F450827

General Info

Members Datasets Scaffolds Average Seq Length
472 221 469 104

Family's Representative Sequence

Representative Sequence 3300030744|Ga0316181_1005850|Ga0316181_10058502
Length 117
Sequence MASITEAILHQQKRTVMTANLDTAYWLGLAISVALPVLVGLVTTRVTSAGIKAVLLLALTAANGFLVELSQAGDGYSIGTAIILWGVSFAVGVLLHFGLYKPTGVSGLAQDSFRTAA

Samples

Sample ID Description Type Environment
1 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
2 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
3 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
25 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
26 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
27 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
28 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
29 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
41 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
42 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
43 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
44 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
51 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
55 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
56 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
57 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
58 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
59 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
60 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
61 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
62 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
66 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
69 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
70 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
71 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
72 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
191 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
193 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
194 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
197 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
198 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
201 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
204 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
211 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
217 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
220 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
221 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.71
Nodule 0.42
Rhizoplane 3.81
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10004517 3300003316 Bacteria 13371
2 rootH1_10036342 3300003316 Bacteria 16542
3 rootH1_10053835 3300003316 Bacteria 4252
4 rootH1_10054041 3300003316 Bacteria 3632
5 rootH2_10008088 3300003320 Bacteria 39205
6 rootH2_10028156 3300003320 Bacteria 9079
7 rootL2_10000823 3300003322 Bacteria 54432
8 rootH1_10000973 3300003323 Bacteria 36668
9 rootH1_10004880 3300003323 Bacteria 55104
10 Ga0070706_100225353 3300005467 Bacteria 1750
11 Ga0070707_100215708 3300005468 Bacteria 1870
12 Ga0068855_101744300 3300005563 Bacteria 634
13 Ga0068857_101115596 3300005577 Bacteria 762
14 Ga0068856_100107182 3300005614 Bacteria 2789
15 Ga0081455_10037898 3300005937 Bacteria 4272
16 Ga0081455_10447338 3300005937 Bacteria 883
17 Ga0105251_10050060 3300009011 Bacteria 1997
18 Ga0105251_10282303 3300009011 Bacteria 751
19 Ga0105251_10295211 3300009011 Bacteria 734
20 Ga0105251_10539923 3300009011 Bacteria 548
21 Ga0105250_10000140 3300009092 Bacteria 62809
22 Ga0105250_10099216 3300009092 Bacteria 1188
23 Ga0105250_10288724 3300009092 Bacteria 707
24 Ga0157371_10004547 3300013102 Bacteria 12075
25 Ga0157371_10021526 3300013102 Unclassified 4732
26 Ga0207696_1000271 3300025711 Bacteria 62813
27 Ga0207713_1014729 3300025735 Bacteria 4042
28 Ga0207713_1104488 3300025735 Unclassified 972
29 Ga0207684_10301812 3300025910 Bacteria 1381
30 Ga0207646_10181661 3300025922 Bacteria 1900
31 Ga0207667_11033347 3300025949 Bacteria 808
32 Ga0207702_10041602 3300026078 Bacteria 3854
33 Ga0207674_10661226 3300026116 Bacteria 1009
34 Ga0209282_1011794 3300027666 Bacteria 5554
35 Ga0209282_1150101 3300027666 Bacteria 1127
36 Ga0314311_1210753 3300030733 Bacteria 636
37 Ga0316178_1079800 3300030735 Bacteria 860
38 Ga0316180_1085976 3300030736 Bacteria 878
39 Ga0316181_1005804 3300030744 Bacteria 610
40 Ga0316181_1005850 3300030744 Bacteria 777
41 Ga0307509_10000684 3300031507 Bacteria 57886
42 Ga0307509_10001133 3300031507 Bacteria 45712
43 Ga0307405_10009655 3300031731 Bacteria 4956
44 Ga0307406_10016748 3300031901 Bacteria 4264
45 Ga0307412_10004330 3300031911 Bacteria 7914
46 Ga0307416_100003821 3300032002 Bacteria 8949
47 Ga0307411_10569385 3300032005 Bacteria 969
48 Ga0395899_0556285 3300037312 Bacteria 736
49 Ga0395899_0580157 3300037312 Bacteria 717
50 Ga0395900_0051443 3300037418 Bacteria 4243
51 Ga0395900_0165916 3300037418 Bacteria 2250
52 Ga0395900_0166704 3300037418 Viruses 2244
53 Ga0395898_0051947 3300037466 Bacteria 4005
54 Ga0395898_0153042 3300037466 Bacteria 2206
55 Ga0395898_0230731 3300037466 Unclassified 1765
56 Ga0395898_0660666 3300037466 Bacteria 988
57 Ga0395905_0089888 3300037471 Bacteria 2878
58 Ga0395905_0886853 3300037471 Bacteria 795
59 Ga0395901_0949760 3300038443 Bacteria 838
60 Ga0395901_1791904 3300038443 Bacteria 563
61 Ga0439438_024377 3300041405 Bacteria 1657
62 Ga0439439_0000016 3300041406 Bacteria 27277
63 Ga0439439_0004861 3300041406 Bacteria 3045
64 Ga0439447_006344 3300041407 Bacteria 3849
65 Ga0439447_020149 3300041407 Bacteria 1772
66 Ga0439453_0023004 3300041408 Bacteria 1134
67 Ga0439453_0187221 3300041408 Bacteria 508
68 Ga0439461_0000769 3300041410 Bacteria 4694
