F450892

General Info

Members Datasets Scaffolds Average Seq Length
472 194 944 231

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0019838|Ga0496124_0019838_2129_2878
Length 249
Sequence MNSFASPQTLVALPFAPAVEDLYSRVLDAILEQRLDTTSRFTEESLAQMFGVRRSAIRGVLTQLSHQQVIVLRANHRPRVAQLNAEQARQALHARRLTELMLVRLACQRPCPLALERLRALVDTERQCAEHGRAIRLSGEFHLQLAEMAGNAPLAHFLGNLVPLTSLAIAQFNAALEDYCVWQLHEKIVDALTRRDTAMAVMLLNRHLDHLEAVLLNAQPHSDQKRLPVSPPPLARTLGESFPAANRRQ

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
10 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
11 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
12 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
17 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
38 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
46 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
47 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
48 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
49 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
50 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
51 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
52 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
55 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
56 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
57 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
58 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
59 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
60 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
61 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
66 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
67 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
68 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
69 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
72 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
73 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
74 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
126 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
147 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
148 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 2511231004 Pseudomonas sp. GM102 Isolate Nodule
154 2511231007 Pseudomonas sp. GM18 Isolate Nodule
155 2511231014 Pseudomonas sp. GM48 Isolate Nodule
156 2511231015 Pseudomonas sp. GM49 Isolate Nodule
157 2511231016 Pseudomonas sp. GM50 Isolate Nodule
158 2511231017 Pseudomonas sp. GM55 Isolate Nodule
159 2511231018 Pseudomonas sp. GM60 Isolate Nodule
160 2511231019 Pseudomonas sp. GM67 Isolate Nodule
161 2511231020 Pseudomonas sp. GM74 Isolate Nodule
162 2511231021 Pseudomonas sp. GM78 Isolate Nodule
163 2511231022 Pseudomonas sp. GM79 Isolate Nodule
164 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
165 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
166 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
167 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
168 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
169 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
170 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
171 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
172 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
173 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
174 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
175 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
176 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
177 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
178 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
179 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
180 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
181 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
182 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
183 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
184 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
185 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
186 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
187 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
188 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
189 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
190 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
191 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
192 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
193 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
194 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.1
Metatranscriptomes 0
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 2.54
Rhizoplane 1.27
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0019838 3300048927 Bacteria 6237
2 MRS2a_Contig_7869 2124908027 Bacteria 2087
3 MRS2a_Contig_7933 2124908027 Bacteria 2049
