F451674

General Info

Members Datasets Scaffolds Average Seq Length
477 216 954 266

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100083604|Ga0097621_1000836043
Length 263
Sequence MGYQYLTTRRDGPVEHVTLNRPEVRNAFNADMIGEIADWAARIAASSGELRAVVISGAGKAFCAGGDAAWMAQTVAYSDEENVRDARALAGMFRAINSLPVPVIGRVHGAAMGGGAGLAAVCDIVVAAEDATFGFTEVKLGLIPAVVSFFVLQKIGQSAARELFLTGARFPAARAYEIGLVHAVVPAADLDATVARYLGELATGGPEAIAAAKSLIAAVADIGHDEDEAAAFTADAIATRRRSAEGQEGLRAFLDKRPPRWSR

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 3.98
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100083604 3300006237 Bacteria 2660
2 Ga0065712_10086945 3300005290 Bacteria 2607
3 Ga0065715_10132264 3300005293 Bacteria 1993
4 Ga0065715_10162681 3300005293 Bacteria 1612
5 Ga0070658_10250673 3300005327 Bacteria 1502
6 Ga0070676_10025706 3300005328 Bacteria 3329
7 Ga0070676_10046714 3300005328 Bacteria 2526
8 Ga0070690_100022304 3300005330 Bacteria 3873
9 Ga0070690_100203816 3300005330 Bacteria 1378
10 Ga0070690_100354951 3300005330 Bacteria 1065
11 Ga0070670_100453888 3300005331 Bacteria 1136
12 Ga0068869_100041732 3300005334 Bacteria 3286
13 Ga0068869_100065823 3300005334 Bacteria 2669
14 Ga0068869_100193680 3300005334 Bacteria 1600
15 Ga0070666_10025613 3300005335 Bacteria 3847
16 Ga0070666_10186758 3300005335 Bacteria 1455
17 Ga0070666_10223437 3300005335 Bacteria 1329
18 Ga0070680_100035681 3300005336 Bacteria 4015
19 Ga0070680_100343119 3300005336 Bacteria 1269
20 Ga0070680_100503158 3300005336 Bacteria 1037
21 Ga0070660_100119710 3300005339 Bacteria 2100
22 Ga0070660_100320054 3300005339 Bacteria 1274
23 Ga0070689_100058191 3300005340 Bacteria 3001
24 Ga0070689_100422826 3300005340 Unclassified 1130
25 Ga0070687_100012351 3300005343 Bacteria 3770
26 Ga0070661_100367956 3300005344 Bacteria 1131
27 Ga0070661_100703850 3300005344 Bacteria 823
28 Ga0070692_10332564 3300005345 Bacteria 938
29 Ga0070668_100591621 3300005347 Bacteria 970
30 Ga0070669_100044498 3300005353 Bacteria 3235
31 Ga0070669_100054711 3300005353 Bacteria 2923
32 Ga0070669_100186702 3300005353 Bacteria 1624
33 Ga0070675_100000988 3300005354 Bacteria 20349
34 Ga0070671_100022892 3300005355 Bacteria 5106
35 Ga0070671_100719754 3300005355 Bacteria 866
36 Ga0070674_100009006 3300005356 Bacteria 5966
37 Ga0070674_100076302 3300005356 Bacteria 2383
38 Ga0070673_100006114 3300005364 Bacteria 7802
39 Ga0070673_100018951 3300005364 Bacteria 4933
40 Ga0070673_100366520 3300005364 Bacteria 1282
41 Ga0070673_100424754 3300005364 Bacteria 1192
42 Ga0070688_100225093 3300005365 Bacteria 1324
43 Ga0070688_100577255 3300005365 Bacteria 858
44 Ga0070667_100097217 3300005367 Bacteria 2540
45 Ga0070667_100282434 3300005367 Bacteria 1491
46 Ga0070667_100505446 3300005367 Bacteria 1108
47 Ga0070703_10039504 3300005406 Bacteria 1463
48 Ga0070709_10135554 3300005434 Bacteria 1686
49 Ga0070713_100149983 3300005436 Bacteria 2073
50 Ga0070711_100084328 3300005439 Bacteria 2273
51 Ga0070705_100003553 3300005440 Bacteria 7632
52 Ga0070705_100006164 3300005440 Bacteria 5871
53 Ga0070705_100021963 3300005440 Bacteria 3402
54 Ga0070705_100285898 3300005440 Bacteria 1175
55 Ga0070700_100015600 3300005441 Bacteria 4312
56 Ga0070700_100197490 3300005441 Bacteria 1411
57 Ga0070700_100463197 3300005441 Bacteria 967
58 Ga0070694_100008914 3300005444 Bacteria 6145
59 Ga0070694_100065352 3300005444 Bacteria 2492
60 Ga0070694_100146771 3300005444 Bacteria 1719
61 Ga0070708_100085965 3300005445 Bacteria 2855
62 Ga0070708_100200301 3300005445 Bacteria 1869
63 Ga0070678_100132990 3300005456 Bacteria 1979
64 Ga0070678_100605956 3300005456 Unclassified 978
65 Ga0070681_10019433 3300005458 Bacteria 6800
66 Ga0068867_100036621 3300005459 Bacteria 3563
67 Ga0068867_100159906 3300005459 Bacteria 1776
68 Ga0068867_100274261 3300005459 Bacteria 1381
69 Ga0070685_10334911 3300005466 Bacteria 1030
70 Ga0070707_100034038 3300005468 Bacteria 4860
71 Ga0070707_100055625 3300005468 Bacteria 3794
72 Ga0070707_100403655 3300005468 Bacteria 1327
73 Ga0070698_100060489 3300005471 Bacteria 3823
74 Ga0070698_100429385 3300005471 Bacteria 1256
75 Ga0070699_100001294 3300005518 Bacteria 23090
76 Ga0070699_100240248 3300005518 Bacteria 1616
77 Ga0070699_100273931 3300005518 Bacteria 1511
78 Ga0070699_100676879 3300005518 Bacteria 942
79 Ga0070679_100234834 3300005530 Bacteria 1793
80 Ga0070697_100033889 3300005536 Bacteria 4115
81 Ga0070697_100124583 3300005536 Bacteria 2158
82 Ga0070697_100248660 3300005536 Bacteria 1520
83 Ga0070672_100014823 3300005543 Bacteria 5532