69 Ga0451853_1429319 3300041512 Bacteria 2916
70 Ga0451853_2075841 3300041512 Bacteria 2642
71 Ga0451853_3553688 3300041512 Bacteria 848
72 Ga0439431_0009267 3300041997 Unclassified 2221
73 Ga0439433_0000038 3300041999 Bacteria 16549
74 Ga0439433_0087400 3300041999 Bacteria 763
75 Ga0439442_022837 3300042002 Bacteria 1299
76 Ga0439449_0002085 3300042007 Bacteria 7861
77 Ga0439449_0021154 3300042007 Bacteria 2436
78 Ga0439452_036914 3300042010 Bacteria 1168
79 Ga0439452_038085 3300042010 Bacteria 1143
80 Ga0439454_025239 3300042011 Bacteria 903
81 Ga0439457_000430 3300042014 Bacteria 12101
82 Ga0439457_003779 3300042014 Bacteria 4064
83 Ga0439462_0000066 3300042015 Bacteria 15576
84 Ga0450911_000257 3300042115 Bacteria 20036
85 Ga0450911_000750 3300042115 Bacteria 9300
86 Ga0450920_000283 3300042122 Bacteria 7678
87 Ga0450923_067956 3300042125 Bacteria 787
88 Ga0450897_000005 3300042128 Bacteria 15037
89 Ga0450897_000028 3300042128 Bacteria 6702
90 Ga0450894_000009 3300042131 Bacteria 27091
91 Ga0450894_001628 3300042131 Bacteria 3170
92 Ga0450894_002366 3300042131 Bacteria 2543
93 Ga0450895_000014 3300042132 Bacteria 6909
94 Ga0450895_000056 3300042132 Bacteria 4163
95 Ga0450896_000185 3300042133 Bacteria 5292
96 Ga0450898_000002 3300042134 Bacteria 25155
97 Ga0450898_000893 3300042134 Bacteria 3732
98 Ga0450898_001033 3300042134 Bacteria 3529
99 Ga0450899_000002 3300042135 Bacteria 28179
100 Ga0450899_000756 3300042135 Bacteria 3685
101 Ga0450903_006635 3300042138 Bacteria 1916
102 Ga0450906_002777 3300042145 Bacteria 3813
103 Ga0450906_010693 3300042145 Bacteria 1729
104 Ga0450907_002370 3300042146 Bacteria 3626
105 Ga0450910_000345 3300042147 Bacteria 5400
106 Ga0450910_000776 3300042147 Bacteria 3844
107 Ga0439458_0004076 3300042157 Bacteria 3371
108 Ga0450908_003109 3300042184 Bacteria 3227
109 Ga0450908_004060 3300042184 Bacteria 2830
110 Ga0450909_000264 3300042185 Bacteria 6324
111 Ga0450918_010269 3300042531 Bacteria 1636
112 Ga0450893_0065729 3300042532 Bacteria 698
113 Ga0450901_000004 3300042533 Bacteria 35963
114 Ga0450901_002007 3300042533 Bacteria 2256
115 Ga0466961_0090880 3300044693 Bacteria 1928
116 Ga0466967_1167601 3300045976 Unclassified 767
117 Ga0495617_001975 3300046452 Bacteria 8577
118 Ga0495617_006726 3300046452 Bacteria 4019
119 Ga0495592_0050690 3300046454 Bacteria 3084
120 Ga0495592_0227898 3300046454 Bacteria 1242
121 Ga0495603_0000041 3300046455 Bacteria 54992
122 Ga0495603_0000120 3300046455 Bacteria 38417
123 Ga0495603_0000125 3300046455 Bacteria 37553
124 Ga0495603_0003152 3300046455 Bacteria 9805
125 Ga0495603_0036542 3300046455 Bacteria 2949
126 Ga0495603_0060157 3300046455 Bacteria 2244
127 Ga0495603_0344818 3300046455 Bacteria 854
128 Ga0495603_0638142 3300046455 Bacteria 610
129 Ga0495603_0870340 3300046455 Bacteria 512
130 Ga0495590_0000536 3300046457 Bacteria 18192
131 Ga0495591_044034 3300046458 Bacteria 1252
132 Ga0495629_0000185 3300046459 Bacteria 56124
133 Ga0495629_0025854 3300046459 Bacteria 4172
134 Ga0495629_0104689 3300046459 Bacteria 1974
135 Ga0495629_0378505 3300046459 Bacteria 963
136 Ga0495638_0060982 3300046460 Bacteria 2331
137 Ga0495651_0041458 3300046462 Bacteria 3576
138 Ga0495651_0687124 3300046462 Bacteria 639
139 Ga0495580_0035125 3300046472 Bacteria 3605
140 Ga0495580_0280165 3300046472 Unclassified 1137
141 Ga0495582_0775601 3300046473 Bacteria 555
142 Ga0495605_0003017 3300046474 Bacteria 10158
143 Ga0495605_0004495 3300046474 Bacteria 8172
144 Ga0495605_0029355 3300046474 Bacteria 2831
145 Ga0495639_0000026 3300046475 Bacteria 68642
146 Ga0495639_0000080 3300046475 Bacteria 45233
147 Ga0495639_0001427 3300046475 Bacteria 10676
148 Ga0495639_0322282 3300046475 Bacteria 773
149 Ga0495662_0000012 3300046476 Bacteria 66974
150 Ga0495662_0020184 3300046476 Bacteria 3223
151 Ga0495662_0047630 3300046476 Bacteria 2069
152 Ga0495662_0064180 3300046476 Bacteria 1774
153 Ga0495662_0115969 3300046476 Bacteria 1313
154 Ga0495662_0140943 3300046476 Bacteria 1187
155 Ga0495664_0661831 3300046477 Bacteria 618
156 Ga0495584_0003048 3300046491 Bacteria 9302
157 Ga0495584_0140441 3300046491 Bacteria 1227
158 Ga0495585_0002295 3300046492 Bacteria 13784
159 Ga0495585_0005956 3300046492 Bacteria 7627
160 Ga0495585_0035521 3300046492 Bacteria 2815
161 Ga0495585_0049866 3300046492 Bacteria 2323
162 Ga0495585_0366309 3300046492 Bacteria 698
163 Ga0495594_0000026 3300046499 Bacteria 68304
164 Ga0495594_0000027 3300046499 Bacteria 68059
165 Ga0495594_0000040 3300046499 Bacteria 57293
166 Ga0495594_0000059 3300046499 Bacteria 47935
167 Ga0495594_0001688 3300046499 Bacteria 11480
168 Ga0495594_0010392 3300046499 Bacteria 4827
169 Ga0495594_0012718 3300046499 Bacteria 4391
170 Ga0495594_0033651 3300046499 Bacteria 2787
171 Ga0495594_0097020 3300046499 Bacteria 1656
172 Ga0495594_0168236 3300046499 Bacteria 1247
173 Ga0495594_0238010 3300046499 Bacteria 1037
174 Ga0495594_0245431 3300046499 Bacteria 1020
175 Ga0495596_0000169 3300046500 Bacteria 45484
176 Ga0495607_0000695 3300046501 Bacteria 32470
177 Ga0495607_0001507 3300046501 Bacteria 20552
178 Ga0495607_0194182 3300046501 Bacteria 1009
179 Ga0495583_0000488 3300046506 Bacteria 57631
180 Ga0495583_0001921 3300046506 Bacteria 19213
181 Ga0495583_0003943 3300046506 Bacteria 10972
182 Ga0495583_0023814 3300046506 Bacteria 3088
183 Ga0495583_0049342 3300046506 Bacteria 1928
184 Ga0495606_0000582 3300046507 Bacteria 57972
185 Ga0495606_0000584 3300046507 Bacteria 57919
186 Ga0495606_0022487 3300046507 Bacteria 4593
187 Ga0495610_0000672 3300046512 Bacteria 33210
188 Ga0495610_0061849 3300046512 Unclassified 1777
189 Ga0495610_0077897 3300046512 Bacteria 1530