4 MRS2a_Contig_8489 2124908027 Bacteria 1994
5 MRS2a_Contig_9225 2124908027 Bacteria 2319
6 Ga0055536_1002544 3300003781 Bacteria 10201
7 Ga0065714_10008369 3300005288 Bacteria 2572
8 Ga0070669_100018381 3300005353 Bacteria 4996
9 Ga0070662_100138231 3300005457 Bacteria 1885
10 Ga0070665_100004186 3300005548 Bacteria 15177
11 Ga0075364_10020688 3300006051 Bacteria 4141
12 Ga0075364_10031360 3300006051 Bacteria 3415
13 Ga0075364_10183796 3300006051 Bacteria 1415
14 Ga0075364_10529711 3300006051 Bacteria 805
15 Ga0075432_10010732 3300006058 Bacteria 3112
16 Ga0075362_10056442 3300006177 Bacteria 1767
17 Ga0075362_10062646 3300006177 Bacteria 1685
18 Ga0075369_10014081 3300006186 Bacteria 3189
19 Ga0075436_100608339 3300006914 Bacteria 805
20 Ga0105251_10001720 3300009011 Bacteria 18316
21 Ga0105244_10014823 3300009036 Bacteria 4492
22 Ga0105244_10016663 3300009036 Bacteria 4179
23 Ga0105244_10065807 3300009036 Bacteria 1815
24 Ga0105244_10096620 3300009036 Bacteria 1449
25 Ga0105244_10163577 3300009036 Bacteria 1062
26 Ga0105250_10004372 3300009092 Bacteria 6508
27 Ga0105250_10030143 3300009092 Bacteria 2181
28 Ga0157336_1000230 3300012477 Bacteria 2463
29 Ga0157345_1000154 3300012498 Bacteria 11456
30 Ga0157373_10019397 3300013100 Bacteria 4949
31 Ga0157373_10082226 3300013100 Bacteria 2270
32 Ga0157373_10097672 3300013100 Bacteria 2067
33 Ga0157373_10116001 3300013100 Bacteria 1882
34 Ga0157373_10125130 3300013100 Bacteria 1808
35 Ga0157371_10023424 3300013102 Bacteria 4515
36 Ga0157370_10371322 3300013104 Bacteria 1318
37 Ga0157369_10057580 3300013105 Bacteria 4193
38 Ga0157369_10212712 3300013105 Bacteria 2026
39 Ga0157369_10609618 3300013105 Bacteria 1127
40 Ga0163162_10001780 3300013306 Bacteria 20197
41 Ga0157372_10033148 3300013307 Bacteria 5671
42 Ga0157375_10332892 3300013308 Bacteria 1683
43 Ga0182008_10038478 3300014497 Bacteria 2392
44 Ga0182008_10063845 3300014497 Bacteria 1813
45 Ga0182006_1007656 3300015261 Bacteria 4935
46 Ga0182007_10001412 3300015262 Bacteria 12924
47 Ga0182005_1004949 3300015265 Bacteria 4223
48 Ga0182005_1012259 3300015265 Bacteria 2424
49 Ga0182005_1022834 3300015265 Bacteria 1712
50 Ga0163161_10107257 3300017792 Bacteria 2085
51 Ga0163161_10278758 3300017792 Bacteria 1311
52 Ga0209563_101545 3300025230 Bacteria 6001
53 Ga0209676_1000264 3300025292 Bacteria 110593
54 Ga0207696_1021330 3300025711 Bacteria 2076
55 Ga0207655_1016985 3300025728 Bacteria 3948
56 Ga0207655_1059048 3300025728 Bacteria 1495
57 Ga0207713_1018880 3300025735 Bacteria 3396
58 Ga0209281_1003115 3300027111 Bacteria 5774
59 Ga0207428_10054007 3300027907 Bacteria 3201
60 Ga0207428_10070828 3300027907 Bacteria 2740
61 Ga0207428_10083370 3300027907 Bacteria 2494
62 Ga0207428_10143398 3300027907 Bacteria 1822
63 Ga0316179_1108103 3300030734 Bacteria 1049
64 Ga0316178_1152882 3300030735 Bacteria 8839
65 Ga0307408_100023917 3300031548 Bacteria 4165
66 Ga0307408_100102869 3300031548 Bacteria 2179
67 Ga0307408_100165533 3300031548 Bacteria 1760
68 Ga0307407_10458515 3300031903 Bacteria 926
69 Ga0307412_10035543 3300031911 Bacteria 3184
70 Ga0307412_10057349 3300031911 Bacteria 2599
71 Ga0307412_10346125 3300031911 Bacteria 1191
72 Ga0307409_100066116 3300031995 Bacteria 2849
73 Ga0307414_10099230 3300032004 Bacteria 2187
74 Ga0307414_10111775 3300032004 Bacteria 2081
75 Ga0307411_10033583 3300032005 Bacteria 3183
76 Ga0439438_006309 3300041405 Bacteria 4208
77 Ga0439438_009455 3300041405 Bacteria 3153
78 Ga0439438_011585 3300041405 Bacteria 2739
79 Ga0439438_032824 3300041405 Bacteria 1374
80 Ga0439438_067908 3300041405 Bacteria 885
81 Ga0439447_004721 3300041407 Bacteria 4644
82 Ga0439447_007300 3300041407 Bacteria 3520
83 Ga0439447_017928 3300041407 Bacteria 1919
84 Ga0439447_020457 3300041407 Bacteria 1755
85 Ga0439447_021564 3300041407 Bacteria 1695
86 Ga0439447_028567 3300041407 Bacteria 1416
87 Ga0439447_042582 3300041407 Bacteria 1102
88 Ga0439461_0006114 3300041410 Bacteria 2086
89 Ga0439466_0005069 3300041411 Bacteria 5050
90 Ga0439466_0022367 3300041411 Bacteria 2232
91 Ga0439466_0028796 3300041411 Bacteria 1914
92 Ga0439466_0069071 3300041411 Bacteria 1127
93 Ga0439465_0009742 3300041413 Bacteria 3027
94 Ga0439445_0049908 3300042004 Bacteria 1127
95 Ga0439432_006423 3300042006 Bacteria 4198
96 Ga0439432_054157 3300042006 Bacteria 1246
97 Ga0439451_003268 3300042009 Bacteria 3286
98 Ga0439451_003898 3300042009 Bacteria 3033
99 Ga0439451_029066 3300042009 Bacteria 1113
100 Ga0439452_001923 3300042010 Bacteria 7962
101 Ga0439452_005307 3300042010 Bacteria 4161
102 Ga0439452_010432 3300042010 Bacteria 2702
103 Ga0439452_017994 3300042010 Bacteria 1889
104 Ga0439452_045242 3300042010 Bacteria 1024
105 Ga0439452_060446 3300042010 Bacteria 849
106 Ga0439456_003137 3300042013 Bacteria 3342
