria 5068
116 Ga0105240_10196769 3300009093 Bacteria 2365
117 Ga0105240_10394463 3300009093 Bacteria 1560
118 Ga0105240_10520083 3300009093 Unclassified 1321
119 Ga0105240_11336462 3300009093 Unclassified 755
120 Ga0105245_10009678 3300009098 Bacteria 8408
121 Ga0105245_10143643 3300009098 Bacteria 2250
122 Ga0105245_10149772 3300009098 Bacteria 2205
123 Ga0105245_10182554 3300009098 Bacteria 2005
124 Ga0105247_10072019 3300009101 Bacteria 2163
125 Ga0105247_10079568 3300009101 Bacteria 2063
126 Ga0105241_10000029 3300009174 Bacteria 125929
127 Ga0105241_10017864 3300009174 Bacteria 5216
128 Ga0105241_10025230 3300009174 Bacteria 4417
129 Ga0105241_10028799 3300009174 Unclassified 4139
130 Ga0105241_10065467 3300009174 Archaea 2808
131 Ga0105241_10073011 3300009174 Bacteria 2668
132 Ga0105241_10190028 3300009174 Bacteria 1709
133 Ga0105241_11176376 3300009174 Unclassified 725
134 Ga0105242_10326976 3300009176 Bacteria 1408
135 Ga0105248_10000795 3300009177 Bacteria 35418
136 Ga0105248_10061474 3300009177 Bacteria 4217
137 Ga0105248_10141518 3300009177 Bacteria 2714
138 Ga0105248_10238123 3300009177 Bacteria 2049
139 Ga0105237_10058311 3300009545 Bacteria 3864
140 Ga0105237_10066423 3300009545 Unclassified 3602
141 Ga0105237_10074573 3300009545 Bacteria 3385
142 Ga0105237_10119678 3300009545 Bacteria 2627
143 Ga0105238_10001519 3300009551 Bacteria 23247
144 Ga0105238_10002104 3300009551 Bacteria 20114
145 Ga0105238_10018796 3300009551 Bacteria 7035
146 Ga0105238_10031052 3300009551 Bacteria 5439
147 Ga0105238_10112723 3300009551 Bacteria 2699
148 Ga0105238_10138838 3300009551 Unclassified 2408
149 Ga0105238_10212145 3300009551 Unclassified 1912
150 Ga0105249_10104279 3300009553 Bacteria 2672
151 Ga0105239_10012699 3300010375 Bacteria 9371
152 Ga0105239_10092379 3300010375 Archaea 3341
153 Ga0105239_10128823 3300010375 Bacteria 2813
154 Ga0105239_10258940 3300010375 Bacteria 1955
155 Ga0105239_10298301 3300010375 Bacteria 1815
156 Ga0105239_13160682 3300010375 Unclassified 536
157 Ga0105239_13453346 3300010375 Bacteria 514
158 Ga0105246_10030157 3300011119 Bacteria 3579
159 Ga0105246_10162351 3300011119 Bacteria 1703
160 Ga0157373_10151434 3300013100 Unclassified 1631
161 Ga0157373_10414279 3300013100 Unclassified 967
162 Ga0157373_10657647 3300013100 Unclassified 766
163 Ga0157373_10879736 3300013100 Unclassified 664
164 Ga0157371_10038049 3300013102 Bacteria 3443
165 Ga0157371_10139730 3300013102 Bacteria 1725
166 Ga0157370_10000001 3300013104 Bacteria 529517
167 Ga0157370_10016216 3300013104 Bacteria 7551
168 Ga0157369_10000017 3300013105 Bacteria 246520
169 Ga0157369_10001363 3300013105 Bacteria 30141
170 Ga0157369_10010452 3300013105 Bacteria 10572
171 Ga0157369_10020706 3300013105 Bacteria 7354
172 Ga0157369_10033309 3300013105 Bacteria 5662
173 Ga0157369_10073216 3300013105 Bacteria 3676
174 Ga0157369_10188438 3300013105 Bacteria 2168
175 Ga0157369_10220124 3300013105 Unclassified 1987
176 Ga0157374_10021006 3300013296 Bacteria 5801
177 Ga0157374_10025530 3300013296 Bacteria 5307
178 Ga0157374_10076619 3300013296 Bacteria 3163
179 Ga0157374_10123959 3300013296 Bacteria 2496
180 Ga0157374_10143300 3300013296 Unclassified 2320
181 Ga0157374_10212026 3300013296 Unclassified 1899
182 Ga0157374_10862952 3300013296 Unclassified 922
183 Ga0157378_10025330 3300013297 Bacteria 5225
184 Ga0157378_10132075 3300013297 Bacteria 2312
185 Ga0157378_10267318 3300013297 Bacteria 1643
186 Ga0157378_11856359 3300013297 Unclassified 651
187 Ga0157378_12645092 3300013297 Unclassified 554
188 Ga0163162_10019036 3300013306 Bacteria 6733
189 Ga0163162_10234387 3300013306 Bacteria 1966
190 Ga0163162_10312258 3300013306 Unclassified 1704
191 Ga0163162_11277594 3300013306 Unclassified 834
192 Ga0157372_10000019 3300013307 Bacteria 209591