190 Ga0495610_0127751 3300046512 Unclassified 1107
191 Ga0495616_0011666 3300046513 Bacteria 5025
192 Ga0495616_0038747 3300046513 Bacteria 2445
193 Ga0495616_0139183 3300046513 Bacteria 1106
194 Ga0495616_0309107 3300046513 Bacteria 666
195 Ga0495620_0011220 3300046515 Bacteria 4683
196 Ga0495620_0076194 3300046515 Bacteria 1363
197 Ga0495628_0000356 3300046516 Bacteria 41722
198 Ga0495631_0107823 3300046518 Unclassified 1197
199 Ga0495631_0179242 3300046518 Bacteria 908
200 Ga0495631_0274132 3300046518 Bacteria 718
201 Ga0495631_0325248 3300046518 Bacteria 654
202 Ga0495632_0000583 3300046519 Bacteria 33819
203 Ga0495637_0000121 3300046520 Bacteria 57766
204 Ga0495643_0001227 3300046522 Bacteria 24733
205 Ga0495643_0520807 3300046522 Bacteria 509
206 Ga0495644_0003365 3300046523 Bacteria 6319
207 Ga0495648_0013101 3300046524 Bacteria 6148
208 Ga0495648_0110889 3300046524 Bacteria 1493
209 Ga0495648_0261205 3300046524 Bacteria 830
210 Ga0495648_0296870 3300046524 Bacteria 759
211 Ga0495666_0000029 3300046526 Bacteria 54957
212 Ga0495666_0195792 3300046526 Bacteria 930
213 Ga0495642_0000258 3300046528 Bacteria 29841
214 Ga0495642_0051208 3300046528 Bacteria 1698
215 Ga0495652_0153048 3300046529 Bacteria 1799
216 Ga0495654_0024151 3300046530 Bacteria 3143
217 Ga0495640_0078764 3300046533 Bacteria 2195
218 Ga0495586_0000054 3300046535 Bacteria 68112
219 Ga0495587_0060391 3300046536 Bacteria 2223
220 Ga0495587_0800458 3300046536 Bacteria 515
221 Ga0495609_0010229 3300046538 Bacteria 4507
222 Ga0495609_0031328 3300046538 Bacteria 2417
223 Ga0495609_0110137 3300046538 Bacteria 1189
224 Ga0495609_0339078 3300046538 Bacteria 608
225 Ga0495597_0013305 3300046542 Bacteria 3946
226 Ga0495597_0075548 3300046542 Bacteria 1446
227 Ga0495597_0125932 3300046542 Bacteria 1065
228 Ga0495597_0146951 3300046542 Bacteria 969
229 Ga0495622_0000315 3300046557 Bacteria 35856
230 Ga0495622_0001109 3300046557 Bacteria 14090
231 Ga0495622_0003048 3300046557 Bacteria 7952
232 Ga0495622_0005332 3300046557 Bacteria 5967
233 Ga0495622_0006009 3300046557 Bacteria 5640
234 Ga0495622_0013683 3300046557 Bacteria 3761
235 Ga0495622_0022551 3300046557 Bacteria 2934
236 Ga0495622_0041168 3300046557 Bacteria 2148
237 Ga0495633_0021592 3300046558 Bacteria 3218
238 Ga0495633_0060575 3300046558 Bacteria 1773
239 Ga0495633_0141933 3300046558 Bacteria 1110
240 Ga0495667_0128343 3300046559 Bacteria 1636
241 Ga0495667_0279174 3300046559 Bacteria 1060
242 Ga0495656_0000364 3300046615 Bacteria 15197
243 Ga0495656_0033779 3300046615 Bacteria 2090
244 Ga0495656_0071357 3300046615 Bacteria 1543
245 Ga0495668_0001683 3300046616 Bacteria 20471
246 Ga0495668_0001726 3300046616 Bacteria 20141
247 Ga0495668_0002139 3300046616 Bacteria 17027
248 Ga0495668_0050190 3300046616 Bacteria 2312
249 Ga0495668_0197835 3300046616 Bacteria 1100
250 Ga0495668_0270134 3300046616 Bacteria 931
251 Ga0495668_0276802 3300046616 Bacteria 919
252 Ga0495634_0000386 3300046642 Bacteria 43016
253 Ga0495634_0007341 3300046642 Bacteria 8293
254 Ga0495634_0132256 3300046642 Bacteria 1589
255 Ga0495611_0000108 3300046648 Bacteria 57847
256 Ga0495611_0000117 3300046648 Bacteria 56523
257 Ga0495611_0001399 3300046648 Bacteria 12067
258 Ga0495611_0082497 3300046648 Bacteria 1480
259 Ga0495611_0092193 3300046648 Bacteria 1401
260 Ga0495625_0023076 3300046660 Bacteria 4757
261 Ga0495625_0035808 3300046660 Bacteria 3654
262 Ga0495625_0057402 3300046660 Bacteria 2768
263 Ga0495625_0177971 3300046660 Bacteria 1416
264 Ga0495625_0267093 3300046660 Bacteria 1105
265 Ga0495625_0292098 3300046660 Bacteria 1045
266 Ga0495635_0011017 3300046663 Bacteria 6337
267 Ga0495661_0000283 3300046665 Bacteria 57751
268 Ga0495661_0098847 3300046665 Bacteria 1646
269 Ga0495588_0647067 3300046674 Bacteria 553
270 Ga0495657_0000801 3300046675 Bacteria 27911
271 Ga0495657_0022616 3300046675 Bacteria 4500
272 Ga0495657_0145685 3300046675 Bacteria 1473
273 Ga0495657_0203577 3300046675 Bacteria 1205
274 Ga0495657_0206871 3300046675 Bacteria 1194
275 Ga0495623_0593582 3300046679 Bacteria 576
276 Ga0495646_0048287 3300046680 Bacteria 2587
277 Ga0495647_0000011 3300046681 Bacteria 93470
278 Ga0495658_0000296 3300046683 Bacteria 28306
279 Ga0495658_0001616 3300046683 Bacteria 11743
280 Ga0495658_0004878 3300046683 Bacteria 6581
281 Ga0495613_0000140 3300046689 Bacteria 72331
282 Ga0495613_0002471 3300046689 Bacteria 13936
283 Ga0495613_0014671 3300046689 Bacteria 5813
284 Ga0495613_0086856 3300046689 Bacteria 2267
285 Ga0495613_0205798 3300046689 Bacteria 1386
286 Ga0495613_0863095 3300046689 Bacteria 587
287 Ga0495624_0005619 3300046690 Bacteria 9003
288 Ga0495670_0001690 3300046691 Bacteria 10839
289 Ga0495670_0096678 3300046691 Bacteria 1517
290 Ga0495670_0549983 3300046691 Bacteria 628
291 Ga0495671_0014073 3300046692 Bacteria 4313
292 Ga0495671_0055106 3300046692 Bacteria 1970
293 Ga0495671_0605504 3300046692 Bacteria 521
294 Ga0495649_0000606 3300046694 Bacteria 29860
295 Ga0495589_0001088 3300046794 Bacteria 16197
296 Ga0495589_0001552 3300046794 Bacteria 13233
297 Ga0495589_0068917 3300046794 Bacteria 1730
298 Ga0495589_0302222 3300046794 Bacteria 741
299 Ga0495589_0325232 3300046794 Bacteria 710
300 Ga0495600_0000745 3300046809 Bacteria 17157
301 Ga0495600_0080419 3300046809 Bacteria 2127
302 Ga0495600_0338652 3300046809 Bacteria 943
303 Ga0495600_0759028 3300046809 Unclassified 580
304 Ga0495660_0000216 3300046810 Bacteria 57887
305 Ga0495660_0067272 3300046810 Bacteria 1909
306 Ga0495660_0098406 3300046810 Bacteria 1509
307 Ga0495581_0000071 3300047315 Bacteria 40218
308 Ga0495581_0000080 3300047315 Bacteria 38435
309 Ga0495581_0000165 3300047315 Bacteria 29613
310 Ga0495581_0044425 3300047315 Bacteria 2569