107 Ga0439456_008032 3300042013 Bacteria 2177
108 Ga0439456_025818 3300042013 Bacteria 1248
109 Ga0439456_026254 3300042013 Bacteria 1238
110 Ga0439456_039768 3300042013 Bacteria 1017
111 Ga0439463_003980 3300042016 Bacteria 3719
112 Ga0439463_015283 3300042016 Bacteria 1898
113 Ga0439463_020559 3300042016 Bacteria 1647
114 Ga0439463_023744 3300042016 Bacteria 1535
115 Ga0450911_003885 3300042115 Bacteria 2536
116 Ga0450911_004208 3300042115 Bacteria 2389
117 Ga0450911_015651 3300042115 Bacteria 1003
118 Ga0450919_001710 3300042121 Bacteria 2863
119 Ga0450920_001220 3300042122 Bacteria 4220
120 Ga0450922_000404 3300042124 Bacteria 4646
121 Ga0450923_016355 3300042125 Bacteria 1396
122 Ga0450902_011301 3300042137 Bacteria 1417
123 Ga0450902_012922 3300042137 Bacteria 1341
124 Ga0450903_003021 3300042138 Bacteria 2935
125 Ga0450903_005477 3300042138 Bacteria 2127
126 Ga0450903_014572 3300042138 Bacteria 1243
127 Ga0450904_003359 3300042139 Bacteria 1746
128 Ga0450904_007986 3300042139 Bacteria 1045
129 Ga0450906_002629 3300042145 Bacteria 3919
130 Ga0450906_004049 3300042145 Bacteria 3100
131 Ga0450906_005165 3300042145 Bacteria 2702
132 Ga0450906_007699 3300042145 Bacteria 2117
133 Ga0450907_001642 3300042146 Bacteria 4685
134 Ga0450907_004716 3300042146 Bacteria 2335
135 Ga0450910_000561 3300042147 Bacteria 4403
136 Ga0450910_001228 3300042147 Bacteria 3197
137 Ga0439446_0005000 3300042156 Bacteria 3390
138 Ga0450908_002093 3300042184 Bacteria 3909
139 Ga0450909_001490 3300042185 Bacteria 3269
140 Ga0439434_0020556 3300042435 Bacteria 1982
141 Ga0439464_0023665 3300042439 Bacteria 1696
142 Ga0450918_005065 3300042531 Bacteria 2373
143 Ga0450918_005282 3300042531 Bacteria 2327
144 Ga0450893_0021430 3300042532 Bacteria 1116
145 Ga0439440_0003979 3300042993 Bacteria 2883
146 Ga0495617_000479 3300046452 Bacteria 21276
147 Ga0495617_015300 3300046452 Bacteria 2600
148 Ga0495617_075832 3300046452 Bacteria 1103
149 Ga0495617_087792 3300046452 Bacteria 1016
150 Ga0495617_093858 3300046452 Bacteria 978
151 Ga0495627_009182 3300046453 Bacteria 3648
152 Ga0495627_014121 3300046453 Bacteria 2796
153 Ga0495592_0105952 3300046454 Bacteria 1996
154 Ga0495603_0103149 3300046455 Bacteria 1665
155 Ga0495590_0006440 3300046457 Bacteria 4581
156 Ga0495590_0021637 3300046457 Bacteria 2278
157 Ga0495590_0023304 3300046457 Bacteria 2185
158 Ga0495590_0080188 3300046457 Bacteria 1149
159 Ga0495590_0081529 3300046457 Bacteria 1139
160 Ga0495590_0096270 3300046457 Bacteria 1049
161 Ga0495590_0160589 3300046457 Bacteria 817
162 Ga0495591_002013 3300046458 Bacteria 11827
163 Ga0495591_004232 3300046458 Bacteria 7113
164 Ga0495591_019262 3300046458 Bacteria 2289
165 Ga0495591_022227 3300046458 Bacteria 2054
166 Ga0495591_052148 3300046458 Bacteria 1113
167 Ga0495591_057330 3300046458 Bacteria 1045
168 Ga0495638_0011092 3300046460 Bacteria 6228
169 Ga0495638_0029817 3300046460 Bacteria 3517
170 Ga0495638_0051508 3300046460 Bacteria 2567
171 Ga0495638_0090732 3300046460 Bacteria 1841
172 Ga0495638_0135518 3300046460 Bacteria 1442
173 Ga0495638_0271459 3300046460 Bacteria 925
174 Ga0495650_0021571 3300046471 Bacteria 3108
175 Ga0495650_0026379 3300046471 Bacteria 2704
176 Ga0495650_0058777 3300046471 Bacteria 1550
177 Ga0495650_0098425 3300046471 Bacteria 1101
178 Ga0495605_0009897 3300046474 Bacteria 5346
179 Ga0495605_0019070 3300046474 Bacteria 3670
180 Ga0495605_0031240 3300046474 Bacteria 2721
181 Ga0495605_0048528 3300046474 Bacteria 2078
182 Ga0495605_0077086 3300046474 Bacteria 1564
183 Ga0495605_0127377 3300046474 Bacteria 1150
184 Ga0495639_0000053 3300046475 Bacteria 50537
185 Ga0495584_0000120 3300046491 Bacteria 54113
186 Ga0495584_0001735 3300046491 Bacteria 12743
187 Ga0495584_0008492 3300046491 Bacteria 5317
188 Ga0495584_0018960 3300046491 Bacteria 3495
189 Ga0495584_0047989 3300046491 Bacteria 2153
190 Ga0495584_0057145 3300046491 Bacteria 1963
191 Ga0495584_0160492 3300046491 Bacteria 1142
192 Ga0495584_0299909 3300046491 Bacteria 816
193 Ga0495585_0013257 3300046492 Bacteria 4828
194 Ga0495585_0026832 3300046492 Bacteria 3288
195 Ga0495585_0053285 3300046492 Bacteria 2239
196 Ga0495585_0104774 3300046492 Bacteria 1509
197 Ga0495585_0162401 3300046492 Bacteria 1158
198 Ga0495594_0073133 3300046499 Bacteria 1907
199 Ga0495607_0001371 3300046501 Bacteria 21663
200 Ga0495607_0019962 3300046501 Bacteria 4245
201 Ga0495607_0030887 3300046501 Bacteria 3283
202 Ga0495607_0032062 3300046501 Bacteria 3211
203 Ga0495607_0058884 3300046501 Bacteria 2193
204 Ga0495607_0067657 3300046501 Bacteria 2006
205 Ga0495607_0078893 3300046501 Bacteria 1815
206 Ga0495607_0098405 3300046501 Bacteria 1571
207 Ga0495607_0164863 3300046501 Bacteria 1123
208 Ga0495607_0185198 3300046501 Bacteria 1041