84 Ga0070686_100001384 3300005544 Bacteria 13700
85 Ga0070686_100034603 3300005544 Bacteria 3114
86 Ga0070695_100030184 3300005545 Bacteria 3374
87 Ga0070695_100041717 3300005545 Bacteria 2910
88 Ga0070695_100171549 3300005545 Bacteria 1531
89 Ga0070695_100281016 3300005545 Bacteria 1223
90 Ga0070696_100039336 3300005546 Bacteria 3265
91 Ga0070696_100049854 3300005546 Bacteria 2909
92 Ga0070696_100097444 3300005546 Bacteria 2103
93 Ga0070696_100123397 3300005546 Bacteria 1877
94 Ga0070696_100345926 3300005546 Bacteria 1150
95 Ga0070665_100001655 3300005548 Bacteria 25682
96 Ga0070665_100062074 3300005548 Bacteria 3747
97 Ga0070704_100037478 3300005549 Bacteria 3313
98 Ga0070704_100092380 3300005549 Bacteria 2259
99 Ga0070704_100255260 3300005549 Bacteria 1442
100 Ga0068855_100005452 3300005563 Bacteria 15511
101 Ga0070664_100129628 3300005564 Bacteria 2215
102 Ga0070664_100244125 3300005564 Bacteria 1613
103 Ga0068857_100008286 3300005577 Bacteria 8981
104 Ga0068854_100089046 3300005578 Bacteria 2293
105 Ga0068854_100168548 3300005578 Bacteria 1702
106 Ga0068854_100275035 3300005578 Bacteria 1353
107 Ga0068852_100347574 3300005616 Bacteria 1447
108 Ga0068859_100074146 3300005617 Bacteria 3442
109 Ga0068859_100707064 3300005617 Bacteria 1098
110 Ga0068864_100032536 3300005618 Bacteria 4432
111 Ga0068866_10020101 3300005718 Bacteria 3054
112 Ga0068866_10032460 3300005718 Bacteria 2525
113 Ga0068866_10055975 3300005718 Bacteria 2028
114 Ga0068866_10229946 3300005718 Unclassified 1124
115 Ga0068861_100025238 3300005719 Bacteria 4308
116 Ga0068861_100145137 3300005719 Bacteria 1941
117 Ga0068861_100407203 3300005719 Bacteria 1208
118 Ga0068861_100443715 3300005719 Bacteria 1161
119 Ga0068851_10067375 3300005834 Bacteria 1846
120 Ga0068863_100089797 3300005841 Bacteria 2914
121 Ga0068863_100263109 3300005841 Bacteria 1668
122 Ga0068863_100556764 3300005841 Bacteria 1132
123 Ga0068863_100774024 3300005841 Bacteria 956
124 Ga0068863_100918116 3300005841 Bacteria 876
125 Ga0068858_100031242 3300005842 Bacteria 4945
126 Ga0068858_100696314 3300005842 Bacteria 989
127 Ga0068860_100049030 3300005843 Bacteria 4025
128 Ga0068860_100088059 3300005843 Bacteria 2956
129 Ga0068860_100249548 3300005843 Bacteria 1728
130 Ga0068860_100315079 3300005843 Unclassified 1535
131 Ga0068860_100456418 3300005843 Bacteria 1271
132 Ga0068862_100055816 3300005844 Bacteria 3384
133 Ga0068862_100184449 3300005844 Bacteria 1874
134 Ga0081539_10038887 3300005985 Bacteria 2814
135 Ga0075365_10025556 3300006038 Bacteria 3739
136 Ga0075364_10293999 3300006051 Bacteria 1106
137 Ga0075362_10001490 3300006177 Bacteria 7517
138 Ga0075367_10040916 3300006178 Bacteria 2707
139 Ga0075366_10029794 3300006195 Bacteria 3206
140 Ga0075366_10063295 3300006195 Bacteria 2199
141 Ga0097621_100023653 3300006237 Bacteria 4786
142 Ga0097621_100099030 3300006237 Bacteria 2450
143 Ga0097621_100115745 3300006237 Bacteria 2269
144 Ga0097621_100284021 3300006237 Bacteria 1457
145 Ga0097621_100607080 3300006237 Bacteria 1000
146 Ga0075370_10177252 3300006353 Bacteria 1254
147 Ga0068871_100038145 3300006358 Bacteria 3835
148 Ga0068871_100053510 3300006358 Bacteria 3272
149 Ga0068871_100107208 3300006358 Bacteria 2346
150 Ga0075428_100238464 3300006844 Bacteria 1962
151 Ga0075428_100282190 3300006844 Bacteria 1787
152 Ga0075428_100484722 3300006844 Bacteria 1323
153 Ga0075433_10047823 3300006852 Bacteria 3721
154 Ga0075433_10068148 3300006852 Bacteria 3123
155 Ga0075433_10518504 3300006852 Bacteria 1049
156 Ga0075434_100000237 3300006871 Bacteria 38182
157 Ga0075434_100020813 3300006871 Bacteria 6368
158 Ga0075434_100023150 3300006871 Bacteria 6050
159 Ga0075434_100120311 3300006871 Bacteria 2641
160 Ga0075434_100192670 3300006871 Bacteria 2059
161 Ga0075434_100370197 3300006871 Bacteria 1454
162 Ga0075434_100470726 3300006871 Bacteria 1278
163 Ga0075429_100413018 3300006880 Bacteria 1182
164 Ga0068865_100161932 3300006881 Bacteria 1708
165 Ga0068865_100333986 3300006881 Bacteria 1223
166 Ga0068865_100381656 3300006881 Bacteria 1149
167 Ga0075436_100000078 3300006914 Bacteria 55590
168 Ga0075436_100009968 3300006914 Bacteria 6501
169 Ga0075436_100026190 3300006914 Bacteria 4015
170 Ga0075436_100026954 3300006914 Bacteria 3958
171 Ga0075436_100086910 3300006914 Bacteria 2172
172 Ga0097620_100074150 3300006931 Bacteria 3442
173 Ga0097620_100707213 3300006931 Bacteria 1098
174 Ga0075435_100000018 3300007076 Bacteria 97506
175 Ga0075435_100002185 3300007076 Bacteria 12908
176 Ga0075435_100009919 3300007076 Bacteria 6937