311 Ga0495581_0100945 3300047315 Bacteria 1676
312 Ga0495581_0254401 3300047315 Bacteria 1027
313 Ga0495581_0448295 3300047315 Bacteria 752
314 Ga0495604_0080694 3300047317 Bacteria 2437
315 Ga0495604_0136131 3300047317 Bacteria 1760
316 Ga0495604_0174668 3300047317 Bacteria 1507
317 Ga0495604_0927091 3300047317 Bacteria 543
318 Ga0495636_0020947 3300047318 Bacteria 2636
319 Ga0495636_0034727 3300047318 Bacteria 2076
320 Ga0495636_0047084 3300047318 Bacteria 1800
321 Ga0495636_0145885 3300047318 Bacteria 1059
322 Ga0495636_0604503 3300047318 Bacteria 536
323 Ga0495672_0116119 3300047320 Unclassified 1429
324 Ga0495676_0088009 3300047321 Bacteria 2331
325 Ga0495680_0002120 3300047322 Bacteria 20609
326 Ga0495680_0636247 3300047322 Bacteria 710
327 Ga0495683_0000232 3300047323 Bacteria 51030
328 Ga0495683_0001685 3300047323 Bacteria 14064
329 Ga0495683_0010013 3300047323 Bacteria 5029
330 Ga0495683_0131071 3300047323 Bacteria 1182
331 Ga0495683_0452567 3300047323 Bacteria 526
332 Ga0495687_002206 3300047443 Bacteria 16099
333 Ga0495687_003115 3300047443 Bacteria 12393
334 Ga0495687_006993 3300047443 Bacteria 6771
335 Ga0495687_035100 3300047443 Bacteria 2258
336 Ga0495687_083625 3300047443 Bacteria 1242
337 Ga0495687_098671 3300047443 Bacteria 1101
338 Ga0495687_144269 3300047443 Bacteria 823
339 Ga0495687_180506 3300047443 Bacteria 689
340 Ga0495675_0009892 3300047444 Bacteria 5946
341 Ga0495675_0240011 3300047444 Bacteria 1091
342 Ga0495675_0631279 3300047444 Bacteria 605
343 Ga0495675_0657238 3300047444 Bacteria 590
344 Ga0495677_0042070 3300047445 Bacteria 1673
345 Ga0495677_0051442 3300047445 Bacteria 1517
346 Ga0495677_0139039 3300047445 Bacteria 932
347 Ga0495677_0332474 3300047445 Bacteria 599
348 Ga0495679_000444 3300047446 Bacteria 30537
349 Ga0495679_162523 3300047446 Bacteria 596
350 Ga0495685_000061 3300047447 Bacteria 41124
351 Ga0495685_001611 3300047447 Bacteria 6966
352 Ga0495685_002380 3300047447 Bacteria 5888
353 Ga0495685_006819 3300047447 Bacteria 3755
354 Ga0495685_041271 3300047447 Bacteria 1577
355 Ga0495685_101277 3300047447 Bacteria 951
356 Ga0495685_103440 3300047447 Bacteria 939
357 Ga0495685_235611 3300047447 Bacteria 582
358 Ga0495673_0010052 3300047469 Bacteria 5178
359 Ga0495681_0000152 3300047470 Bacteria 57847
360 Ga0495681_0007012 3300047470 Bacteria 7280
361 Ga0495681_0029162 3300047470 Bacteria 2828
362 Ga0495681_0033334 3300047470 Bacteria 2581
363 Ga0495681_0056693 3300047470 Bacteria 1822
364 Ga0495681_0077414 3300047470 Bacteria 1492
365 Ga0495686_0000343 3300047472 Bacteria 76639
366 Ga0495686_0000611 3300047472 Bacteria 49375
367 Ga0495686_0088316 3300047472 Bacteria 1885
368 Ga0495686_0220007 3300047472 Bacteria 1081
369 Ga0495593_0000035 3300047673 Bacteria 54459
370 Ga0495593_0393982 3300047673 Bacteria 692
371 Ga0495602_0004376 3300048088 Bacteria 14737
372 Ga0495614_0000048 3300048089 Bacteria 37564
373 Ga0495614_0000138 3300048089 Bacteria 25939
374 Ga0495614_0003018 3300048089 Bacteria 7492
375 Ga0495614_0033642 3300048089 Bacteria 2205
376 Ga0495614_0060639 3300048089 Bacteria 1625
377 Ga0495614_0311797 3300048089 Bacteria 729
378 Ga0495614_0324977 3300048089 Bacteria 714
379 Ga0495626_0007063 3300048091 Bacteria 6300
380 Ga0495626_0298337 3300048091 Bacteria 637
381 Ga0496100_0011746 3300048903 Bacteria 4994
382 Ga0496104_1485965 3300048907 Bacteria 580
383 Ga0496105_0141550 3300048908 Bacteria 1980
384 Ga0496106_0863917 3300048909 Bacteria 715
385 Ga0496107_0019260 3300048910 Bacteria 4815
386 Ga0496107_0221077 3300048910 Bacteria 1409
387 Ga0496108_0000680 3300048911 Bacteria 26293
388 Ga0496108_1068632 3300048911 Bacteria 687
389 Ga0496109_0039816 3300048912 Bacteria 4255
390 Ga0496109_0402861 3300048912 Bacteria 1292
391 Ga0496109_1330778 3300048912 Bacteria 654
392 Ga0496110_0083229 3300048913 Bacteria 2854
393 Ga0496110_0220087 3300048913 Bacteria 1726
394 Ga0496111_0198827 3300048914 Bacteria 1490
395 Ga0496111_0706795 3300048914 Bacteria 733
396 Ga0496113_1334679 3300048916 Bacteria 557
397 Ga0496113_1450982 3300048916 Bacteria 530
398 Ga0496115_0341040 3300048918 Bacteria 1223
399 Ga0495678_015766 3300049459 Bacteria 3470
400 Ga0495682_0048399 3300049460 Bacteria 1550
401 Ga0501031_0642731 3300049568 Bacteria 682
402 Ga0501037_0014131 3300049573 Bacteria 5881
403 Ga0501038_0000330 3300049574 Bacteria 40847
404 Ga0501038_0271279 3300049574 Bacteria 1338
405 Ga0501073_0000077 3300049589 Bacteria 61488
406 Ga0501227_000498 3300049665 Bacteria 8409
407 Ga0501080_0017801 3300049742 Bacteria 6577
408 Ga0501044_0010109 3300049823 Bacteria 10253
409 Ga0500610_0000023 3300053079 Bacteria 57766
410 Ga0495655_0000014 3300053083 Bacteria 57963
411 Ga0500578_0000328 3300053086 Bacteria 57972
412 Ga0500578_0007279 3300053086 Bacteria 7311
413 Ga0500643_000192 3300053087 Bacteria 58154
414 Ga0500644_0006879 3300053088 Bacteria 2932
415 Ga0500644_0135632 3300053088 Bacteria 973
416 Ga0500644_0205916 3300053088 Bacteria 815
417 Ga0500646_0004641 3300053090 Bacteria 3471
418 Ga0500583_0000328 3300053092 Bacteria 15986
419 Ga0500651_0001038 3300053093 Bacteria 13725
420 Ga0500651_0060536 3300053093 Bacteria 2366
421 Ga0500566_0000853 3300053094 Bacteria 17410
422 Ga0500650_0001327 3300053098 Bacteria 7366
423 Ga0500650_0190895 3300053098 Bacteria 935
424 Ga0500654_015507 3300053099 Bacteria 5038
425 Ga0500556_0000154 3300053104 Bacteria 57766
426 Ga0500557_013301 3300053105 Bacteria 2162
427 Ga0500558_204740 3300053106 Bacteria 684
428 Ga0500562_000101 3300053108 Bacteria 33291
429 Ga0500569_000046 3300053109 Bacteria 22896
430 Ga0500569_029221 3300053109 Bacteria 1534
431 Ga0500582_000005 3300053114 Bacteria 58232
432 Ga0500582_059310 3300053114 Bacteria 1277