209 Ga0495583_0045411 3300046506 Bacteria 2032
210 Ga0495583_0066365 3300046506 Bacteria 1596
211 Ga0495583_0070260 3300046506 Bacteria 1540
212 Ga0495606_0050028 3300046507 Bacteria 2736
213 Ga0495606_0083503 3300046507 Bacteria 1980
214 Ga0495610_0017303 3300046512 Bacteria 4114
215 Ga0495610_0117784 3300046512 Bacteria 1168
216 Ga0495616_0005311 3300046513 Bacteria 7940
217 Ga0495616_0011376 3300046513 Bacteria 5104
218 Ga0495616_0018036 3300046513 Bacteria 3884
219 Ga0495616_0019841 3300046513 Bacteria 3663
220 Ga0495616_0031017 3300046513 Bacteria 2803
221 Ga0495616_0078202 3300046513 Bacteria 1587
222 Ga0495616_0166174 3300046513 Bacteria 989
223 Ga0495620_0000811 3300046515 Bacteria 19225
224 Ga0495620_0034287 3300046515 Bacteria 2295
225 Ga0495620_0040307 3300046515 Bacteria 2056
226 Ga0495620_0081597 3300046515 Bacteria 1307
227 Ga0495620_0114701 3300046515 Bacteria 1065
228 Ga0495631_0066837 3300046518 Bacteria 1555
229 Ga0495631_0067139 3300046518 Bacteria 1552
230 Ga0495631_0228111 3300046518 Bacteria 794
231 Ga0495632_0001542 3300046519 Bacteria 19038
232 Ga0495632_0002560 3300046519 Bacteria 13770
233 Ga0495632_0018769 3300046519 Bacteria 3786
234 Ga0495632_0021439 3300046519 Bacteria 3481
235 Ga0495632_0024155 3300046519 Bacteria 3235
236 Ga0495632_0028951 3300046519 Bacteria 2887
237 Ga0495637_0010013 3300046520 Bacteria 4605
238 Ga0495637_0012785 3300046520 Bacteria 4005
239 Ga0495637_0022260 3300046520 Bacteria 2893
240 Ga0495637_0023812 3300046520 Bacteria 2775
241 Ga0495637_0039083 3300046520 Bacteria 2050
242 Ga0495637_0041126 3300046520 Bacteria 1985
243 Ga0495637_0066763 3300046520 Bacteria 1461
244 Ga0495643_0010056 3300046522 Bacteria 5836
245 Ga0495643_0034476 3300046522 Bacteria 2792
246 Ga0495643_0073046 3300046522 Bacteria 1798
247 Ga0495643_0114431 3300046522 Bacteria 1368
248 Ga0495643_0185621 3300046522 Bacteria 1007
249 Ga0495643_0241496 3300046522 Bacteria 847
250 Ga0495644_0002862 3300046523 Bacteria 6837
251 Ga0495644_0017553 3300046523 Bacteria 2735
252 Ga0495644_0165133 3300046523 Bacteria 849
253 Ga0495648_0001828 3300046524 Bacteria 20470
254 Ga0495648_0055741 3300046524 Bacteria 2381
255 Ga0495648_0059478 3300046524 Bacteria 2279
256 Ga0495648_0063199 3300046524 Bacteria 2187
257 Ga0495648_0175245 3300046524 Bacteria 1095
258 Ga0495666_0038563 3300046526 Bacteria 2323
259 Ga0495642_0003262 3300046528 Bacteria 6422
260 Ga0495642_0004718 3300046528 Bacteria 5280
261 Ga0495654_0005926 3300046530 Bacteria 7026
262 Ga0495654_0018888 3300046530 Bacteria 3607
263 Ga0495654_0023300 3300046530 Bacteria 3206
264 Ga0495654_0027622 3300046530 Bacteria 2907
265 Ga0495654_0058187 3300046530 Bacteria 1865
266 Ga0495654_0088871 3300046530 Bacteria 1437
267 Ga0495654_0114003 3300046530 Bacteria 1230
268 Ga0495609_0008086 3300046538 Bacteria 5183
269 Ga0495609_0009745 3300046538 Bacteria 4633
270 Ga0495597_0014005 3300046542 Bacteria 3829
271 Ga0495597_0017471 3300046542 Bacteria 3374
272 Ga0495597_0023167 3300046542 Bacteria 2874
273 Ga0495597_0031221 3300046542 Bacteria 2425
274 Ga0495622_0080112 3300046557 Bacteria 1503
275 Ga0495622_0149938 3300046557 Bacteria 1055
276 Ga0495656_0034674 3300046615 Bacteria 2068
277 Ga0495656_0083214 3300046615 Bacteria 1448
278 Ga0495668_0247668 3300046616 Bacteria 976
279 Ga0495668_0369574 3300046616 Bacteria 787
280 Ga0495611_0024608 3300046648 Bacteria 2620
281 Ga0495611_0028660 3300046648 Bacteria 2439
282 Ga0495611_0121621 3300046648 Bacteria 1217
283 Ga0495611_0203570 3300046648 Bacteria 923
284 Ga0495625_0006971 3300046660 Bacteria 9965
285 Ga0495625_0029328 3300046660 Bacteria 4117
286 Ga0495625_0080085 3300046660 Bacteria 2275
287 Ga0495625_0117570 3300046660 Bacteria 1812
288 Ga0495625_0121907 3300046660 Bacteria 1773
289 Ga0495625_0203872 3300046660 Bacteria 1303
290 Ga0495625_0276590 3300046660 Bacteria 1081
291 Ga0495625_0278270 3300046660 Bacteria 1077
292 Ga0495659_0000457 3300046664 Bacteria 15230
293 Ga0495659_0013314 3300046664 Bacteria 2678
294 Ga0495659_0037263 3300046664 Bacteria 1722
295 Ga0495659_0067088 3300046664 Bacteria 1337
296 Ga0495661_0073550 3300046665 Bacteria 1991
297 Ga0495661_0079931 3300046665 Bacteria 1888
298 Ga0495661_0160819 3300046665 Bacteria 1205
299 Ga0495661_0240264 3300046665 Bacteria 929
300 Ga0495588_0335405 3300046674 Bacteria 795
301 Ga0495669_0007735 3300046684 Bacteria 4511
302 Ga0495670_0012701 3300046691 Bacteria 4142
303 Ga0495670_0030889 3300046691 Bacteria 2661
304 Ga0495670_0325451 3300046691 Bacteria 825
305 Ga0495671_0011275 3300046692 Bacteria 4928
306 Ga0495671_0011462 3300046692 Bacteria 4875
307 Ga0495671_0019136 3300046692 Bacteria 3623
308 Ga0495671_0026750 3300046692 Bacteria 2986
309 Ga0495671_0039318 3300046692 Bacteria 2389
310 Ga0495671_0041114 3300046692 Bacteria 2329