177 Ga0075435_100034807 3300007076 Bacteria 3993
178 Ga0075435_100036085 3300007076 Bacteria 3927
179 Ga0075435_100050971 3300007076 Bacteria 3332
180 Ga0075435_100073686 3300007076 Bacteria 2792
181 Ga0075435_100112561 3300007076 Bacteria 2265
182 Ga0075435_100113045 3300007076 Bacteria 2259
183 Ga0075435_100292549 3300007076 Bacteria 1392
184 Ga0105240_10130166 3300009093 Bacteria 3019
185 Ga0111539_10005467 3300009094 Bacteria 16437
186 Ga0111539_10012731 3300009094 Bacteria 10533
187 Ga0111539_10054236 3300009094 Bacteria 4770
188 Ga0111539_10383739 3300009094 Bacteria 1636
189 Ga0111539_11196937 3300009094 Bacteria 882
190 Ga0105245_10078995 3300009098 Bacteria 3003
191 Ga0105245_10245796 3300009098 Bacteria 1737
192 Ga0114129_10003418 3300009147 Bacteria 22320
193 Ga0114129_10011485 3300009147 Bacteria 12609
194 Ga0114129_10011838 3300009147 Bacteria 12409
195 Ga0114129_10014445 3300009147 Bacteria 11253
196 Ga0114129_10027270 3300009147 Bacteria 8086
197 Ga0114129_10054206 3300009147 Bacteria 5623
198 Ga0114129_10083314 3300009147 Bacteria 4443
199 Ga0114129_10150397 3300009147 Bacteria 3186
200 Ga0114129_10485096 3300009147 Bacteria 1617
201 Ga0105243_10374590 3300009148 Bacteria 1315
202 Ga0105243_10444823 3300009148 Bacteria 1214
203 Ga0105241_10028233 3300009174 Bacteria 4181
204 Ga0105242_10023245 3300009176 Bacteria 4887
205 Ga0105242_10031815 3300009176 Bacteria 4217
206 Ga0105242_10177871 3300009176 Bacteria 1875
207 Ga0105242_10245255 3300009176 Bacteria 1612
208 Ga0105242_10326499 3300009176 Bacteria 1409
209 Ga0105248_10047055 3300009177 Bacteria 4837
210 Ga0105248_10048211 3300009177 Bacteria 4778
211 Ga0105248_10064150 3300009177 Bacteria 4124
212 Ga0105248_10259872 3300009177 Bacteria 1955
213 Ga0105248_10312847 3300009177 Bacteria 1769
214 Ga0105248_10354587 3300009177 Bacteria 1652
215 Ga0105249_10487855 3300009553 Bacteria 1276
216 Ga0105249_10751753 3300009553 Bacteria 1037
217 Ga0105239_10482459 3300010375 Bacteria 1408
218 Ga0157370_10502153 3300013104 Bacteria 1114
219 Ga0157374_10031502 3300013296 Bacteria 4821
220 Ga0157374_10185671 3300013296 Bacteria 2033
221 Ga0157374_10496317 3300013296 Bacteria 1225
222 Ga0157374_10504509 3300013296 Bacteria 1215
223 Ga0157378_10018496 3300013297 Bacteria 6122
224 Ga0157378_10618492 3300013297 Bacteria 1096
225 Ga0163162_10137844 3300013306 Bacteria 2551
226 Ga0163162_10249347 3300013306 Bacteria 1907
227 Ga0163162_10345413 3300013306 Bacteria 1621
228 Ga0157375_10191049 3300013308 Bacteria 2202
229 Ga0157375_10203551 3300013308 Bacteria 2136
230 Ga0157375_10220613 3300013308 Bacteria 2054
231 Ga0157375_10259819 3300013308 Bacteria 1898
232 Ga0163163_10004080 3300014325 Bacteria 12453
233 Ga0163163_10105426 3300014325 Bacteria 2845
234 Ga0163163_10373084 3300014325 Bacteria 1484
235 Ga0157380_10311998 3300014326 Bacteria 1454
236 Ga0157380_10734316 3300014326 Bacteria 997
237 Ga0157380_10750872 3300014326 Bacteria 987
238 Ga0157379_10075530 3300014968 Bacteria 3017
239 Ga0157379_10123010 3300014968 Bacteria 2335
240 Ga0157379_10231749 3300014968 Bacteria 1674
241 Ga0157379_10278420 3300014968 Bacteria 1522
242 Ga0157376_10056912 3300014969 Bacteria 3269
243 Ga0207682_10050590 3300025893 Bacteria 1718
244 Ga0207642_10048078 3300025899 Bacteria 1911
245 Ga0207642_10104027 3300025899 Bacteria 1432
246 Ga0207642_10150973 3300025899 Bacteria 1236
247 Ga0207642_10178107 3300025899 Bacteria 1156
248 Ga0207688_10083964 3300025901 Bacteria 1822
249 Ga0207680_10017147 3300025903 Bacteria 3820
250 Ga0207680_10192507 3300025903 Bacteria 1385
251 Ga0207699_10034966 3300025906 Bacteria 2855
252 Ga0207645_10011515 3300025907 Bacteria 6035
253 Ga0207645_10086620 3300025907 Bacteria 2012
254 Ga0207705_10089066 3300025909 Bacteria 2258
255 Ga0207707_10026109 3300025912 Bacteria 5107
256 Ga0207663_10105257 3300025916 Bacteria 1904
257 Ga0207660_10039332 3300025917 Bacteria 3305
258 Ga0207660_10164288 3300025917 Bacteria 1715
259 Ga0207662_10000449 3300025918 Bacteria 18232
260 Ga0207662_10018403 3300025918 Bacteria 3964
261 Ga0207657_10063454 3300025919 Bacteria 3158
262 Ga0207657_10070107 3300025919 Bacteria 2972
263 Ga0207646_10036658 3300025922 Bacteria 4426
264 Ga0207646_10081414 3300025922 Bacteria 2895
265 Ga0207681_10056367 3300025923 Bacteria 2680
266 Ga0207681_10175834 3300025923 Bacteria 1626
267 Ga0207650_10130804 3300025925 Bacteria 1964
268 Ga0207659_10005692 3300025926 Bacteria 7585
269 Ga0207687_10062630 3300025927 Bacteria 2631
270 Ga0207687_10157830 3300025927 Bacteria 1737
271 Ga0207700_10100634 3300025928 Bacteria 2304