433 Ga0500594_0000152 3300053118 Bacteria 18450
434 Ga0500617_009998 3300053124 Bacteria 3907
435 Ga0500621_016443 3300053126 Bacteria 2742
436 Ga0500621_023080 3300053126 Bacteria 2407
437 Ga0500623_169132 3300053127 Bacteria 865
438 Ga0500628_000051 3300053129 Bacteria 39645
439 Ga0500652_000121 3300053131 Bacteria 29746
440 Ga0500652_000548 3300053131 Bacteria 13077
441 Ga0500652_023997 3300053131 Bacteria 2324
442 Ga0500655_000029 3300053133 Bacteria 40342
443 Ga0500658_0000055 3300053134 Bacteria 58360
444 Ga0500658_0000883 3300053134 Bacteria 12307
445 Ga0500659_0155177 3300053135 Bacteria 1137
446 Ga0500561_0000011 3300053137 Bacteria 55400
447 Ga0500561_0000524 3300053137 Bacteria 6207
448 Ga0500561_0005216 3300053137 Unclassified 2396
449 Ga0500568_0042815 3300053139 Bacteria 1813
450 Ga0500573_0000064 3300053140 Bacteria 64925
451 Ga0500577_0000023 3300053142 Bacteria 39947
452 Ga0500586_000013 3300053145 Bacteria 40736
453 Ga0500588_0000008 3300053146 Bacteria 57766
454 Ga0500589_036941 3300053147 Bacteria 2280
455 Ga0500603_002892 3300053150 Bacteria 3718
456 Ga0500616_0007593 3300053153 Bacteria 6855
457 Ga0500616_0008738 3300053153 Bacteria 6246
458 Ga0500616_0054689 3300053153 Bacteria 2090
459 Ga0500622_0004202 3300053156 Bacteria 9174
460 Ga0500627_0000066 3300053158 Bacteria 44709
461 Ga0500633_0000019 3300053160 Bacteria 33646
462 Ga0500633_0240494 3300053160 Bacteria 673
463 Ga0500634_0000043 3300053161 Bacteria 57736
464 Ga0500570_003260 3300053724 Bacteria 8294
465 Ga0500611_066682 3300053727 Unclassified 866
466 Ga0500656_000017 3300053732 Bacteria 27862
467 Ga0500552_000005 3300053733 Bacteria 59769
468 Ga0500587_000014 3300053739 Bacteria 38174
469 Ga0500587_013579 3300053739 Bacteria 1029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10037898 Ga0081455_100378987 83
2 3300048914 Ga0496111_0198827 Ga0496111_0198827_1223_1480 85
3 3300046518 Ga0495631_0325248 Ga0495631_0325248_353_619 88
4 3300030744 Ga0316181_1005850 Ga0316181_10058502 101
5 3300031507 Ga0307509_10000684 Ga0307509_1000068456 101
6 3300031507 Ga0307509_10001133 Ga0307509_1000113342 101
7 3300041512 Ga0451853_2075841 Ga0451853_2075841_1259_1564 101
8 3300046452 Ga0495617_001975 Ga0495617_001975_1819_2124 101
9 3300046457 Ga0495590_0000536 Ga0495590_0000536_1829_2134 101
10 3300046458 Ga0495591_044034 Ga0495591_044034_461_766 101
11 3300046460 Ga0495638_0060982 Ga0495638_0060982_685_990 101
12 3300046472 Ga0495580_0280165 Ga0495580_0280165_15_320 101
13 3300046474 Ga0495605_0004495 Ga0495605_0004495_3359_3664 101
14 3300046491 Ga0495584_0003048 Ga0495584_0003048_4995_5300 101
15 3300046492 Ga0495585_0005956 Ga0495585_0005956_5977_6282 101
16 3300046500 Ga0495596_0000169 Ga0495596_0000169_8935_9240 101
17 3300046501 Ga0495607_0001507 Ga0495607_0001507_5299_5604 101
18 3300046506 Ga0495583_0000488 Ga0495583_0000488_44778_45083 101
19 3300046507 Ga0495606_0000582 Ga0495606_0000582_9223_9528 101
20 3300046512 Ga0495610_0000672 Ga0495610_0000672_8865_9170 101
21 3300046513 Ga0495616_0011666 Ga0495616_0011666_65_370 101
22 3300046515 Ga0495620_0011220 Ga0495620_0011220_2550_2855 101
23 3300046515 Ga0495620_0076194 Ga0495620_0076194_674_979 101
24 3300046518 Ga0495631_0107823 Ga0495631_0107823_179_484 101
25 3300046519 Ga0495632_0000583 Ga0495632_0000583_24650_24955 101
26 3300046520 Ga0495637_0000121 Ga0495637_0000121_34262_34567 101
27 3300046522 Ga0495643_0001227 Ga0495643_0001227_18273_18578 101
28 3300046523 Ga0495644_0003365 Ga0495644_0003365_1755_2060 101
29 3300046524 Ga0495648_0110889 Ga0495648_0110889_401_706 101
30 3300046524 Ga0495648_0261205 Ga0495648_0261205_295_600 101
31 3300046528 Ga0495642_0000258 Ga0495642_0000258_19327_19632 101
32 3300046528 Ga0495642_0051208 Ga0495642_0051208_76_381 101
33 3300046530 Ga0495654_0024151 Ga0495654_0024151_2813_3118 101
34 3300046538 Ga0495609_0010229 Ga0495609_0010229_2528_2833 101
35 3300046538 Ga0495609_0031328 Ga0495609_0031328_385_690 101
36 3300046542 Ga0495597_0013305 Ga0495597_0013305_1194_1499 101
37 3300046558 Ga0495633_0060575 Ga0495633_0060575_1004_1309 101
38 3300046615 Ga0495656_0071357 Ga0495656_0071357_1159_1464 101
39 3300046616 Ga0495668_0197835 Ga0495668_0197835_395_700 101
40 3300046616 Ga0495668_0276802 Ga0495668_0276802_410_715 101
41 3300046648 Ga0495611_0000108 Ga0495611_0000108_26365_26670 101
42 3300046660 Ga0495625_0177971 Ga0495625_0177971_32_337 101
43 3300046665 Ga0495661_0000283 Ga0495661_0000283_10058_10363 101
44 3300046691 Ga0495670_0001690 Ga0495670_0001690_5467_5772 101
45 3300046692 Ga0495671_0014073 Ga0495671_0014073_134_439 101
46 3300046694 Ga0495649_0000606 Ga0495649_0000606_6432_6737 101
47 3300046794 Ga0495589_0001088 Ga0495589_0001088_11023_11328 101
48 3300046810 Ga0495660_0000216 Ga0495660_0000216_7112_7417 101
49 3300047320 Ga0495672_0116119 Ga0495672_0116119_971_1276 101
50 3300047323 Ga0495683_0000232 Ga0495683_0000232_27606_27911 101
51 3300047446 Ga0495679_000444 Ga0495679_000444_8979_9284 101
52 3300047446 Ga0495679_162523 Ga0495679_162523_52_357 101
53 3300047447 Ga0495685_235611 Ga0495685_235611_228_533 101
54 3300047469 Ga0495673_0010052 Ga0495673_0010052_4528_4833 101
55 3300047470 Ga0495681_0000152 Ga0495681_0000152_40467_40772 101
56 3300047472 Ga0495686_0000611 Ga0495686_0000611_21924_22229 101
57 3300048091 Ga0495626_0007063 Ga0495626_0007063_4223_4528 101
58 3300049459 Ga0495678_015766 Ga0495678_015766_2850_3155 101
59 3300049460 Ga0495682_0048399 Ga0495682_0048399_202_507 101
60 3300049665 Ga0501227_000498 Ga0501227_000498_5368_5673 101
61 3300053079 Ga0500610_0000023 Ga0500610_0000023_37928_38233 101
62 3300053083 Ga0495655_0000014 Ga0495655_0000014_48469_48774 101