193 Ga0157372_10000581 3300013307 Bacteria 39954
194 Ga0157372_10000968 3300013307 Bacteria 31318
195 Ga0157372_10014538 3300013307 Bacteria 8423
196 Ga0157372_10044099 3300013307 Unclassified 4941
197 Ga0157372_10076276 3300013307 Unclassified 3785
198 Ga0157372_10084715 3300013307 Bacteria 3593
199 Ga0157372_10114520 3300013307 Bacteria 3091
200 Ga0157372_11054824 3300013307 Bacteria 941
201 Ga0157375_10198050 3300013308 Bacteria 2164
202 Ga0157375_10307756 3300013308 Bacteria 1749
203 Ga0157375_10394420 3300013308 Bacteria 1551
204 Ga0157375_10559321 3300013308 Bacteria 1305
205 Ga0157375_10624488 3300013308 Bacteria 1235
206 Ga0157375_10874458 3300013308 Unclassified 1044
207 Ga0163163_10001460 3300014325 Bacteria 19976
208 Ga0163163_10125935 3300014325 Bacteria 2600
209 Ga0163163_10241121 3300014325 Bacteria 1857
210 Ga0157377_10414742 3300014745 Bacteria 920
211 Ga0157377_10872180 3300014745 Bacteria 670
212 Ga0157379_10000374 3300014968 Bacteria 36109
213 Ga0157379_10010442 3300014968 Bacteria 8094
214 Ga0157379_10027706 3300014968 Bacteria 5044
215 Ga0157379_10235767 3300014968 Unclassified 1659
216 Ga0157379_10275834 3300014968 Bacteria 1530
217 Ga0157376_10019696 3300014969 Bacteria 5206
218 Ga0157376_10064834 3300014969 Bacteria 3082
219 Ga0157376_10104193 3300014969 Unclassified 2485
220 Ga0157376_10494051 3300014969 Bacteria 1201
221 Ga0163161_10149689 3300017792 Bacteria 1773
222 Ga0206352_11343048 3300020078 Bacteria 647
223 Ga0207697_10026114 3300025315 Bacteria 2389
224 Ga0207656_10023057 3300025321 Bacteria 2503
225 Ga0207656_10027688 3300025321 Unclassified 2320
226 Ga0207656_10055213 3300025321 Unclassified 1728
227 Ga0207710_10006326 3300025900 Bacteria 5063
228 Ga0207688_10194736 3300025901 Bacteria 1213
229 Ga0207680_10059260 3300025903 Bacteria 2324
230 Ga0207680_10131494 3300025903 Bacteria 1650
231 Ga0207647_10083981 3300025904 Bacteria 1906
232 Ga0207647_10095322 3300025904 Bacteria 1772
233 Ga0207645_10064380 3300025907 Bacteria 2343
234 Ga0207645_10132182 3300025907 Bacteria 1624
235 Ga0207654_10000039 3300025911 Bacteria 105913
236 Ga0207654_10001354 3300025911 Bacteria 12999
237 Ga0207654_10069427 3300025911 Bacteria 2088
238 Ga0207654_10251259 3300025911 Unclassified 1185
239 Ga0207654_10723833 3300025911 Unclassified 716
240 Ga0207707_10004167 3300025912 Bacteria 12808
241 Ga0207695_10000026 3300025913 Bacteria 624558
242 Ga0207695_10000161 3300025913 Bacteria 199839
243 Ga0207695_10001682 3300025913 Bacteria 35568
244 Ga0207695_10010889 3300025913 Bacteria 11072
245 Ga0207695_10023701 3300025913 Bacteria 6926
246 Ga0207695_10041748 3300025913 Bacteria 4907
247 Ga0207695_10284190 3300025913 Unclassified 1548
248 Ga0207695_10328830 3300025913 Bacteria 1417
249 Ga0207695_11271319 3300025913 Bacteria 616
250 Ga0207671_10000082 3300025914 Bacteria 146424
251 Ga0207671_10277315 3300025914 Unclassified 1322
252 Ga0207663_10210570 3300025916 Bacteria 1408
253 Ga0207660_10004670 3300025917 Bacteria 8920
254 Ga0207657_10005001 3300025919 Bacteria 13929
255 Ga0207649_10016167 3300025920 Bacteria 4202
256 Ga0207649_10077922 3300025920 Archaea 2137
257 Ga0207649_10179993 3300025920 Bacteria 1479
258 Ga0207649_10259230 3300025920 Bacteria 1256
259 Ga0207649_10303523 3300025920 Unclassified 1168
260 Ga0207652_10092375 3300025921 Bacteria 2662
261 Ga0207694_10000769 3300025924 Bacteria 28761
262 Ga0207694_10001303 3300025924 Bacteria 21502
263 Ga0207694_10004138 3300025924 Bacteria 11393
264 Ga0207694_10045861 3300025924 Bacteria 3377
265 Ga0207694_10245154 3300025924 Bacteria 1465
266 Ga0207694_10314492 3300025924 Unclassified 1291
267 Ga0207650_10004956 3300025925 Bacteria 9097
268 Ga0207650_10588724 3300025925 Unclassified 935
269 Ga0207659_10011975 3300025926 Bacteria 5496
270 Ga0207687_10266630 3300025927 Bacteria 1367