272 Ga0207700_10123826 3300025928 Bacteria 2100
273 Ga0207644_10023608 3300025931 Bacteria 4215
274 Ga0207644_10320800 3300025931 Bacteria 1252
275 Ga0207706_10071171 3300025933 Bacteria 3059
276 Ga0207686_10323994 3300025934 Bacteria 1152
277 Ga0207670_10097958 3300025936 Bacteria 2089
278 Ga0207670_10348570 3300025936 Bacteria 1172
279 Ga0207669_10014466 3300025937 Bacteria 3955
280 Ga0207704_10401151 3300025938 Bacteria 1082
281 Ga0207665_10219811 3300025939 Bacteria 1392
282 Ga0207691_10022983 3300025940 Bacteria 5873
283 Ga0207691_10291696 3300025940 Bacteria 1403
284 Ga0207691_10317442 3300025940 Bacteria 1336
285 Ga0207711_10028281 3300025941 Bacteria 4716
286 Ga0207711_10109864 3300025941 Bacteria 2451
287 Ga0207711_10198334 3300025941 Bacteria 1831
288 Ga0207711_10471286 3300025941 Bacteria 1169
289 Ga0207689_10031004 3300025942 Bacteria 4454
290 Ga0207689_10205486 3300025942 Bacteria 1626
291 Ga0207679_10069640 3300025945 Bacteria 2648
292 Ga0207667_10186592 3300025949 Bacteria 2128
293 Ga0207651_10010540 3300025960 Bacteria 5128
294 Ga0207651_10033876 3300025960 Bacteria 3300
295 Ga0207651_10091925 3300025960 Bacteria 2223
296 Ga0207651_10122915 3300025960 Bacteria 1972
297 Ga0207651_10278529 3300025960 Bacteria 1381
298 Ga0207651_10378396 3300025960 Bacteria 1199
299 Ga0207712_10160469 3300025961 Bacteria 1747
300 Ga0207668_10475409 3300025972 Bacteria 1071
301 Ga0207640_10076624 3300025981 Bacteria 2271
302 Ga0207640_10206469 3300025981 Bacteria 1493
303 Ga0207640_10268903 3300025981 Bacteria 1332
304 Ga0207658_10046287 3300025986 Bacteria 3176
305 Ga0207658_10206676 3300025986 Bacteria 1643
306 Ga0207703_10022235 3300026035 Bacteria 4972
307 Ga0207703_10093019 3300026035 Bacteria 2539
308 Ga0207703_10189621 3300026035 Bacteria 1820
309 Ga0207708_10000847 3300026075 Bacteria 23031
310 Ga0207708_10002214 3300026075 Bacteria 14371
311 Ga0207708_10383625 3300026075 Bacteria 1159
312 Ga0207708_10459622 3300026075 Unclassified 1062
313 Ga0207641_10000982 3300026088 Bacteria 29176
314 Ga0207641_10040336 3300026088 Bacteria 3909
315 Ga0207641_10147144 3300026088 Bacteria 2131
316 Ga0207641_10213638 3300026088 Bacteria 1785
317 Ga0207641_10523440 3300026088 Bacteria 1154
318 Ga0207648_10008611 3300026089 Bacteria 9865
319 Ga0207648_10023127 3300026089 Bacteria 5573
320 Ga0207648_10048925 3300026089 Bacteria 3701
321 Ga0207648_10065365 3300026089 Bacteria 3171
322 Ga0207676_10160913 3300026095 Bacteria 1945
323 Ga0207674_10015392 3300026116 Bacteria 8403
324 Ga0207675_100003296 3300026118 Bacteria 15808
325 Ga0207675_100020361 3300026118 Bacteria 6184
326 Ga0207675_100031487 3300026118 Bacteria 4940
327 Ga0207675_100072333 3300026118 Bacteria 3225
328 Ga0207675_100081275 3300026118 Bacteria 3038
329 Ga0207683_10107608 3300026121 Bacteria 2494
330 Ga0207683_10305395 3300026121 Bacteria 1456
331 Ga0207698_10198421 3300026142 Bacteria 1794
332 Ga0207428_10097814 3300027907 Bacteria 2271
333 Ga0207428_10148578 3300027907 Bacteria 1785
334 Ga0207428_10205491 3300027907 Bacteria 1481
335 Ga0268266_10006622 3300028379 Bacteria 10576
336 Ga0268266_10048233 3300028379 Bacteria 3650
337 Ga0268266_10340547 3300028379 Bacteria 1407
338 Ga0268265_10029639 3300028380 Bacteria 3931
339 Ga0268264_10073855 3300028381 Bacteria 2896
340 Ga0268264_10135798 3300028381 Bacteria 2187
341 Ga0268264_10311900 3300028381 Bacteria 1484
342 Ga0268264_10376297 3300028381 Unclassified 1359
343 Ga0307413_10245084 3300031824 Bacteria 1326
344 Ga0373930_0002603 3300034816 Bacteria 2804
345 Ga0373948_0003658 3300034817 Bacteria 2382
346 Ga0373950_0000395 3300034818 Bacteria 5350
347 Ga0373938_0002288 3300034957 Bacteria 3081
348 Ga0373929_0002436 3300035085 Bacteria 3418
349 Ga0373944_0082999 3300035089 Bacteria 1061
350 Ga0373944_0090713 3300035089 Bacteria 1021
351 Ga0373949_0004143 3300035090 Bacteria 3352
352 Ga0373951_0024450 3300035091 Bacteria 1399
353 Ga0373952_0004928 3300035092 Bacteria 2428
354 Ga0373932_0006190 3300035112 Bacteria 2826
355 Ga0373941_0000058 3300035115 Bacteria 17110
356 Ga0373941_0012101 3300035115 Bacteria 2248
357 Ga0373956_0107071 3300035119 Bacteria 1300
358 Ga0373942_0002917 3300035207 Bacteria 4050
359 Ga0373961_0002004 3300035241 Bacteria 5466
360 Ga0373962_0005208 3300035242 Bacteria 3144
361 Ga0373924_0000892 3300035410 Bacteria 9414
362 Ga0373931_0023546 3300035691 Bacteria 3110
363 Ga0373935_0179548 3300035692 Bacteria 1453
364 Ga0373935_0197032 3300035692 Bacteria 1390
365 Ga0373937_0097434 3300036401 Bacteria 2728