63 3300053086 Ga0500578_0000328 Ga0500578_0000328_42193_42498 101
64 3300053086 Ga0500578_0007279 Ga0500578_0007279_5593_5898 101
65 3300053087 Ga0500643_000192 Ga0500643_000192_24695_25000 101
66 3300053088 Ga0500644_0006879 Ga0500644_0006879_2227_2532 101
67 3300053088 Ga0500644_0135632 Ga0500644_0135632_163_468 101
68 3300053088 Ga0500644_0205916 Ga0500644_0205916_406_711 101
69 3300053090 Ga0500646_0004641 Ga0500646_0004641_1299_1604 101
70 3300053092 Ga0500583_0000328 Ga0500583_0000328_4357_4662 101
71 3300053093 Ga0500651_0001038 Ga0500651_0001038_7720_8025 101
72 3300053093 Ga0500651_0060536 Ga0500651_0060536_1658_1963 101
73 3300053098 Ga0500650_0001327 Ga0500650_0001327_3756_4061 101
74 3300053098 Ga0500650_0190895 Ga0500650_0190895_298_603 101
75 3300053099 Ga0500654_015507 Ga0500654_015507_2908_3213 101
76 3300053104 Ga0500556_0000154 Ga0500556_0000154_22659_22964 101
77 3300053105 Ga0500557_013301 Ga0500557_013301_446_751 101
78 3300053108 Ga0500562_000101 Ga0500562_000101_23770_24075 101
79 3300053109 Ga0500569_000046 Ga0500569_000046_7643_7948 101
80 3300053109 Ga0500569_029221 Ga0500569_029221_807_1112 101
81 3300053114 Ga0500582_000005 Ga0500582_000005_9068_9373 101
82 3300053114 Ga0500582_059310 Ga0500582_059310_732_1037 101
83 3300053118 Ga0500594_0000152 Ga0500594_0000152_9411_9716 101
84 3300053124 Ga0500617_009998 Ga0500617_009998_42_347 101
85 3300053126 Ga0500621_016443 Ga0500621_016443_523_828 101
86 3300053126 Ga0500621_023080 Ga0500621_023080_1646_1951 101
87 3300053127 Ga0500623_169132 Ga0500623_169132_266_571 101
88 3300053129 Ga0500628_000051 Ga0500628_000051_30124_30429 101
89 3300053131 Ga0500652_000121 Ga0500652_000121_8979_9284 101
90 3300053131 Ga0500652_023997 Ga0500652_023997_589_894 101
91 3300053133 Ga0500655_000029 Ga0500655_000029_34836_35141 101
92 3300053134 Ga0500658_0000055 Ga0500658_0000055_29479_29784 101
93 3300053135 Ga0500659_0155177 Ga0500659_0155177_673_978 101
94 3300053137 Ga0500561_0000011 Ga0500561_0000011_49798_50103 101
95 3300053137 Ga0500561_0000524 Ga0500561_0000524_3750_4055 101
96 3300053137 Ga0500561_0005216 Ga0500561_0005216_267_572 101
97 3300053139 Ga0500568_0042815 Ga0500568_0042815_790_1095 101
98 3300053142 Ga0500577_0000023 Ga0500577_0000023_28364_28669 101
99 3300053145 Ga0500586_000013 Ga0500586_000013_9521_9826 101
100 3300053146 Ga0500588_0000008 Ga0500588_0000008_2306_2611 101
101 3300053147 Ga0500589_036941 Ga0500589_036941_1082_1387 101
102 3300053153 Ga0500616_0007593 Ga0500616_0007593_6156_6461 101
103 3300053153 Ga0500616_0008738 Ga0500616_0008738_410_715 101
104 3300053153 Ga0500616_0054689 Ga0500616_0054689_1181_1486 101
105 3300053156 Ga0500622_0004202 Ga0500622_0004202_2474_2779 101
106 3300053158 Ga0500627_0000066 Ga0500627_0000066_2689_2994 101
107 3300053160 Ga0500633_0000019 Ga0500633_0000019_2448_2753 101
108 3300053160 Ga0500633_0240494 Ga0500633_0240494_67_372 101
109 3300053161 Ga0500634_0000043 Ga0500634_0000043_29635_29940 101
110 3300053724 Ga0500570_003260 Ga0500570_003260_7413_7718 101
111 3300053727 Ga0500611_066682 Ga0500611_066682_19_324 101
112 3300053732 Ga0500656_000017 Ga0500656_000017_411_716 101
113 3300053733 Ga0500552_000005 Ga0500552_000005_39389_39694 101
114 3300053739 Ga0500587_000014 Ga0500587_000014_379_684 101
115 3300053739 Ga0500587_013579 Ga0500587_013579_409_714 101
116 iso_pu_bacteria 2954673503 2954674064 101
117 3300037466 Ga0395898_0660666 Ga0395898_0660666_352_660 102
118 3300046452 Ga0495617_006726 Ga0495617_006726_2291_2599 102
119 3300046454 Ga0495592_0050690 Ga0495592_0050690_2057_2365 102
120 3300046455 Ga0495603_0000041 Ga0495603_0000041_6506_6814 102
121 3300046455 Ga0495603_0000120 Ga0495603_0000120_7002_7310 102
122 3300046455 Ga0495603_0344818 Ga0495603_0344818_313_621 102
123 3300046459 Ga0495629_0000185 Ga0495629_0000185_3899_4207 102
124 3300046462 Ga0495651_0041458 Ga0495651_0041458_1751_2059 102
125 3300046472 Ga0495580_0035125 Ga0495580_0035125_311_619 102
126 3300046474 Ga0495605_0029355 Ga0495605_0029355_2418_2726 102
127 3300046475 Ga0495639_0000026 Ga0495639_0000026_21969_22277 102
128 3300046475 Ga0495639_0000080 Ga0495639_0000080_35306_35614 102
129 3300046475 Ga0495639_0001427 Ga0495639_0001427_6705_7013 102
130 3300046475 Ga0495639_0322282 Ga0495639_0322282_451_759 102
131 3300046476 Ga0495662_0000012 Ga0495662_0000012_23924_24232 102
132 3300046476 Ga0495662_0020184 Ga0495662_0020184_2726_3034 102
133 3300046476 Ga0495662_0047630 Ga0495662_0047630_591_899 102
134 3300046476 Ga0495662_0115969 Ga0495662_0115969_753_1061 102
135 3300046476 Ga0495662_0140943 Ga0495662_0140943_168_476 102
136 3300046477 Ga0495664_0661831 Ga0495664_0661831_194_502 102
137 3300046491 Ga0495584_0140441 Ga0495584_0140441_77_385 102
138 3300046492 Ga0495585_0002295 Ga0495585_0002295_11203_11511 102
139 3300046492 Ga0495585_0049866 Ga0495585_0049866_624_932 102
140 3300046499 Ga0495594_0000026 Ga0495594_0000026_734_1042 102
141 3300046499 Ga0495594_0001688 Ga0495594_0001688_6506_6814 102
142 3300046499 Ga0495594_0010392 Ga0495594_0010392_1232_1540 102
143 3300046499 Ga0495594_0097020 Ga0495594_0097020_846_1154 102
144 3300046501 Ga0495607_0000695 Ga0495607_0000695_30010_30318 102
145 3300046501 Ga0495607_0194182 Ga0495607_0194182_379_687 102
146 3300046506 Ga0495583_0001921 Ga0495583_0001921_1013_1321 102
147 3300046507 Ga0495606_0000584 Ga0495606_0000584_56853_57161 102
148 3300046513 Ga0495616_0139183 Ga0495616_0139183_78_386 102
149 3300046513 Ga0495616_0309107 Ga0495616_0309107_132_440 102
150 3300046516 Ga0495628_0000356 Ga0495628_0000356_29655_29963 102
151 3300046518 Ga0495631_0179242 Ga0495631_0179242_366_674 102
152 3300046518 Ga0495631_0274132 Ga0495631_0274132_74_382 102