271 Ga0207700_10033915 3300025928 Unclassified 3658
272 Ga0207700_10051607 3300025928 Bacteria 3070
273 Ga0207664_10092534 3300025929 Bacteria 2482
274 Ga0207664_10279992 3300025929 Bacteria 1463
275 Ga0207644_10351844 3300025931 Unclassified 1196
276 Ga0207644_10633173 3300025931 Unclassified 889
277 Ga0207690_11055271 3300025932 Unclassified 677
278 Ga0207706_10034304 3300025933 Bacteria 4515
279 Ga0207669_10761774 3300025937 Bacteria 800
280 Ga0207704_10050536 3300025938 Bacteria 2508
281 Ga0207665_11487434 3300025939 Unclassified 538
282 Ga0207691_10009290 3300025940 Bacteria 9435
283 Ga0207711_10001763 3300025941 Bacteria 19822
284 Ga0207711_10151772 3300025941 Bacteria 2091
285 Ga0207711_10393297 3300025941 Unclassified 1287
286 Ga0207689_10001661 3300025942 Bacteria 21097
287 Ga0207661_10000513 3300025944 Bacteria 25043
288 Ga0207661_10129185 3300025944 Unclassified 2162
289 Ga0207661_11537937 3300025944 Unclassified 609
290 Ga0207679_10006960 3300025945 Bacteria 7167
291 Ga0207679_10636063 3300025945 Bacteria 964
292 Ga0207667_10000059 3300025949 Bacteria 192543
293 Ga0207667_10006793 3300025949 Bacteria 13817
294 Ga0207667_10006925 3300025949 Bacteria 13698
295 Ga0207667_10210775 3300025949 Bacteria 1991
296 Ga0207667_10211172 3300025949 Archaea 1989
297 Ga0207712_10350972 3300025961 Bacteria 1226
298 Ga0207668_10162962 3300025972 Unclassified 1740
299 Ga0207640_10118799 3300025981 Unclassified 1889
300 Ga0207640_11916814 3300025981 Unclassified 536
301 Ga0207658_10295976 3300025986 Bacteria 1392
302 Ga0207658_10604346 3300025986 Bacteria 985
303 Ga0207677_10003194 3300026023 Bacteria 8642
304 Ga0207677_10036852 3300026023 Bacteria 3191
305 Ga0207677_10042194 3300026023 Bacteria 3023
306 Ga0207703_10064912 3300026035 Bacteria 2998
307 Ga0207639_11079702 3300026041 Bacteria 753
308 Ga0207702_10013108 3300026078 Bacteria 6892
309 Ga0207702_10062310 3300026078 Bacteria 3185
310 Ga0207702_10101821 3300026078 Unclassified 2537
311 Ga0207702_10141390 3300026078 Unclassified 2178
312 Ga0207702_10144162 3300026078 Archaea 2159
313 Ga0207702_10174593 3300026078 Bacteria 1973
314 Ga0207702_10944708 3300026078 Unclassified 855
315 Ga0207641_10017135 3300026088 Bacteria 5927
316 Ga0207676_10034040 3300026095 Bacteria 3854
317 Ga0207676_10865363 3300026095 Unclassified 885
318 Ga0207674_10001640 3300026116 Bacteria 28791
319 Ga0207674_10002375 3300026116 Bacteria 23799
320 Ga0207675_100378483 3300026118 Bacteria 1392
321 Ga0207683_10001119 3300026121 Bacteria 24387
322 Ga0207698_10000018 3300026142 Bacteria 176540
323 Ga0207698_10022235 3300026142 Bacteria 4402
324 Ga0207698_10030225 3300026142 Bacteria 3892
325 Ga0207698_10203329 3300026142 Bacteria 1776
326 Ga0207698_10696121 3300026142 Bacteria 1011
327 Ga0207698_10794140 3300026142 Bacteria 948
328 Ga0207698_11497514 3300026142 Unclassified 690
329 Ga0268265_10475596 3300028380 Unclassified 1172
330 Ga0268264_10003694 3300028381 Bacteria 13133
331 Ga0268264_10146863 3300028381 Bacteria 2110
332 Ga0265334_10028477 3300028573 Bacteria 2244
333 Ga0265318_10081619 3300028577 Unclassified 1194
334 Ga0265338_10003245 3300028800 Bacteria 23123
335 Ga0265338_10004924 3300028800 Bacteria 17749
336 Ga0265338_10011566 3300028800 Bacteria 10175
337 Ga0265338_10022343 3300028800 Bacteria 6552
338 Ga0265338_10104551 3300028800 Bacteria 2298
339 Ga0265324_10014238 3300029957 Bacteria 2947
340 Ga0265762_1001784 3300030760 Bacteria 3910
341 Ga0265762_1003742 3300030760 Unclassified 2720
342 Ga0265770_1104559 3300030878 Unclassified 580
343 Ga0265760_10014927 3300031090 Bacteria 2227
344 Ga0265760_10296804 3300031090 Unclassified 572
345 Ga0265330_10000180 3300031235 Bacteria 48901
346 Ga0265330_10001410 3300031235 Bacteria 14066
347 Ga0265330_10010141 3300031235 Bacteria 4452