366 Ga0373937_0132648 3300036401 Bacteria 2327
367 Ga0373925_0040147 3300037068 Bacteria 3464
368 Ga0373925_0113583 3300037068 Bacteria 2095
369 Ga0395900_0409464 3300037418 Bacteria 1319
370 Ga0436365_0681011 3300039437 Bacteria 1929
371 Ga0439446_0017889 3300042156 Bacteria 1983
372 Ga0451577_0375743 3300042876 Bacteria 1289
373 Ga0453684_0315236 3300044712 Bacteria 1773
374 Ga0451576_0021009 3300045051 Bacteria 7102
375 Ga0495592_0032510 3300046454 Bacteria 3936
376 Ga0495629_0059443 3300046459 Bacteria 2672
377 Ga0495629_0097337 3300046459 Bacteria 2053
378 Ga0495653_0251675 3300046463 Bacteria 1172
379 Ga0495608_0001571 3300046511 Bacteria 16323
380 Ga0495628_0029335 3300046516 Bacteria 4462
381 Ga0495628_0544690 3300046516 Bacteria 834
382 Ga0495630_0001513 3300046517 Bacteria 16086
383 Ga0495630_0111889 3300046517 Bacteria 2068
384 Ga0495652_0133685 3300046529 Bacteria 1960
385 Ga0495665_0035609 3300046531 Bacteria 2659
386 Ga0495587_0026721 3300046536 Bacteria 3517
387 Ga0495587_0093427 3300046536 Bacteria 1737
388 Ga0495645_0002346 3300046543 Bacteria 12846
389 Ga0495645_0007508 3300046543 Bacteria 7589
390 Ga0495667_0083433 3300046559 Bacteria 2075
391 Ga0495634_0034665 3300046642 Bacteria 3462
392 Ga0495635_0210917 3300046663 Bacteria 1315
393 Ga0495658_0024290 3300046683 Bacteria 3226
394 Ga0495658_0030022 3300046683 Bacteria 2948
395 Ga0495613_0000883 3300046689 Bacteria 23073
396 Ga0495684_0000214 3300047471 Bacteria 45082
397 Ga0495684_0067972 3300047471 Bacteria 2710
398 Ga0495684_0114955 3300047471 Bacteria 2029
399 Ga0495684_0396114 3300047471 Bacteria 970
400 Ga0496101_0135184 3300048904 Bacteria 1876
401 Ga0496101_0542051 3300048904 Unclassified 920
402 Ga0496102_0067653 3300048905 Bacteria 3277
403 Ga0496104_0121850 3300048907 Bacteria 2504
404 Ga0496104_0139680 3300048907 Bacteria 2328
405 Ga0496104_0312129 3300048907 Bacteria 1485
406 Ga0496106_0170248 3300048909 Bacteria 1726
407 Ga0496107_0104297 3300048910 Bacteria 2081
408 Ga0496108_0108869 3300048911 Bacteria 2367
409 Ga0496108_0165684 3300048911 Bacteria 1911
410 Ga0496109_0340530 3300048912 Bacteria 1416
411 Ga0496112_0002605 3300048915 Bacteria 14562
412 Ga0496112_0153908 3300048915 Bacteria 2267
413 Ga0496112_0169052 3300048915 Bacteria 2152
414 Ga0496113_0057060 3300048916 Bacteria 2933
415 Ga0496113_0274656 3300048916 Bacteria 1347
416 Ga0496114_0062353 3300048917 Bacteria 3120
417 Ga0496114_0148960 3300048917 Bacteria 2030
418 Ga0496114_0269166 3300048917 Bacteria 1501
419 Ga0501036_0450474 3300049572 Bacteria 1072
420 Ga0501041_0303321 3300049577 Bacteria 1006
421 Ga0501076_0068095 3300049592 Bacteria 2843
422 Ga0501076_0475811 3300049592 Bacteria 1029
423 Ga0501079_0151813 3300049741 Bacteria 1806
424 nmdc:mga03683_20907_c2 3300050489 Bacteria 2064
425 nmdc:mga0k408_173614_c1 3300050493 Bacteria 1285
426 nmdc:mga0k408_61639_c2 3300050493 Bacteria 1842
427 nmdc:mga0k408_7591_c1 3300050493 Bacteria 5791
428 nmdc:mga07m45_28858_c1 3300050496 Bacteria 2075
429 nmdc:mga05p37_10425_c1 3300050507 Bacteria 11029
430 nmdc:mga05p37_235183_c1 3300050507 Bacteria 2206
431 nmdc:mga05p37_369585_c1 3300050507 Bacteria 1683
432 nmdc:mga05p37_50834_c1 3300050507 Bacteria 5097
433 nmdc:mga05p37_61866_c1 3300050507 Bacteria 4608
434 nmdc:mga05p37_67291_c1 3300050507 Bacteria 4407
435 nmdc:mga08y16_126372_c1 3300050511 Bacteria 2660
436 nmdc:mga08y16_166796_c1 3300050511 Bacteria 2288
437 nmdc:mga08y16_369747_c1 3300050511 Bacteria 1471
438 nmdc:mga08y16_535670_c1 3300050511 Unclassified 1186
439 nmdc:mga08y16_56946_c1 3300050511 Bacteria 4085
440 nmdc:mga0n895_109075_c1 3300050512 Bacteria 2783
441 nmdc:mga0n895_158928_c1 3300050512 Bacteria 2291
442 nmdc:mga0n895_182788_c1 3300050512 Bacteria 2128
443 nmdc:mga0n895_198212_c1 3300050512 Bacteria 2039
444 nmdc:mga0n895_24_c1 3300050512 Bacteria 92082
445 nmdc:mga0n895_488726_c1 3300050512 Bacteria 1241
446 nmdc:mga0n895_673190_c1 3300050512 Bacteria 1032
447 nmdc:mga0n895_69716_c1 3300050512 Bacteria 3484
448 nmdc:mga0n895_79641_c1 3300050512 Bacteria 3263
449 nmdc:mga0rr50_118363_c1 3300050513 Bacteria 2105
450 nmdc:mga0rr50_1771_c1 3300050513 Bacteria 11927
451 nmdc:mga0rr50_190920_c1 3300050513 Bacteria 1679
452 nmdc:mga0rr50_2576_c1 3300050513 Bacteria 10266
453 nmdc:mga0rr50_29764_c1 3300050513 Bacteria 3856
454 nmdc:mga0rr50_332462_c1 3300050513 Bacteria 1276
455 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
456 nmdc:mga08x19_188574_c1 3300050514 Bacteria 1410
457 nmdc:mga08x19_21824_c1 3300050514 Bacteria 3957