153 3300046524 Ga0495648_0013101 Ga0495648_0013101_2776_3084 102
154 3300046526 Ga0495666_0000029 Ga0495666_0000029_26437_26745 102
155 3300046529 Ga0495652_0153048 Ga0495652_0153048_1093_1401 102
156 3300046533 Ga0495640_0078764 Ga0495640_0078764_1564_1872 102
157 3300046535 Ga0495586_0000054 Ga0495586_0000054_26757_27065 102
158 3300046536 Ga0495587_0060391 Ga0495587_0060391_1546_1854 102
159 3300046538 Ga0495609_0110137 Ga0495609_0110137_444_752 102
160 3300046538 Ga0495609_0339078 Ga0495609_0339078_283_591 102
161 3300046542 Ga0495597_0125932 Ga0495597_0125932_49_357 102
162 3300046557 Ga0495622_0000315 Ga0495622_0000315_28519_28827 102
163 3300046557 Ga0495622_0001109 Ga0495622_0001109_5939_6247 102
164 3300046557 Ga0495622_0013683 Ga0495622_0013683_1787_2095 102
165 3300046558 Ga0495633_0021592 Ga0495633_0021592_895_1203 102
166 3300046558 Ga0495633_0141933 Ga0495633_0141933_609_917 102
167 3300046559 Ga0495667_0128343 Ga0495667_0128343_1159_1467 102
168 3300046559 Ga0495667_0279174 Ga0495667_0279174_523_831 102
169 3300046615 Ga0495656_0000364 Ga0495656_0000364_10400_10708 102
170 3300046615 Ga0495656_0033779 Ga0495656_0033779_604_912 102
171 3300046616 Ga0495668_0001683 Ga0495668_0001683_11214_11522 102
172 3300046616 Ga0495668_0002139 Ga0495668_0002139_11118_11426 102
173 3300046616 Ga0495668_0050190 Ga0495668_0050190_1100_1408 102
174 3300046642 Ga0495634_0000386 Ga0495634_0000386_32230_32538 102
175 3300046642 Ga0495634_0007341 Ga0495634_0007341_6638_6946 102
176 3300046648 Ga0495611_0000117 Ga0495611_0000117_39597_39905 102
177 3300046648 Ga0495611_0001399 Ga0495611_0001399_6465_6773 102
178 3300046660 Ga0495625_0023076 Ga0495625_0023076_730_1038 102
179 3300046660 Ga0495625_0057402 Ga0495625_0057402_2080_2388 102
180 3300046660 Ga0495625_0292098 Ga0495625_0292098_544_852 102
181 3300046663 Ga0495635_0011017 Ga0495635_0011017_4431_4739 102
182 3300046665 Ga0495661_0098847 Ga0495661_0098847_526_834 102
183 3300046674 Ga0495588_0647067 Ga0495588_0647067_165_473 102
184 3300046675 Ga0495657_0000801 Ga0495657_0000801_11221_11529 102
185 3300046675 Ga0495657_0022616 Ga0495657_0022616_893_1201 102
186 3300046675 Ga0495657_0145685 Ga0495657_0145685_1012_1320 102
187 3300046675 Ga0495657_0203577 Ga0495657_0203577_495_803 102
188 3300046675 Ga0495657_0206871 Ga0495657_0206871_276_584 102
189 3300046680 Ga0495646_0048287 Ga0495646_0048287_582_890 102
190 3300046681 Ga0495647_0000011 Ga0495647_0000011_45607_45915 102
191 3300046683 Ga0495658_0000296 Ga0495658_0000296_22827_23135 102
192 3300046683 Ga0495658_0001616 Ga0495658_0001616_10957_11265 102
193 3300046683 Ga0495658_0004878 Ga0495658_0004878_6114_6422 102
194 3300046689 Ga0495613_0000140 Ga0495613_0000140_10354_10662 102
195 3300046689 Ga0495613_0002471 Ga0495613_0002471_10778_11086 102
196 3300046689 Ga0495613_0014671 Ga0495613_0014671_4737_5045 102
197 3300046689 Ga0495613_0863095 Ga0495613_0863095_257_565 102
198 3300046690 Ga0495624_0005619 Ga0495624_0005619_6906_7214 102
199 3300046691 Ga0495670_0549983 Ga0495670_0549983_189_497 102
200 3300046692 Ga0495671_0055106 Ga0495671_0055106_861_1169 102
201 3300046794 Ga0495589_0001552 Ga0495589_0001552_2533_2841 102
202 3300046794 Ga0495589_0068917 Ga0495589_0068917_581_889 102
203 3300046794 Ga0495589_0302222 Ga0495589_0302222_342_650 102
204 3300046809 Ga0495600_0000745 Ga0495600_0000745_7248_7556 102
205 3300046809 Ga0495600_0080419 Ga0495600_0080419_539_847 102
206 3300046810 Ga0495660_0067272 Ga0495660_0067272_924_1232 102
207 3300046810 Ga0495660_0098406 Ga0495660_0098406_1089_1397 102
208 3300047315 Ga0495581_0000071 Ga0495581_0000071_2678_2986 102
209 3300047315 Ga0495581_0000080 Ga0495581_0000080_7015_7323 102
210 3300047315 Ga0495581_0000165 Ga0495581_0000165_10352_10660 102
211 3300047315 Ga0495581_0044425 Ga0495581_0044425_330_638 102
212 3300047315 Ga0495581_0100945 Ga0495581_0100945_1271_1579 102
213 3300047315 Ga0495581_0448295 Ga0495581_0448295_405_713 102
214 3300047317 Ga0495604_0136131 Ga0495604_0136131_1311_1619 102
215 3300047317 Ga0495604_0927091 Ga0495604_0927091_211_519 102
216 3300047318 Ga0495636_0047084 Ga0495636_0047084_1144_1452 102
217 3300047322 Ga0495680_0002120 Ga0495680_0002120_19452_19760 102
218 3300047322 Ga0495680_0636247 Ga0495680_0636247_12_320 102
219 3300047323 Ga0495683_0001685 Ga0495683_0001685_2552_2860 102
220 3300047323 Ga0495683_0131071 Ga0495683_0131071_623_931 102
221 3300047323 Ga0495683_0452567 Ga0495683_0452567_201_509 102
222 3300047443 Ga0495687_002206 Ga0495687_002206_13632_13940 102
223 3300047443 Ga0495687_098671 Ga0495687_098671_710_1018 102
224 3300047443 Ga0495687_144269 Ga0495687_144269_212_520 102
225 3300047443 Ga0495687_180506 Ga0495687_180506_192_500 102
226 3300047444 Ga0495675_0009892 Ga0495675_0009892_563_871 102
227 3300047444 Ga0495675_0240011 Ga0495675_0240011_442_750 102
228 3300047444 Ga0495675_0657238 Ga0495675_0657238_252_560 102
229 3300047445 Ga0495677_0139039 Ga0495677_0139039_368_676 102
230 3300047447 Ga0495685_000061 Ga0495685_000061_11214_11522 102
231 3300047447 Ga0495685_002380 Ga0495685_002380_4957_5265 102
232 3300047470 Ga0495681_0007012 Ga0495681_0007012_4788_5096 102
233 3300047470 Ga0495681_0029162 Ga0495681_0029162_2090_2398 102
234 3300047472 Ga0495686_0088316 Ga0495686_0088316_1248_1556 102
235 3300047472 Ga0495686_0220007 Ga0495686_0220007_207_515 102
236 3300047673 Ga0495593_0000035 Ga0495593_0000035_27241_27549 102
237 3300047673 Ga0495593_0393982 Ga0495593_0393982_286_594 102
238 3300048088 Ga0495602_0004376 Ga0495602_0004376_4951_5259 102
239 3300048089 Ga0495614_0000048 Ga0495614_0000048_6806_7114 102
240 3300048089 Ga0495614_0000138 Ga0495614_0000138_4858_5166 102