348 Ga0265330_10026364 3300031235 Unclassified 2629
349 Ga0265330_10027773 3300031235 Bacteria 2555
350 Ga0265330_10044452 3300031235 Unclassified 1961
351 Ga0265330_10099800 3300031235 Unclassified 1243
352 Ga0265332_10078461 3300031238 Bacteria 1402
353 Ga0265332_10240160 3300031238 Unclassified 750
354 Ga0265328_10013296 3300031239 Bacteria 3262
355 Ga0265328_10023130 3300031239 Bacteria 2359
356 Ga0265320_10021572 3300031240 Bacteria 3460
357 Ga0265325_10000086 3300031241 Bacteria 64912
358 Ga0265325_10001896 3300031241 Bacteria 14449
359 Ga0265325_10031579 3300031241 Unclassified 2833
360 Ga0265325_10033043 3300031241 Bacteria 2759
361 Ga0265325_10074503 3300031241 Bacteria 1698
362 Ga0265325_10157788 3300031241 Unclassified 1069
363 Ga0265329_10018245 3300031242 Bacteria 2402
364 Ga0265329_10127628 3300031242 Unclassified 818
365 Ga0265340_10011892 3300031247 Unclassified 4610
366 Ga0265340_10043253 3300031247 Unclassified 2209
367 Ga0265340_10119784 3300031247 Bacteria 1212
368 Ga0265339_10000003 3300031249 Bacteria 305994
369 Ga0265339_10007851 3300031249 Bacteria 6845
370 Ga0265339_10031535 3300031249 Bacteria 2994
371 Ga0265339_10041653 3300031249 Bacteria 2547
372 Ga0265339_10069853 3300031249 Unclassified 1874
373 Ga0265339_10377371 3300031249 Unclassified 665
374 Ga0265339_10504598 3300031249 Unclassified 558
375 Ga0265331_10010205 3300031250 Bacteria 5209
376 Ga0265331_10166821 3300031250 Bacteria 997
377 Ga0265316_10002035 3300031344 Bacteria 21280
378 Ga0265316_10003587 3300031344 Bacteria 15644
379 Ga0265316_10021451 3300031344 Bacteria 5470
380 Ga0265316_10027588 3300031344 Bacteria 4699
381 Ga0265316_10063812 3300031344 Bacteria 2855
382 Ga0265316_10099571 3300031344 Bacteria 2210
383 Ga0265316_10140335 3300031344 Bacteria 1816
384 Ga0265316_10460616 3300031344 Bacteria 911
385 Ga0265316_10942684 3300031344 Unclassified 602
386 Ga0265313_10001987 3300031595 Bacteria 18447
387 Ga0265313_10002856 3300031595 Bacteria 14492
388 Ga0265313_10088233 3300031595 Bacteria 1397
389 Ga0265314_10000047 3300031711 Bacteria 194061
390 Ga0265314_10004093 3300031711 Bacteria 13736
391 Ga0265314_10024877 3300031711 Unclassified 4529
392 Ga0265314_10576482 3300031711 Unclassified 582
393 Ga0265342_10000208 3300031712 Bacteria 66250
394 Ga0265342_10000778 3300031712 Bacteria 32411
395 Ga0265342_10006498 3300031712 Bacteria 8700
396 Ga0265342_10038271 3300031712 Bacteria 2922
397 Ga0265342_10086500 3300031712 Unclassified 1802
398 Ga0265342_10300383 3300031712 Bacteria 846
399 Ga0307415_100655385 3300032126 Unclassified 942
400 Ga0316215_1001129 3300033544 Bacteria 2593
401 Ga0373931_0342428 3300035691 Bacteria 934
402 Ga0373935_0691213 3300035692 Bacteria 750
403 Ga0373937_0080988 3300036401 Bacteria 3003
404 Ga0373937_0090753 3300036401 Bacteria 2830
405 Ga0373937_0105252 3300036401 Bacteria 2622
406 Ga0373937_1246092 3300036401 Bacteria 692
407 Ga0395901_0934478 3300038443 Unclassified 847
408 Ga0466963_0149623 3300044694 Bacteria 1621
409 Ga0466963_0564006 3300044694 Unclassified 804
410 Ga0451576_1263728 3300045051 Bacteria 770
411 Ga0466967_2270516 3300045976 Unclassified 538
412 Ga0495629_0133169 3300046459 Bacteria 1731
413 Ga0495629_1030715 3300046459 Unclassified 534
414 Ga0495641_0030352 3300046461 Bacteria 2594
415 Ga0495651_0212135 3300046462 Unclassified 1347
416 Ga0495651_0618429 3300046462 Unclassified 682
417 Ga0495580_0033797 3300046472 Bacteria 3683
418 Ga0495580_0237812 3300046472 Bacteria 1249
419 Ga0495580_0338177 3300046472 Unclassified 1021
420 Ga0495582_0153085 3300046473 Bacteria 1309
421 Ga0495662_0222737 3300046476 Unclassified 930
422 Ga0495662_0230079 3300046476 Unclassified 914
423 Ga0495662_0452636 3300046476 Unclassified 630
424 Ga0495664_0006160 3300046477 Bacteria 6621