458 nmdc:mga08x19_31923_c1 3300050514 Bacteria 3317
459 nmdc:mga08x19_34640_c1 3300050514 Bacteria 3192
460 nmdc:mga08x19_77_c1 3300050514 Bacteria 91801
461 nmdc:mga0a205_181418_c1 3300050515 Bacteria 1999
462 nmdc:mga0a205_196616_c1 3300050515 Bacteria 1907
463 nmdc:mga0a205_311967_c1 3300050515 Bacteria 1445
464 nmdc:mga0a205_32180_c1 3300050515 Bacteria 5029
465 nmdc:mga0a205_385891_c1 3300050515 Bacteria 1265
466 nmdc:mga0a205_78679_c1 3300050515 Bacteria 3186
467 Ga0495601_0009416 3300053077 Bacteria 5777
468 Ga0495601_0153890 3300053077 Bacteria 1502
469 Ga0495595_0043459 3300053084 Bacteria 2061
470 Ga0495595_0094942 3300053084 Bacteria 1434
471 Ga0495619_0021989 3300053085 Bacteria 4077
472 Ga0495619_0024580 3300053085 Bacteria 3865
473 Ga0495619_0060257 3300053085 Bacteria 2522
474 Ga0501084_0212831 3300054114 Bacteria 1631
475 Ga0590071_000777 3300059421 Bacteria 8944
476 Ga0590075_000152 3300059424 Bacteria 18638
477 Ga0590077_000481 3300059426 Bacteria 11212
478 Ga0097621_100083604
479 Ga0065712_10086945
480 Ga0065715_10132264
481 Ga0065715_10162681
482 Ga0070658_10250673
483 Ga0070676_10025706
484 Ga0070676_10046714
485 Ga0070690_100022304
486 Ga0070690_100203816
487 Ga0070690_100354951
488 Ga0070670_100453888
489 Ga0068869_100041732
490 Ga0068869_100065823
491 Ga0068869_100193680
492 Ga0070666_10025613
493 Ga0070666_10186758
494 Ga0070666_10223437
495 Ga0070680_100035681
496 Ga0070680_100343119
497 Ga0070680_100503158
498 Ga0070660_100119710
499 Ga0070660_100320054
500 Ga0070689_100058191
501 Ga0070689_100422826
502 Ga0070687_100012351
503 Ga0070661_100367956
504 Ga0070661_100703850
505 Ga0070692_10332564
506 Ga0070668_100591621
507 Ga0070669_100044498
508 Ga0070669_100054711
509 Ga0070669_100186702
510 Ga0070675_100000988
511 Ga0070671_100022892
512 Ga0070671_100719754
513 Ga0070674_100009006
514 Ga0070674_100076302
515 Ga0070673_100006114
516 Ga0070673_100018951
517 Ga0070673_100366520
518 Ga0070673_100424754
519 Ga0070688_100225093
520 Ga0070688_100577255
521 Ga0070667_100097217
522 Ga0070667_100282434
523 Ga0070667_100505446
524 Ga0070703_10039504
525 Ga0070709_10135554
526 Ga0070713_100149983
527 Ga0070711_100084328
528 Ga0070705_100003553
529 Ga0070705_100006164
530 Ga0070705_100021963
531 Ga0070705_100285898
532 Ga0070700_100015600
533 Ga0070700_100197490
534 Ga0070700_100463197
535 Ga0070694_100008914
536 Ga0070694_100065352
537 Ga0070694_100146771
538 Ga0070708_100085965
539 Ga0070708_100200301
540 Ga0070678_100132990
541 Ga0070678_100605956
542 Ga0070681_10019433
543 Ga0068867_100036621
544 Ga0068867_100159906
545 Ga0068867_100274261
546 Ga0070685_10334911
547 Ga0070707_100034038
548 Ga0070707_100055625
549 Ga0070707_100403655
550 Ga0070698_100060489
551 Ga0070698_100429385
552 Ga0070699_100001294
553 Ga0070699_100240248
554 Ga0070699_100273931
555 Ga0070699_100676879
556 Ga0070679_100234834
557 Ga0070697_100033889
558 Ga0070697_100124583
559 Ga0070697_100248660
560 Ga0070672_100014823
561 Ga0070686_100001384
562 Ga0070686_100034603
563 Ga0070695_100030184
564 Ga0070695_100041717
565 Ga0070695_100171549
566 Ga0070695_100281016
567 Ga0070696_100039336
568 Ga0070696_100049854
569 Ga0070696_100097444
570 Ga0070696_100123397
571 Ga0070696_100345926
572 Ga0070665_100001655
573 Ga0070665_100062074
574 Ga0070704_100037478
575 Ga0070704_100092380
576 Ga0070704_100255260
577 Ga0068855_100005452
578 Ga0070664_100129628
579 Ga0070664_100244125
580 Ga0068857_100008286
581 Ga0068854_100089046
582 Ga0068854_100168548
583 Ga0068854_100275035
584 Ga0068852_100347574
585 Ga0068859_100074146
586 Ga0068859_100707064
587 Ga0068864_100032536
588 Ga0068866_10020101
589 Ga0068866_10032460
590 Ga0068866_10055975
591 Ga0068866_10229946
592 Ga0068861_100025238
593 Ga0068861_100145137
594 Ga0068861_100407203
595 Ga0068861_100443715
596 Ga0068851_10067375
597 Ga0068863_100089797
598 Ga0068863_100263109
599 Ga0068863_100556764
600 Ga0068863_100774024
601 Ga0068863_100918116
602 Ga0068858_100031242
603 Ga0068858_100696314
604 Ga0068860_100049030
605 Ga0068860_100088059
606 Ga0068860_100249548
607 Ga0068860_100315079
608 Ga0068860_100456418
609 Ga0068862_100055816
610 Ga0068862_100184449
611 Ga0081539_10038887
612 Ga0075365_10025556
613 Ga0075364_10293999
614 Ga0075362_10001490
615 Ga0075367_10040916
616 Ga0075366_10029794
617 Ga0075366_10063295
618 Ga0097621_100023653
619 Ga0097621_100099030
620 Ga0097621_100115745
621 Ga0097621_100284021
622 Ga0097621_100607080
623 Ga0075370_10177252
624 Ga0068871_100038145
625 Ga0068871_100053510
626 Ga0068871_100107208
627 Ga0075428_100238464