311 Ga0495649_0001000 3300046694 Bacteria 22223
312 Ga0495649_0020437 3300046694 Bacteria 3714
313 Ga0495649_0020852 3300046694 Bacteria 3673
314 Ga0495649_0027542 3300046694 Bacteria 3152
315 Ga0495649_0065616 3300046694 Bacteria 1948
316 Ga0495649_0075604 3300046694 Bacteria 1803
317 Ga0495649_0199565 3300046694 Bacteria 1039
318 Ga0495589_0004057 3300046794 Bacteria 7848
319 Ga0495589_0006766 3300046794 Bacteria 6037
320 Ga0495589_0012140 3300046794 Bacteria 4466
321 Ga0495589_0028032 3300046794 Bacteria 2844
322 Ga0495589_0031176 3300046794 Bacteria 2684
323 Ga0495589_0045001 3300046794 Bacteria 2193
324 Ga0495589_0140339 3300046794 Bacteria 1157
325 Ga0495660_0005328 3300046810 Bacteria 7704
326 Ga0495660_0013447 3300046810 Bacteria 4742
327 Ga0495660_0026469 3300046810 Bacteria 3288
328 Ga0495660_0041030 3300046810 Bacteria 2564
329 Ga0495660_0046370 3300046810 Bacteria 2383
330 Ga0495660_0075592 3300046810 Bacteria 1776
331 Ga0495660_0158427 3300046810 Bacteria 1112
332 Ga0495660_0169259 3300046810 Bacteria 1065
333 Ga0495660_0196008 3300046810 Bacteria 967
334 Ga0495660_0212215 3300046810 Bacteria 917
335 Ga0495581_0025949 3300047315 Bacteria 3398
336 Ga0495636_0011258 3300047318 Bacteria 3539
337 Ga0495672_0004532 3300047320 Bacteria 11333
338 Ga0495672_0013081 3300047320 Bacteria 5743
339 Ga0495672_0017425 3300047320 Bacteria 4805
340 Ga0495672_0020229 3300047320 Bacteria 4367
341 Ga0495672_0039380 3300047320 Bacteria 2873
342 Ga0495672_0067464 3300047320 Bacteria 2037
343 Ga0495672_0072436 3300047320 Bacteria 1946
344 Ga0495672_0186081 3300047320 Bacteria 1048
345 Ga0495683_0001446 3300047323 Bacteria 15578
346 Ga0495683_0009570 3300047323 Bacteria 5160
347 Ga0495683_0010852 3300047323 Bacteria 4803
348 Ga0495683_0022195 3300047323 Bacteria 3265
349 Ga0495683_0025685 3300047323 Bacteria 3017
350 Ga0495683_0050146 3300047323 Bacteria 2089
351 Ga0495683_0062984 3300047323 Bacteria 1833
352 Ga0495687_002579 3300047443 Bacteria 14291
353 Ga0495687_013440 3300047443 Bacteria 4273
354 Ga0495687_126815 3300047443 Bacteria 911
355 Ga0495677_0058369 3300047445 Bacteria 1427
356 Ga0495679_018459 3300047446 Bacteria 2475
357 Ga0495685_015385 3300047447 Bacteria 2608
358 Ga0495673_0001376 3300047469 Bacteria 19632
359 Ga0495673_0006316 3300047469 Bacteria 6982
360 Ga0495673_0009282 3300047469 Bacteria 5455
361 Ga0495673_0026520 3300047469 Bacteria 2769
362 Ga0495673_0033123 3300047469 Bacteria 2401
363 Ga0495673_0065160 3300047469 Bacteria 1547
364 Ga0495673_0142686 3300047469 Bacteria 932
365 Ga0495673_0147946 3300047469 Bacteria 910
366 Ga0495673_0178105 3300047469 Bacteria 806
367 Ga0495681_0002070 3300047470 Bacteria 14573
368 Ga0495681_0008069 3300047470 Bacteria 6634
369 Ga0495681_0017408 3300047470 Bacteria 3990
370 Ga0495681_0027297 3300047470 Bacteria 2956
371 Ga0495681_0064369 3300047470 Bacteria 1679
372 Ga0495681_0077481 3300047470 Bacteria 1491
373 Ga0495681_0229870 3300047470 Bacteria 740
374 Ga0495684_0128924 3300047471 Bacteria 1901
375 Ga0495686_0060970 3300047472 Bacteria 2344
376 Ga0495686_0078998 3300047472 Bacteria 2012
377 Ga0495593_0086326 3300047673 Bacteria 1618
378 Ga0495626_0001872 3300048091 Bacteria 15768
379 Ga0495626_0002288 3300048091 Bacteria 13583
380 Ga0495626_0005048 3300048091 Bacteria 7873
381 Ga0495626_0014164 3300048091 Bacteria 4121
382 Ga0495626_0026446 3300048091 Bacteria 2828
383 Ga0495626_0048716 3300048091 Bacteria 1965
384 Ga0495626_0079689 3300048091 Bacteria 1457
385 Ga0495626_0080480 3300048091 Bacteria 1448
386 Ga0495626_0132233 3300048091 Bacteria 1064
387 Ga0496105_0110416 3300048908 Bacteria 2270
388 Ga0496106_0208297 3300048909 Bacteria 1557
389 Ga0496107_0372199 3300048910 Bacteria 1063
390 Ga0496110_0137433 3300048913 Bacteria 2209
391 Ga0496110_0248088 3300048913 Bacteria 1620
392 Ga0496116_0026478 3300048919 Bacteria 4240
393 Ga0496116_0038400 3300048919 Bacteria 3325
394 Ga0496117_0038264 3300048920 Bacteria 3560
395 Ga0496118_0048844 3300048921 Bacteria 3263
396 Ga0496118_0168945 3300048921 Bacteria 1339
397 Ga0496120_0148022 3300048923 Bacteria 1183
398 Ga0496121_0112699 3300048924 Bacteria 2071
399 Ga0496122_0040302 3300048925 Bacteria 3714
400 Ga0496122_0085634 3300048925 Bacteria 2173
401 Ga0496122_0088456 3300048925 Bacteria 2122
402 Ga0496123_0032143 3300048926 Bacteria 3806
403 Ga0496124_0340136 3300048927 Bacteria 1066
404 Ga0495678_002086 3300049459 Bacteria 14214
405 Ga0495678_006531 3300049459 Bacteria 6193
406 Ga0495678_015870 3300049459 Bacteria 3456
407 Ga0495678_023804 3300049459 Bacteria 2655
408 Ga0495678_036935 3300049459 Bacteria 1989
409 Ga0495678_042708 3300049459 Bacteria 1805
410 Ga0495678_043657 3300049459 Bacteria 1778
411 Ga0495678_044999 3300049459 Bacteria 1743
412 Ga0495678_046309 3300049459 Bacteria 1710