425 Ga0495664_0147155 3300046477 Unclassified 1429
426 Ga0495594_0778815 3300046499 Bacteria 539
427 Ga0495608_0400737 3300046511 Unclassified 839
428 Ga0495618_0018885 3300046514 Bacteria 4235
429 Ga0495628_0199122 3300046516 Unclassified 1509
430 Ga0495630_0080880 3300046517 Unclassified 2451
431 Ga0495630_0422984 3300046517 Unclassified 1021
432 Ga0495666_0001281 3300046526 Bacteria 12179
433 Ga0495652_0083361 3300046529 Bacteria 2632
434 Ga0495665_0174370 3300046531 Unclassified 1119
435 Ga0495665_0282673 3300046531 Unclassified 851
436 Ga0495640_0015060 3300046533 Bacteria 5827
437 Ga0495586_0003153 3300046535 Bacteria 8875
438 Ga0495586_0643823 3300046535 Unclassified 612
439 Ga0495645_0010443 3300046543 Bacteria 6509
440 Ga0495667_0236594 3300046559 Unclassified 1164
441 Ga0495667_0385703 3300046559 Unclassified 883
442 Ga0495634_0001786 3300046642 Bacteria 18595
443 Ga0495634_0142966 3300046642 Bacteria 1518
444 Ga0495635_0798296 3300046663 Unclassified 608
445 Ga0495599_0151348 3300046678 Unclassified 1437
446 Ga0495623_0156066 3300046679 Unclassified 1345
447 Ga0495647_0050776 3300046681 Unclassified 1610
448 Ga0495658_0012952 3300046683 Bacteria 4236
449 Ga0495669_0125595 3300046684 Bacteria 1205
450 Ga0495669_0224261 3300046684 Bacteria 901
451 Ga0495613_0023657 3300046689 Bacteria 4579
452 Ga0495613_0067669 3300046689 Bacteria 2607
453 Ga0495613_0605849 3300046689 Unclassified 728
454 Ga0495674_0013264 3300047319 Bacteria 7749
455 Ga0495676_0066147 3300047321 Bacteria 2803
456 Ga0495680_0009098 3300047322 Bacteria 8964
457 Ga0495675_0430308 3300047444 Unclassified 766
458 Ga0495677_0088002 3300047445 Bacteria 1169
459 Ga0495684_0027713 3300047471 Bacteria 4351
460 Ga0495684_0075502 3300047471 Unclassified 2561
461 Ga0495602_0709295 3300048088 Bacteria 682
462 Ga0496101_0163698 3300048904 Bacteria 1707
463 Ga0496102_0426902 3300048905 Bacteria 1245
464 Ga0496104_0050865 3300048907 Bacteria 3909
465 Ga0496105_0338483 3300048908 Bacteria 1203
466 Ga0496105_0442231 3300048908 Bacteria 1027
467 Ga0496106_0287002 3300048909 Unclassified 1319
468 Ga0496106_0417790 3300048909 Bacteria 1078
469 Ga0496107_0017168 3300048910 Bacteria 5091
470 Ga0496108_1190592 3300048911 Bacteria 645
471 Ga0496114_0396203 3300048917 Bacteria 1223
472 Ga0496115_0002459 3300048918 Bacteria 13306
473 Ga0496115_0256790 3300048918 Bacteria 1438
474 Ga0496115_0601115 3300048918 Bacteria 874
475 Ga0496115_0892418 3300048918 Unclassified 686
476 Ga0496126_0005093 3300048929 Bacteria 15242
477 Ga0495601_0101211 3300053077 Bacteria 1861
478 Ga0495619_0537198 3300053085 Unclassified 803
479 Ga0207695_10627320
480 Ga0065712_10381625
481 Ga0070658_10015493
482 Ga0070658_10547913
483 Ga0070683_100000282
484 Ga0070683_100048840
485 Ga0070683_100067405
486 Ga0070683_100260996
487 Ga0070670_100208956
488 Ga0068869_100012168
489 Ga0070666_10033382
490 Ga0070680_100002690
491 Ga0070682_100243579
492 Ga0068868_100021039
493 Ga0068868_100024338
494 Ga0068868_100095100
495 Ga0070660_100001506
496 Ga0070691_10351605
497 Ga0070661_100089769
498 Ga0070661_100130293
499 Ga0070661_100280089
500 Ga0070661_100703925
501 Ga0070692_10465804
502 Ga0070668_100063224
503 Ga0070669_100250422
504 Ga0070675_100077649
505 Ga0070671_100146884
506 Ga0070671_100160141
507 Ga0070673_100003419
508 Ga0070659_100129655
509 Ga0070659_100840306
510 Ga0070667_100014923
511 Ga0070667_100084215
512 Ga0070714_100166142
513 Ga0070714_100270596
514 Ga0070714_101448340
515 Ga0070713_100056223
516 Ga0070713_100083023
517 Ga0070713_100888444
518 Ga0070710_10331497
519 Ga0070711_100428550
520 Ga0070708_100087711
521 Ga0070678_100011300
522 Ga0070662_100034137
523 Ga0070681_10002976
524 Ga0070679_100003299
525 Ga0070684_100000597
526 Ga0070684_100041695
527 Ga0070684_100059769
528 Ga0070684_100166680