628 Ga0075428_100282190
629 Ga0075428_100484722
630 Ga0075433_10047823
631 Ga0075433_10068148
632 Ga0075433_10518504
633 Ga0075434_100000237
634 Ga0075434_100020813
635 Ga0075434_100023150
636 Ga0075434_100120311
637 Ga0075434_100192670
638 Ga0075434_100370197
639 Ga0075434_100470726
640 Ga0075429_100413018
641 Ga0068865_100161932
642 Ga0068865_100333986
643 Ga0068865_100381656
644 Ga0075436_100000078
645 Ga0075436_100009968
646 Ga0075436_100026190
647 Ga0075436_100026954
648 Ga0075436_100086910
649 Ga0097620_100074150
650 Ga0097620_100707213
651 Ga0075435_100000018
652 Ga0075435_100002185
653 Ga0075435_100009919
654 Ga0075435_100034807
655 Ga0075435_100036085
656 Ga0075435_100050971
657 Ga0075435_100073686
658 Ga0075435_100112561
659 Ga0075435_100113045
660 Ga0075435_100292549
661 Ga0105240_10130166
662 Ga0111539_10005467
663 Ga0111539_10012731
664 Ga0111539_10054236
665 Ga0111539_10383739
666 Ga0111539_11196937
667 Ga0105245_10078995
668 Ga0105245_10245796
669 Ga0114129_10003418
670 Ga0114129_10011485
671 Ga0114129_10011838
672 Ga0114129_10014445
673 Ga0114129_10027270
674 Ga0114129_10054206
675 Ga0114129_10083314
676 Ga0114129_10150397
677 Ga0114129_10485096
678 Ga0105243_10374590
679 Ga0105243_10444823
680 Ga0105241_10028233
681 Ga0105242_10023245
682 Ga0105242_10031815
683 Ga0105242_10177871
684 Ga0105242_10245255
685 Ga0105242_10326499
686 Ga0105248_10047055
687 Ga0105248_10048211
688 Ga0105248_10064150
689 Ga0105248_10259872
690 Ga0105248_10312847
691 Ga0105248_10354587
692 Ga0105249_10487855
693 Ga0105249_10751753
694 Ga0105239_10482459
695 Ga0157370_10502153
696 Ga0157374_10031502
697 Ga0157374_10185671
698 Ga0157374_10496317
699 Ga0157374_10504509
700 Ga0157378_10018496
701 Ga0157378_10618492
702 Ga0163162_10137844
703 Ga0163162_10249347
704 Ga0163162_10345413
705 Ga0157375_10191049
706 Ga0157375_10203551
707 Ga0157375_10220613
708 Ga0157375_10259819
709 Ga0163163_10004080
710 Ga0163163_10105426
711 Ga0163163_10373084
712 Ga0157380_10311998
713 Ga0157380_10734316
714 Ga0157380_10750872
715 Ga0157379_10075530
716 Ga0157379_10123010
717 Ga0157379_10231749
718 Ga0157379_10278420
719 Ga0157376_10056912
720 Ga0207682_10050590
721 Ga0207642_10048078
722 Ga0207642_10104027
723 Ga0207642_10150973
724 Ga0207642_10178107
725 Ga0207688_10083964
726 Ga0207680_10017147
727 Ga0207680_10192507
728 Ga0207699_10034966
729 Ga0207645_10011515
730 Ga0207645_10086620
731 Ga0207705_10089066
732 Ga0207707_10026109
733 Ga0207663_10105257
734 Ga0207660_10039332
735 Ga0207660_10164288
736 Ga0207662_10000449
737 Ga0207662_10018403
738 Ga0207657_10063454
739 Ga0207657_10070107
740 Ga0207646_10036658
741 Ga0207646_10081414
742 Ga0207681_10056367
743 Ga0207681_10175834
744 Ga0207650_10130804
745 Ga0207659_10005692
746 Ga0207687_10062630
747 Ga0207687_10157830
748 Ga0207700_10100634
749 Ga0207700_10123826
750 Ga0207644_10023608
751 Ga0207644_10320800
752 Ga0207706_10071171
753 Ga0207686_10323994
754 Ga0207670_10097958
755 Ga0207670_10348570
756 Ga0207669_10014466
757 Ga0207704_10401151
758 Ga0207665_10219811
759 Ga0207691_10022983
760 Ga0207691_10291696
761 Ga0207691_10317442
762 Ga0207711_10028281
763 Ga0207711_10109864
764 Ga0207711_10198334
765 Ga0207711_10471286
766 Ga0207689_10031004
767 Ga0207689_10205486
768 Ga0207679_10069640
769 Ga0207667_10186592
770 Ga0207651_10010540
771 Ga0207651_10033876
772 Ga0207651_10091925
773 Ga0207651_10122915
774 Ga0207651_10278529
775 Ga0207651_10378396
776 Ga0207712_10160469
777 Ga0207668_10475409
778 Ga0207640_10076624
779 Ga0207640_10206469
780 Ga0207640_10268903
781 Ga0207658_10046287
782 Ga0207658_10206676
783 Ga0207703_10022235
784 Ga0207703_10093019
785 Ga0207703_10189621
786 Ga0207708_10000847
787 Ga0207708_10002214
788 Ga0207708_10383625
789 Ga0207708_10459622
790 Ga0207641_10000982
791 Ga0207641_10040336
792 Ga0207641_10147144
793 Ga0207641_10213638
794 Ga0207641_10523440
795 Ga0207648_10008611
796 Ga0207648_10023127
797 Ga0207648_10048925
798 Ga0207648_10065365
799 Ga0207676_10160913
800 Ga0207674_10015392
801 Ga0207675_100003296
802 Ga0207675_100020361
803 Ga0207675_100031487
804 Ga0207675_100072333
805 Ga0207675_100081275
806 Ga0207683_10107608
807 Ga0207683_10305395
808 Ga0207698_10198421
809 Ga0207428_10097814
810 Ga0207428_10148578
811 Ga0207428_10205491
812 Ga0268266_10006622
813 Ga0268266_10048233
814 Ga0268266_10340547
815 Ga0268265_10029639
816 Ga0268264_10073855
817 Ga0268264_10135798
818 Ga0268264_10311900
819 Ga0268264_10376297
820 Ga0307413_10245084
821 Ga0373930_0002603
822 Ga0373948_0003658
823 Ga0373950_0000395