413 Ga0495678_050649 3300049459 Bacteria 1608
414 Ga0495678_078953 3300049459 Bacteria 1187
415 Ga0495678_098463 3300049459 Bacteria 1017
416 Ga0495678_161579 3300049459 Bacteria 715
417 Ga0495682_0016348 3300049460 Bacteria 2808
418 Ga0495682_0024710 3300049460 Bacteria 2238
419 Ga0495682_0047604 3300049460 Bacteria 1564
420 Ga0501240_007185 3300049673 Bacteria 1393
421 Ga0501241_003026 3300049758 Bacteria 3215
422 Ga0501269_008598 3300049766 Bacteria 1235
423 nmdc:mga03683_27131_c1 3300050489 Bacteria 1442
424 nmdc:mga03683_37616_c1 3300050489 Bacteria 1632
425 nmdc:mga00v17_206125_c1 3300050491 Bacteria 1272
426 nmdc:mga00v17_305303_c1 3300050491 Bacteria 1034
427 nmdc:mga00v17_444532_c1 3300050491 Bacteria 842
428 nmdc:mga00v17_49430_c1 3300050491 Bacteria 2551
429 nmdc:mga08x19_338658_c1 3300050514 Bacteria 1049
430 nmdc:mga0sz30_87528_c1 3300050516 Bacteria 1353
431 2511252917 2511231004 Bacteria 6669789
432 2511271354 2511231007 Bacteria 6306603
433 2511315855 2511231014 Bacteria 6462302
434 2511323223 2511231015 Bacteria 6598026
435 2511329438 2511231016 Bacteria 6704427
436 2511335021 2511231017 Bacteria 6503007
437 2511338317 2511231018 Bacteria 6436256
438 2511344552 2511231019 Bacteria 6520662
439 2511351656 2511231020 Bacteria 6115223
440 2511356017 2511231021 Bacteria 7302637
441 2511363407 2511231022 Bacteria 6719296
442 2599934531 2599185300 Bacteria 6062622
443 2624494400 2623620446 Bacteria 6500345
444 2644187771 2643221633 Bacteria 6733554
445 2715752295 2713897148 Bacteria 5883533
446 2718636073 2718217725 Bacteria 5758958
447 2739198201 2738543004 Bacteria 6381073
448 2739260965 2738543015 Bacteria 6750701
449 2808857987 2808606361 Bacteria 6136259
450 2808926605 2808606376 Bacteria 6248667
451 2808937481 2808606378 Bacteria 6177535
452 2808948766 2808606380 Bacteria 6248705
453 2808959277 2808606382 Bacteria 6841132
454 2808966472 2808606383 Bacteria 6138645
455 2809001359 2808606389 Bacteria 6138126
456 2819659151 2818991456 Bacteria 6123676
457 2842837007 2842832357 Bacteria 5959113
458 2842847746 2842843487 Bacteria 6004777
459 2880235441 2880230671 Bacteria 6140320
460 2904555904 2904550169 Bacteria 6221258
461 2919390714 2919385768 Bacteria 5897293
462 2919490993 2919487758 Bacteria 5929766
463 2919701499 2919697872 Bacteria 6553725
464 2939641784 2939636861 Bacteria 6297853
465 2974294657 2974289157 Bacteria 6080362
466 2988730909 2988728565 Bacteria 6124362
467 2998144861 2998139840 Bacteria 6073514
468 3007860068 3007855910 Bacteria 5637581
469 3007866318 3007861166 Bacteria 6045338
470 8019781884 8019775933 Bacteria 6858656
471 8029996034 8029995093 Bacteria 5990776
472 8056171707 8056166840 Bacteria 5820959
473 Ga0496124_0019838
474 MRS2a_Contig_7869
475 MRS2a_Contig_7933
476 MRS2a_Contig_8489
477 MRS2a_Contig_9225
478 Ga0055536_1002544
479 Ga0065714_10008369
480 Ga0070669_100018381
481 Ga0070662_100138231
482 Ga0070665_100004186
483 Ga0075364_10020688
484 Ga0075364_10031360
485 Ga0075364_10183796
486 Ga0075364_10529711
487 Ga0075432_10010732
488 Ga0075362_10056442
489 Ga0075362_10062646
490 Ga0075369_10014081
491 Ga0075436_100608339
492 Ga0105251_10001720
493 Ga0105244_10014823
494 Ga0105244_10016663
495 Ga0105244_10065807
496 Ga0105244_10096620
497 Ga0105244_10163577
498 Ga0105250_10004372
499 Ga0105250_10030143
500 Ga0157336_1000230
501 Ga0157345_1000154
502 Ga0157373_10019397
503 Ga0157373_10082226
504 Ga0157373_10097672
505 Ga0157373_10116001
506 Ga0157373_10125130
507 Ga0157371_10023424
508 Ga0157370_10371322
509 Ga0157369_10057580
510 Ga0157369_10212712
511 Ga0157369_10609618
512 Ga0163162_10001780
513 Ga0157372_10033148
514 Ga0157375_10332892
515 Ga0182008_10038478
516 Ga0182008_10063845
517 Ga0182006_1007656
518 Ga0182007_10001412
519 Ga0182005_1004949
520 Ga0182005_1012259
521 Ga0182005_1022834
522 Ga0163161_10107257
523 Ga0163161_10278758
524 Ga0209563_101545
525 Ga0209676_1000264
526 Ga0207696_1021330
527 Ga0207655_1016985
528 Ga0207655_1059048
529 Ga0207713_1018880
530 Ga0209281_1003115
531 Ga0207428_10054007
532 Ga0207428_10070828
533 Ga0207428_10083370
534 Ga0207428_10143398
535 Ga0316179_1108103
536 Ga0316178_1152882
537 Ga0307408_100023917
538 Ga0307408_100102869
539 Ga0307408_100165533
540 Ga0307407_10458515
541 Ga0307412_10035543
542 Ga0307412_10057349
543 Ga0307412_10346125
544 Ga0307409_100066116
545 Ga0307414_10099230
546 Ga0307414_10111775
547 Ga0307411_10033583
548 Ga0439438_006309
549 Ga0439438_009455
550 Ga0439438_011585
551 Ga0439438_032824
552 Ga0439438_067908
553 Ga0439447_004721
554 Ga0439447_007300
555 Ga0439447_017928
556 Ga0439447_020457
557 Ga0439447_021564
558 Ga0439447_028567
559 Ga0439447_042582
560 Ga0439461_0006114
561 Ga0439466_0005069
562 Ga0439466_0022367
563 Ga0439466_0028796
564 Ga0439466_0069071
565 Ga0439465_0009742