529 Ga0070684_101482049
530 Ga0068853_100011945
531 Ga0068853_100103590
532 Ga0068853_101139797
533 Ga0068853_101434694
534 Ga0070672_100001524
535 Ga0070672_100075971
536 Ga0070665_100146867
537 Ga0068855_100007984
538 Ga0068855_100170459
539 Ga0068855_100178255
540 Ga0068855_100596137
541 Ga0070664_100008968
542 Ga0070664_100084447
543 Ga0068857_100001190
544 Ga0068857_100002013
545 Ga0068857_100136231
546 Ga0068857_100230371
547 Ga0068854_100071772
548 Ga0068854_100236576
549 Ga0068854_100354124
550 Ga0068854_101960240
551 Ga0068856_100008160
552 Ga0068856_100021854
553 Ga0068856_100045251
554 Ga0068856_100061266
555 Ga0068856_100068151
556 Ga0068856_100474231
557 Ga0068856_100797567
558 Ga0068852_100000017
559 Ga0068852_100022418
560 Ga0068852_100055306
561 Ga0068852_100150766
562 Ga0068852_100517163
563 Ga0068859_100002738
564 Ga0068864_100038590
565 Ga0068864_100357797
566 Ga0068866_10051896
567 Ga0068861_100299566
568 Ga0068851_10008211
569 Ga0068851_10025255
570 Ga0068851_10063861
571 Ga0068851_10067316
572 Ga0068863_100003883
573 Ga0068863_100015945
574 Ga0068858_100024002
575 Ga0068858_100073478
576 Ga0068858_101263643
577 Ga0068860_100008090
578 Ga0068860_100184304
579 Ga0068862_100433098
580 Ga0081539_10018234
581 Ga0070717_10703325
582 Ga0097621_100050872
583 Ga0068871_100001265
584 Ga0068871_100078360
585 Ga0097620_100002738
586 Ga0105250_10512914
587 Ga0105240_10000110
588 Ga0105240_10000480
589 Ga0105240_10002039
590 Ga0105240_10002142
591 Ga0105240_10005844
592 Ga0105240_10007039
593 Ga0105240_10053490
594 Ga0105240_10196769
595 Ga0105240_10394463
596 Ga0105240_10520083
597 Ga0105240_11336462
598 Ga0105245_10009678
599 Ga0105245_10143643
600 Ga0105245_10149772
601 Ga0105245_10182554
602 Ga0105247_10072019
603 Ga0105247_10079568
604 Ga0105241_10000029
605 Ga0105241_10017864
606 Ga0105241_10025230
607 Ga0105241_10028799
608 Ga0105241_10065467
609 Ga0105241_10073011
610 Ga0105241_10190028
611 Ga0105241_11176376
612 Ga0105242_10326976
613 Ga0105248_10000795
614 Ga0105248_10061474
615 Ga0105248_10141518
616 Ga0105248_10238123
617 Ga0105237_10058311
618 Ga0105237_10066423
619 Ga0105237_10074573
620 Ga0105237_10119678
621 Ga0105238_10001519
622 Ga0105238_10002104
623 Ga0105238_10018796
624 Ga0105238_10031052
625 Ga0105238_10112723
626 Ga0105238_10138838
627 Ga0105238_10212145
628 Ga0105249_10104279
629 Ga0105239_10012699
630 Ga0105239_10092379
631 Ga0105239_10128823
632 Ga0105239_10258940
633 Ga0105239_10298301
634 Ga0105239_13160682
635 Ga0105239_13453346
636 Ga0105246_10030157
637 Ga0105246_10162351
638 Ga0157373_10151434
639 Ga0157373_10414279
640 Ga0157373_10657647
641 Ga0157373_10879736
642 Ga0157371_10038049
643 Ga0157371_10139730
644 Ga0157370_10000001
645 Ga0157370_10016216
646 Ga0157369_10000017
647 Ga0157369_10001363
648 Ga0157369_10010452
649 Ga0157369_10020706
650 Ga0157369_10033309
651 Ga0157369_10073216
652 Ga0157369_10188438
653 Ga0157369_10220124
654 Ga0157374_10021006
655 Ga0157374_10025530
656 Ga0157374_10076619
657 Ga0157374_10123959
658 Ga0157374_10143300
659 Ga0157374_10212026
660 Ga0157374_10862952
661 Ga0157378_10025330
662 Ga0157378_10132075
663 Ga0157378_10267318
664 Ga0157378_11856359
665 Ga0157378_12645092
666 Ga0163162_10019036
667 Ga0163162_10234387
668 Ga0163162_10312258
669 Ga0163162_11277594
670 Ga0157372_10000019
671 Ga0157372_10000581
672 Ga0157372_10000968
673 Ga0157372_10014538
674 Ga0157372_10044099
675 Ga0157372_10076276
676 Ga0157372_10084715
677 Ga0157372_10114520
678 Ga0157372_11054824
679 Ga0157375_10198050
680 Ga0157375_10307756
681 Ga0157375_10394420
682 Ga0157375_10559321
683 Ga0157375_10624488
684 Ga0157375_10874458
685 Ga0163163_10001460
686 Ga0163163_10125935
687 Ga0163163_10241121
688 Ga0157377_10414742
689 Ga0157377_10872180
690 Ga0157379_10000374