824 Ga0373938_0002288
825 Ga0373929_0002436
826 Ga0373944_0082999
827 Ga0373944_0090713
828 Ga0373949_0004143
829 Ga0373951_0024450
830 Ga0373952_0004928
831 Ga0373932_0006190
832 Ga0373941_0000058
833 Ga0373941_0012101
834 Ga0373956_0107071
835 Ga0373942_0002917
836 Ga0373961_0002004
837 Ga0373962_0005208
838 Ga0373924_0000892
839 Ga0373931_0023546
840 Ga0373935_0179548
841 Ga0373935_0197032
842 Ga0373937_0097434
843 Ga0373937_0132648
844 Ga0373925_0040147
845 Ga0373925_0113583
846 Ga0395900_0409464
847 Ga0436365_0681011
848 Ga0439446_0017889
849 Ga0451577_0375743
850 Ga0453684_0315236
851 Ga0451576_0021009
852 Ga0495592_0032510
853 Ga0495629_0059443
854 Ga0495629_0097337
855 Ga0495653_0251675
856 Ga0495608_0001571
857 Ga0495628_0029335
858 Ga0495628_0544690
859 Ga0495630_0001513
860 Ga0495630_0111889
861 Ga0495652_0133685
862 Ga0495665_0035609
863 Ga0495587_0026721
864 Ga0495587_0093427
865 Ga0495645_0002346
866 Ga0495645_0007508
867 Ga0495667_0083433
868 Ga0495634_0034665
869 Ga0495635_0210917
870 Ga0495658_0024290
871 Ga0495658_0030022
872 Ga0495613_0000883
873 Ga0495684_0000214
874 Ga0495684_0067972
875 Ga0495684_0114955
876 Ga0495684_0396114
877 Ga0496101_0135184
878 Ga0496101_0542051
879 Ga0496102_0067653
880 Ga0496104_0121850
881 Ga0496104_0139680
882 Ga0496104_0312129
883 Ga0496106_0170248
884 Ga0496107_0104297
885 Ga0496108_0108869
886 Ga0496108_0165684
887 Ga0496109_0340530
888 Ga0496112_0002605
889 Ga0496112_0153908
890 Ga0496112_0169052
891 Ga0496113_0057060
892 Ga0496113_0274656
893 Ga0496114_0062353
894 Ga0496114_0148960
895 Ga0496114_0269166
896 Ga0501036_0450474
897 Ga0501041_0303321
898 Ga0501076_0068095
899 Ga0501076_0475811
900 Ga0501079_0151813
901 nmdc:mga03683_20907_c2
902 nmdc:mga0k408_173614_c1
903 nmdc:mga0k408_61639_c2
904 nmdc:mga0k408_7591_c1
905 nmdc:mga07m45_28858_c1
906 nmdc:mga05p37_10425_c1
907 nmdc:mga05p37_235183_c1
908 nmdc:mga05p37_369585_c1
909 nmdc:mga05p37_50834_c1
910 nmdc:mga05p37_61866_c1
911 nmdc:mga05p37_67291_c1
912 nmdc:mga08y16_126372_c1
913 nmdc:mga08y16_166796_c1
914 nmdc:mga08y16_369747_c1
915 nmdc:mga08y16_535670_c1
916 nmdc:mga08y16_56946_c1
917 nmdc:mga0n895_109075_c1
918 nmdc:mga0n895_158928_c1
919 nmdc:mga0n895_182788_c1
920 nmdc:mga0n895_198212_c1
921 nmdc:mga0n895_24_c1
922 nmdc:mga0n895_488726_c1
923 nmdc:mga0n895_673190_c1
924 nmdc:mga0n895_69716_c1
925 nmdc:mga0n895_79641_c1
926 nmdc:mga0rr50_118363_c1
927 nmdc:mga0rr50_1771_c1
928 nmdc:mga0rr50_190920_c1
929 nmdc:mga0rr50_2576_c1
930 nmdc:mga0rr50_29764_c1
931 nmdc:mga0rr50_332462_c1
932 nmdc:mga0rr50_5_c1
933 nmdc:mga08x19_188574_c1
934 nmdc:mga08x19_21824_c1
935 nmdc:mga08x19_31923_c1
936 nmdc:mga08x19_34640_c1
937 nmdc:mga08x19_77_c1
938 nmdc:mga0a205_181418_c1
939 nmdc:mga0a205_196616_c1
940 nmdc:mga0a205_311967_c1
941 nmdc:mga0a205_32180_c1
942 nmdc:mga0a205_385891_c1
943 nmdc:mga0a205_78679_c1
944 Ga0495601_0009416
945 Ga0495601_0153890
946 Ga0495595_0043459
947 Ga0495595_0094942
948 Ga0495619_0021989
949 Ga0495619_0024580
950 Ga0495619_0060257
951 Ga0501084_0212831
952 Ga0590071_000777
953 Ga0590075_000152
954 Ga0590077_000481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

9

263

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

14

262

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kpk-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from shewanella pealeana atcc 700345 0.9653 3 261
1uiy-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from thermus thermophilus hb8 0.9547 6 259
4zu2-assembly1.cif.gz_C pseudomonas aeruginosa atue 0.9504 5 261
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9495 5 261
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.944 1 256
ID Description Score Start End Superfamily
3i47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9634 2 203 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9571 5 203 3.90.226.10
4kpkA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9561 3 261 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9471 1 206 3.90.226.10
2vx2B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9464 211 261 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A843S0X4-F1-model_v4 Enoyl-CoA hydratase 0.9968 1 261
AF-A0A7W0HGH6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9957 1 262 GO:0016853
AF-Q27Q49-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9915 2 219 GO:0003824
AF-A0A1F4DU87-F1-model_v4 Enoyl-CoA hydratase 0.9884 1 185 GO:0003824
GO:0008300
AF-A0A2N5KJF8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9868 2 261 GO:0004300

Map