566 Ga0439445_0049908
567 Ga0439432_006423
568 Ga0439432_054157
569 Ga0439451_003268
570 Ga0439451_003898
571 Ga0439451_029066
572 Ga0439452_001923
573 Ga0439452_005307
574 Ga0439452_010432
575 Ga0439452_017994
576 Ga0439452_045242
577 Ga0439452_060446
578 Ga0439456_003137
579 Ga0439456_008032
580 Ga0439456_025818
581 Ga0439456_026254
582 Ga0439456_039768
583 Ga0439463_003980
584 Ga0439463_015283
585 Ga0439463_020559
586 Ga0439463_023744
587 Ga0450911_003885
588 Ga0450911_004208
589 Ga0450911_015651
590 Ga0450919_001710
591 Ga0450920_001220
592 Ga0450922_000404
593 Ga0450923_016355
594 Ga0450902_011301
595 Ga0450902_012922
596 Ga0450903_003021
597 Ga0450903_005477
598 Ga0450903_014572
599 Ga0450904_003359
600 Ga0450904_007986
601 Ga0450906_002629
602 Ga0450906_004049
603 Ga0450906_005165
604 Ga0450906_007699
605 Ga0450907_001642
606 Ga0450907_004716
607 Ga0450910_000561
608 Ga0450910_001228
609 Ga0439446_0005000
610 Ga0450908_002093
611 Ga0450909_001490
612 Ga0439434_0020556
613 Ga0439464_0023665
614 Ga0450918_005065
615 Ga0450918_005282
616 Ga0450893_0021430
617 Ga0439440_0003979
618 Ga0495617_000479
619 Ga0495617_015300
620 Ga0495617_075832
621 Ga0495617_087792
622 Ga0495617_093858
623 Ga0495627_009182
624 Ga0495627_014121
625 Ga0495592_0105952
626 Ga0495603_0103149
627 Ga0495590_0006440
628 Ga0495590_0021637
629 Ga0495590_0023304
630 Ga0495590_0080188
631 Ga0495590_0081529
632 Ga0495590_0096270
633 Ga0495590_0160589
634 Ga0495591_002013
635 Ga0495591_004232
636 Ga0495591_019262
637 Ga0495591_022227
638 Ga0495591_052148
639 Ga0495591_057330
640 Ga0495638_0011092
641 Ga0495638_0029817
642 Ga0495638_0051508
643 Ga0495638_0090732
644 Ga0495638_0135518
645 Ga0495638_0271459
646 Ga0495650_0021571
647 Ga0495650_0026379
648 Ga0495650_0058777
649 Ga0495650_0098425
650 Ga0495605_0009897
651 Ga0495605_0019070
652 Ga0495605_0031240
653 Ga0495605_0048528
654 Ga0495605_0077086
655 Ga0495605_0127377
656 Ga0495639_0000053
657 Ga0495584_0000120
658 Ga0495584_0001735
659 Ga0495584_0008492
660 Ga0495584_0018960
661 Ga0495584_0047989
662 Ga0495584_0057145
663 Ga0495584_0160492
664 Ga0495584_0299909
665 Ga0495585_0013257
666 Ga0495585_0026832
667 Ga0495585_0053285
668 Ga0495585_0104774
669 Ga0495585_0162401
670 Ga0495594_0073133
671 Ga0495607_0001371
672 Ga0495607_0019962
673 Ga0495607_0030887
674 Ga0495607_0032062
675 Ga0495607_0058884
676 Ga0495607_0067657
677 Ga0495607_0078893
678 Ga0495607_0098405
679 Ga0495607_0164863
680 Ga0495607_0185198
681 Ga0495583_0045411
682 Ga0495583_0066365
683 Ga0495583_0070260
684 Ga0495606_0050028
685 Ga0495606_0083503
686 Ga0495610_0017303
687 Ga0495610_0117784
688 Ga0495616_0005311
689 Ga0495616_0011376
690 Ga0495616_0018036
691 Ga0495616_0019841
692 Ga0495616_0031017
693 Ga0495616_0078202
694 Ga0495616_0166174
695 Ga0495620_0000811
696 Ga0495620_0034287
697 Ga0495620_0040307
698 Ga0495620_0081597
699 Ga0495620_0114701
700 Ga0495631_0066837
701 Ga0495631_0067139
702 Ga0495631_0228111
703 Ga0495632_0001542
704 Ga0495632_0002560
705 Ga0495632_0018769
706 Ga0495632_0021439
707 Ga0495632_0024155
708 Ga0495632_0028951
709 Ga0495637_0010013
710 Ga0495637_0012785
711 Ga0495637_0022260
712 Ga0495637_0023812
713 Ga0495637_0039083
714 Ga0495637_0041126
715 Ga0495637_0066763
716 Ga0495643_0010056
717 Ga0495643_0034476
718 Ga0495643_0073046
719 Ga0495643_0114431
720 Ga0495643_0185621
721 Ga0495643_0241496
722 Ga0495644_0002862
723 Ga0495644_0017553
724 Ga0495644_0165133
725 Ga0495648_0001828
726 Ga0495648_0055741
727 Ga0495648_0059478
728 Ga0495648_0063199
729 Ga0495648_0175245
730 Ga0495666_0038563
731 Ga0495642_0003262
732 Ga0495642_0004718
733 Ga0495654_0005926
734 Ga0495654_0018888
735 Ga0495654_0023300
736 Ga0495654_0027622
737 Ga0495654_0058187
738 Ga0495654_0088871
739 Ga0495654_0114003
740 Ga0495609_0008086
741 Ga0495609_0009745
742 Ga0495597_0014005
743 Ga0495597_0017471
744 Ga0495597_0023167
745 Ga0495597_0031221
746 Ga0495622_0080112
747 Ga0495622_0149938
748 Ga0495656_0034674
749 Ga0495656_0083214
750 Ga0495668_0247668
751 Ga0495668_0369574
752 Ga0495611_0024608
753 Ga0495611_0028660
754 Ga0495611_0121621
755 Ga0495611_0203570
756 Ga0495625_0006971
757 Ga0495625_0029328
758 Ga0495625_0080085
759 Ga0495625_0117570
760 Ga0495625_0121907
761 Ga0495625_0203872
762 Ga0495625_0276590
763 Ga0495625_0278270
764 Ga0495659_0000457
765 Ga0495659_0013314
766 Ga0495659_0037263
767 Ga0495659_0067088
768 Ga0495661_0073550
769 Ga0495661_0079931
770 Ga0495661_0160819
771 Ga0495661_0240264
772 Ga0495588_0335405
773 Ga0495669_0007735
774 Ga0495670_0012701
775 Ga0495670_0030889
776 Ga0495670_0325451
777 Ga0495671_0011275
778 Ga0495671_0011462
779 Ga0495671_0019136
780 Ga0495671_0026750
781 Ga0495671_0039318
782 Ga0495671_0041114
783 Ga0495649_0001000
784 Ga0495649_0020437
785 Ga0495649_0020852