691 Ga0157379_10010442
692 Ga0157379_10027706
693 Ga0157379_10235767
694 Ga0157379_10275834
695 Ga0157376_10019696
696 Ga0157376_10064834
697 Ga0157376_10104193
698 Ga0157376_10494051
699 Ga0163161_10149689
700 Ga0206352_11343048
701 Ga0207697_10026114
702 Ga0207656_10023057
703 Ga0207656_10027688
704 Ga0207656_10055213
705 Ga0207710_10006326
706 Ga0207688_10194736
707 Ga0207680_10059260
708 Ga0207680_10131494
709 Ga0207647_10083981
710 Ga0207647_10095322
711 Ga0207645_10064380
712 Ga0207645_10132182
713 Ga0207654_10000039
714 Ga0207654_10001354
715 Ga0207654_10069427
716 Ga0207654_10251259
717 Ga0207654_10723833
718 Ga0207707_10004167
719 Ga0207695_10000026
720 Ga0207695_10000161
721 Ga0207695_10001682
722 Ga0207695_10010889
723 Ga0207695_10023701
724 Ga0207695_10041748
725 Ga0207695_10284190
726 Ga0207695_10328830
727 Ga0207695_11271319
728 Ga0207671_10000082
729 Ga0207671_10277315
730 Ga0207663_10210570
731 Ga0207660_10004670
732 Ga0207657_10005001
733 Ga0207649_10016167
734 Ga0207649_10077922
735 Ga0207649_10179993
736 Ga0207649_10259230
737 Ga0207649_10303523
738 Ga0207652_10092375
739 Ga0207694_10000769
740 Ga0207694_10001303
741 Ga0207694_10004138
742 Ga0207694_10045861
743 Ga0207694_10245154
744 Ga0207694_10314492
745 Ga0207650_10004956
746 Ga0207650_10588724
747 Ga0207659_10011975
748 Ga0207687_10266630
749 Ga0207700_10033915
750 Ga0207700_10051607
751 Ga0207664_10092534
752 Ga0207664_10279992
753 Ga0207644_10351844
754 Ga0207644_10633173
755 Ga0207690_11055271
756 Ga0207706_10034304
757 Ga0207669_10761774
758 Ga0207704_10050536
759 Ga0207665_11487434
760 Ga0207691_10009290
761 Ga0207711_10001763
762 Ga0207711_10151772
763 Ga0207711_10393297
764 Ga0207689_10001661
765 Ga0207661_10000513
766 Ga0207661_10129185
767 Ga0207661_11537937
768 Ga0207679_10006960
769 Ga0207679_10636063
770 Ga0207667_10000059
771 Ga0207667_10006793
772 Ga0207667_10006925
773 Ga0207667_10210775
774 Ga0207667_10211172
775 Ga0207712_10350972
776 Ga0207668_10162962
777 Ga0207640_10118799
778 Ga0207640_11916814
779 Ga0207658_10295976
780 Ga0207658_10604346
781 Ga0207677_10003194
782 Ga0207677_10036852
783 Ga0207677_10042194
784 Ga0207703_10064912
785 Ga0207639_11079702
786 Ga0207702_10013108
787 Ga0207702_10062310
788 Ga0207702_10101821
789 Ga0207702_10141390
790 Ga0207702_10144162
791 Ga0207702_10174593
792 Ga0207702_10944708
793 Ga0207641_10017135
794 Ga0207676_10034040
795 Ga0207676_10865363
796 Ga0207674_10001640
797 Ga0207674_10002375
798 Ga0207675_100378483
799 Ga0207683_10001119
800 Ga0207698_10000018
801 Ga0207698_10022235
802 Ga0207698_10030225
803 Ga0207698_10203329
804 Ga0207698_10696121
805 Ga0207698_10794140
806 Ga0207698_11497514
807 Ga0268265_10475596
808 Ga0268264_10003694
809 Ga0268264_10146863
810 Ga0265334_10028477
811 Ga0265318_10081619
812 Ga0265338_10003245
813 Ga0265338_10004924
814 Ga0265338_10011566
815 Ga0265338_10022343
816 Ga0265338_10104551
817 Ga0265324_10014238
818 Ga0265762_1001784
819 Ga0265762_1003742
820 Ga0265770_1104559
821 Ga0265760_10014927
822 Ga0265760_10296804
823 Ga0265330_10000180
824 Ga0265330_10001410
825 Ga0265330_10010141
826 Ga0265330_10026364
827 Ga0265330_10027773
828 Ga0265330_10044452
829 Ga0265330_10099800
830 Ga0265332_10078461
831 Ga0265332_10240160
832 Ga0265328_10013296
833 Ga0265328_10023130
834 Ga0265320_10021572
835 Ga0265325_10000086
836 Ga0265325_10001896
837 Ga0265325_10031579
838 Ga0265325_10033043
839 Ga0265325_10074503
840 Ga0265325_10157788
841 Ga0265329_10018245
842 Ga0265329_10127628
843 Ga0265340_10011892
844 Ga0265340_10043253
845 Ga0265340_10119784
846 Ga0265339_10000003
847 Ga0265339_10007851
848 Ga0265339_10031535
849 Ga0265339_10041653
850 Ga0265339_10069853
851 Ga0265339_10377371
852 Ga0265339_10504598
853 Ga0265331_10010205
854 Ga0265331_10166821
855 Ga0265316_10002035
856 Ga0265316_10003587
857 Ga0265316_10021451
858 Ga0265316_10027588
859 Ga0265316_10063812
860 Ga0265316_10099571
861 Ga0265316_10140335
862 Ga0265316_10460616
863 Ga0265316_10942684
864 Ga0265313_10001987
865 Ga0265313_10002856
866 Ga0265313_10088233
867 Ga0265314_10000047
868 Ga0265314_10004093
869 Ga0265314_10024877
870 Ga0265314_10576482
871 Ga0265342_10000208
872 Ga0265342_10000778
873 Ga0265342_10006498
874 Ga0265342_10038271
875 Ga0265342_10086500
876 Ga0265342_10300383
877 Ga0307415_100655385
878 Ga0316215_1001129
879 Ga0373931_0342428
880 Ga0373935_0691213
881 Ga0373937_0080988
882 Ga0373937_0090753
883 Ga0373937_0105252
884 Ga0373937_1246092
885 Ga0395901_0934478
886 Ga0466963_0149623
887 Ga0466963_0564006
888 Ga0451576_1263728
889 Ga0466967_2270516
890 Ga0495629_0133169
891 Ga0495629_1030715
892 Ga0495641_0030352
893 Ga0495651_0212135
894 Ga0495651_0618429
895 Ga0495580_0033797
896 Ga0495580_0237812
897 Ga0495580_0338177
898 Ga0495582_0153085
899 Ga0495662_0222737
900 Ga0495662_0230079
901 Ga0495662_0452636
902 Ga0495664_0006160
903 Ga0495664_0147155
904 Ga0495594_0778815
905 Ga0495608_0400737
906 Ga0495618_0018885
907 Ga0495628_0199122
908 Ga0495630_0080880
909 Ga0495630_0422984
910 Ga0495666_0001281
911 Ga0495652_0083361
912 Ga0495665_0174370
913 Ga0495665_0282673
914 Ga0495640_0015060
915 Ga0495586_0003153
916 Ga0495586_0643823
917 Ga0495645_0010443
918 Ga0495667_0236594
919 Ga0495667_0385703
920 Ga0495634_0001786
921 Ga0495634_0142966
922 Ga0495635_0798296
923 Ga0495599_0151348
924 Ga0495623_0156066
925 Ga0495647_0050776
926 Ga0495658_0012952
927 Ga0495669_0125595
928 Ga0495669_0224261
929 Ga0495613_0023657
930 Ga0495613_0067669
931 Ga0495613_0605849
932 Ga0495674_0013264
933 Ga0495676_0066147
934 Ga0495680_0009098
935 Ga0495675_0430308
936 Ga0495677_0088002
937 Ga0495684_0027713
938 Ga0495684_0075502
939 Ga0495602_0709295
940 Ga0496101_0163698
941 Ga0496102_0426902
942 Ga0496104_0050865
943 Ga0496105_0338483
944 Ga0496105_0442231
945 Ga0496106_0287002
946 Ga0496106_0417790
947 Ga0496107_0017168
948 Ga0496108_1190592
949 Ga0496114_0396203
950 Ga0496115_0002459
951 Ga0496115_0256790
952 Ga0496115_0601115
953 Ga0496115_0892418
954 Ga0496126_0005093
955 Ga0495601_0101211
956 Ga0495619_0537198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20136

DUF6526

Family of unknown function (DUF6526)

25

167

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8io2-assembly1.cif.gz_I the rubisco assembly intermidate of arabidopsis thaliana rubisco accumulation factor 1 (atraf1) and rubisco large subunit (rbcl) 0.8179 100 133
6kkm-assembly1.cif.gz_F-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7643 72 133
7xsd-assembly1.cif.gz_O cryo-em structure of rubisco assembly intermediate rbcl8raf18rbcx16 0.7609 74 133
6kkm-assembly1.cif.gz_H-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7585 72 133
6kkm-assembly1.cif.gz_G-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7565 72 133
ID Description Score Start End Superfamily
af_B4FR29_166_275_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8074 101 133 1.25.40.10
4fi5A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7366 25 74 1.20.58.90
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6643 81 132 1.10.10.2830
af_Q2FUQ5_107_218_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6308 78 135 1.10.10.2830
4fi5A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5465 25 74 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A3D4FUU1-F1-model_v4 Uncharacterized protein 0.9473 60 145
AF-A0A2V8HYJ4-F1-model_v4 Uncharacterized protein 0.9393 98 145 GO:0016020
AF-A0A1F2VKA3-F1-model_v4 Uncharacterized protein 0.9244 78 145
AF-A0A3D4FUU1-F1-model_v4 Uncharacterized protein 0.907 60 145
AF-A0A6L7R9V5-F1-model_v4 deleted 0.876 41 145

Map