786 Ga0495649_0027542
787 Ga0495649_0065616
788 Ga0495649_0075604
789 Ga0495649_0199565
790 Ga0495589_0004057
791 Ga0495589_0006766
792 Ga0495589_0012140
793 Ga0495589_0028032
794 Ga0495589_0031176
795 Ga0495589_0045001
796 Ga0495589_0140339
797 Ga0495660_0005328
798 Ga0495660_0013447
799 Ga0495660_0026469
800 Ga0495660_0041030
801 Ga0495660_0046370
802 Ga0495660_0075592
803 Ga0495660_0158427
804 Ga0495660_0169259
805 Ga0495660_0196008
806 Ga0495660_0212215
807 Ga0495581_0025949
808 Ga0495636_0011258
809 Ga0495672_0004532
810 Ga0495672_0013081
811 Ga0495672_0017425
812 Ga0495672_0020229
813 Ga0495672_0039380
814 Ga0495672_0067464
815 Ga0495672_0072436
816 Ga0495672_0186081
817 Ga0495683_0001446
818 Ga0495683_0009570
819 Ga0495683_0010852
820 Ga0495683_0022195
821 Ga0495683_0025685
822 Ga0495683_0050146
823 Ga0495683_0062984
824 Ga0495687_002579
825 Ga0495687_013440
826 Ga0495687_126815
827 Ga0495677_0058369
828 Ga0495679_018459
829 Ga0495685_015385
830 Ga0495673_0001376
831 Ga0495673_0006316
832 Ga0495673_0009282
833 Ga0495673_0026520
834 Ga0495673_0033123
835 Ga0495673_0065160
836 Ga0495673_0142686
837 Ga0495673_0147946
838 Ga0495673_0178105
839 Ga0495681_0002070
840 Ga0495681_0008069
841 Ga0495681_0017408
842 Ga0495681_0027297
843 Ga0495681_0064369
844 Ga0495681_0077481
845 Ga0495681_0229870
846 Ga0495684_0128924
847 Ga0495686_0060970
848 Ga0495686_0078998
849 Ga0495593_0086326
850 Ga0495626_0001872
851 Ga0495626_0002288
852 Ga0495626_0005048
853 Ga0495626_0014164
854 Ga0495626_0026446
855 Ga0495626_0048716
856 Ga0495626_0079689
857 Ga0495626_0080480
858 Ga0495626_0132233
859 Ga0496105_0110416
860 Ga0496106_0208297
861 Ga0496107_0372199
862 Ga0496110_0137433
863 Ga0496110_0248088
864 Ga0496116_0026478
865 Ga0496116_0038400
866 Ga0496117_0038264
867 Ga0496118_0048844
868 Ga0496118_0168945
869 Ga0496120_0148022
870 Ga0496121_0112699
871 Ga0496122_0040302
872 Ga0496122_0085634
873 Ga0496122_0088456
874 Ga0496123_0032143
875 Ga0496124_0340136
876 Ga0495678_002086
877 Ga0495678_006531
878 Ga0495678_015870
879 Ga0495678_023804
880 Ga0495678_036935
881 Ga0495678_042708
882 Ga0495678_043657
883 Ga0495678_044999
884 Ga0495678_046309
885 Ga0495678_050649
886 Ga0495678_078953
887 Ga0495678_098463
888 Ga0495678_161579
889 Ga0495682_0016348
890 Ga0495682_0024710
891 Ga0495682_0047604
892 Ga0501240_007185
893 Ga0501241_003026
894 Ga0501269_008598
895 nmdc:mga03683_27131_c1
896 nmdc:mga03683_37616_c1
897 nmdc:mga00v17_206125_c1
898 nmdc:mga00v17_305303_c1
899 nmdc:mga00v17_444532_c1
900 nmdc:mga00v17_49430_c1
901 nmdc:mga08x19_338658_c1
902 nmdc:mga0sz30_87528_c1
903 2511252917
904 2511271354
905 2511315855
906 2511323223
907 2511329438
908 2511335021
909 2511338317
910 2511344552
911 2511351656
912 2511356017
913 2511363407
914 2599934531
915 2624494400
916 2644187771
917 2715752295
918 2718636073
919 2739198201
920 2739260965
921 2808857987
922 2808926605
923 2808937481
924 2808948766
925 2808959277
926 2808966472
927 2809001359
928 2819659151
929 2842837007
930 2842847746
931 2880235441
932 2904555904
933 2919390714
934 2919490993
935 2919701499
936 2939641784
937 2974294657
938 2988730909
939 2998144861
940 3007860068
941 3007866318
942 8019781884
943 8029996034
944 8056171707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

18

80

0.93

PF07729

FCD

FCD domain

90

210

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dt4-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of camp-regulatory protein from yersinia pestis in complex with camp 0.8557 39 82
1i6x-assembly1.cif.gz_B structure of a star mutant crp-camp at 2.2 a 0.8464 39 82
7oz3-assembly1.cif.gz_D s. agalactiae busr in complex with its busa-promotor dna 0.8351 24 82
4p9f-assembly1.cif.gz_A e. coli mcbr/yncc 0.8297 23 218
2hs5-assembly1.cif.gz_A structural genomics, the crystal structure of a putative transcriptional regulator gntr from rhodococcus sp. rha1 0.8226 23 218
ID Description Score Start End Superfamily
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9107 23 82 1.10.10.10
af_P37338_7_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8988 21 77 1.10.10.10
af_P39399_1_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 23 82 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8763 39 81 1.10.10.10
af_P0ACM2_81_217_1.20.120.530 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.8731 87 217 1.20.120.530
ID Description Score Start End GO Terms
AF-A0A5R8QNQ9-F1-model_v4 deleted 0.9108 11 218
AF-A0A1A9F025-F1-model_v4 GntR family transcriptional regulator 0.9098 23 215 GO:0003677
GO:0003700
AF-A0A009ST91-F1-model_v4 FCD domain protein 0.8975 81 215 GO:0003677
AF-A0A5R8QNQ9-F1-model_v4 deleted 0.8822 11 218
AF-G1UZ86-F1-model_v4 HTH gntR-type domain-containing protein 0.875 23 217 GO:0003677
GO:0003700

Map