241 3300048089 Ga0495614_0003018 Ga0495614_0003018_5795_6103 102
242 3300048089 Ga0495614_0060639 Ga0495614_0060639_691_999 102
243 3300048089 Ga0495614_0324977 Ga0495614_0324977_353_661 102
244 3300048903 Ga0496100_0011746 Ga0496100_0011746_4561_4869 102
245 3300048910 Ga0496107_0221077 Ga0496107_0221077_798_1106 102
246 3300048911 Ga0496108_0000680 Ga0496108_0000680_25894_26202 102
247 3300048912 Ga0496109_0039816 Ga0496109_0039816_1890_2198 102
248 3300048913 Ga0496110_0083229 Ga0496110_0083229_153_461 102
249 3300048916 Ga0496113_1334679 Ga0496113_1334679_175_483 102
250 3300049573 Ga0501037_0014131 Ga0501037_0014131_2244_2552 102
251 3300049574 Ga0501038_0000330 Ga0501038_0000330_13277_13585 102
252 3300049574 Ga0501038_0271279 Ga0501038_0271279_397_705 102
253 3300049589 Ga0501073_0000077 Ga0501073_0000077_3703_4011 102
254 3300049742 Ga0501080_0017801 Ga0501080_0017801_5313_5621 102
255 3300049823 Ga0501044_0010109 Ga0501044_0010109_6932_7240 102
256 3300053094 Ga0500566_0000853 Ga0500566_0000853_11955_12263 102
257 3300053131 Ga0500652_000548 Ga0500652_000548_6764_7072 102
258 iso_pu_bacteria 2954759201 2954765280 102
259 3300047447 Ga0495685_101277 Ga0495685_101277_522_833 103
260 3300053134 Ga0500658_0000883 Ga0500658_0000883_8224_8535 103
261 iso_pu_bacteria 3006486233 3006486950 103
262 3300009011 Ga0105251_10295211 Ga0105251_102952112 104
263 3300009011 Ga0105251_10539923 Ga0105251_105399232 104
264 3300009092 Ga0105250_10099216 Ga0105250_100992162 104
265 3300009092 Ga0105250_10288724 Ga0105250_102887241 104
266 3300013102 Ga0157371_10004547 Ga0157371_100045474 104
267 3300013102 Ga0157371_10021526 Ga0157371_100215265 104
268 3300025735 Ga0207713_1014729 Ga0207713_10147291 104
269 3300030733 Ga0314311_1210753 Ga0314311_12107532 104
270 3300030735 Ga0316178_1079800 Ga0316178_10798002 104
271 3300030736 Ga0316180_1085976 Ga0316180_10859761 104
272 3300030744 Ga0316181_1005804 Ga0316181_10058042 104
273 3300041410 Ga0439461_0000769 Ga0439461_0000769_3183_3497 104
274 3300041997 Ga0439431_0009267 Ga0439431_0009267_1203_1517 104
275 3300046499 Ga0495594_0012718 Ga0495594_0012718_2154_2468 104
276 3300046557 Ga0495622_0003048 Ga0495622_0003048_4543_4857 104
277 3300048908 Ga0496105_0141550 Ga0496105_0141550_416_730 104
278 3300048909 Ga0496106_0863917 Ga0496106_0863917_120_434 104
279 3300048910 Ga0496107_0019260 Ga0496107_0019260_878_1192 104
280 3300048911 Ga0496108_1068632 Ga0496108_1068632_80_394 104
281 3300048912 Ga0496109_0402861 Ga0496109_0402861_182_496 104
282 3300048912 Ga0496109_1330778 Ga0496109_1330778_306_620 104
283 3300048913 Ga0496110_0220087 Ga0496110_0220087_135_449 104
284 3300048914 Ga0496111_0706795 Ga0496111_0706795_123_437 104
285 3300048916 Ga0496113_1450982 Ga0496113_1450982_28_342 104
286 3300048918 Ga0496115_0341040 Ga0496115_0341040_158_472 104
287 3300003316 rootH1_10053835 rootH1_100538352 105
288 3300003316 rootH1_10054041 rootH1_100540411 105
289 3300003320 rootH2_10008088 rootH2_100080886 105
290 3300003322 rootL2_10000823 rootL2_1000082352 105
291 3300003323 rootH1_10004880 rootH1_1000488030 105
292 3300027666 Ga0209282_1011794 Ga0209282_10117944 105
293 3300044693 Ga0466961_0090880 Ga0466961_0090880_254_571 105
294 3300049568 Ga0501031_0642731 Ga0501031_0642731_118_435 105
295 3300005577 Ga0068857_101115596 Ga0068857_1011155962 106
296 3300009092 Ga0105250_10000140 Ga0105250_1000014041 106
297 3300025711 Ga0207696_1000271 Ga0207696_100027145 106
298 3300026116 Ga0207674_10661226 Ga0207674_106612262 106
299 3300027666 Ga0209282_1150101 Ga0209282_11501012 106
300 3300041408 Ga0439453_0023004 Ga0439453_0023004_299_619 106
301 3300042157 Ga0439458_0004076 Ga0439458_0004076_768_1088 106
302 3300042533 Ga0450901_002007 Ga0450901_002007_970_1290 106
303 3300046499 Ga0495594_0000027 Ga0495594_0000027_26950_27270 106
304 3300046499 Ga0495594_0245431 Ga0495594_0245431_121_441 106
305 3300046512 Ga0495610_0061849 Ga0495610_0061849_993_1313 106
306 3300053106 Ga0500558_204740 Ga0500558_204740_89_409 106
307 3300053140 Ga0500573_0000064 Ga0500573_0000064_1754_2074 106
308 3300053150 Ga0500603_002892 Ga0500603_002892_1210_1530 106
309 3300003316 rootH1_10036342 rootH1_1003634211 107
310 3300003320 rootH2_10028156 rootH2_100281568 107
311 3300003323 rootH1_10000973 rootH1_1000097313 107
312 3300005563 Ga0068855_101744300 Ga0068855_1017443002 107
313 3300009011 Ga0105251_10050060 Ga0105251_100500602 107
314 3300009011 Ga0105251_10282303 Ga0105251_102823032 107
315 3300025735 Ga0207713_1104488 Ga0207713_11044882 107
316 3300025949 Ga0207667_11033347 Ga0207667_110333472 107
317 3300031731 Ga0307405_10009655 Ga0307405_100096554 107
318 3300031901 Ga0307406_10016748 Ga0307406_100167482 107
319 3300031911 Ga0307412_10004330 Ga0307412_100043309 107
320 3300032002 Ga0307416_100003821 Ga0307416_1000038219 107
321 3300032005 Ga0307411_10569385 Ga0307411_105693852 107
322 3300037312 Ga0395899_0580157 Ga0395899_0580157_157_480 107
323 3300037418 Ga0395900_0051443 Ga0395900_0051443_2285_2608 107
324 3300037466 Ga0395898_0153042 Ga0395898_0153042_1177_1500 107
325 3300037466 Ga0395898_0230731 Ga0395898_0230731_112_435 107
326 3300037471 Ga0395905_0886853 Ga0395905_0886853_42_365 107
327 3300038443 Ga0395901_1791904 Ga0395901_1791904_51_374 107
328 3300041405 Ga0439438_024377 Ga0439438_024377_635_964 107
329 3300041406 Ga0439439_0000016 Ga0439439_0000016_14435_14758 107
330 3300041406 Ga0439439_0004861 Ga0439439_0004861_2087_2416 107
331 3300041407 Ga0439447_006344 Ga0439447_006344_426_755 107
332 3300041407 Ga0439447_020149 Ga0439447_020149_118_441 107
333 3300041408 Ga0439453_0187221 Ga0439453_0187221_132_455 107
334 3300041512 Ga0451853_3553688 Ga0451853_3553688_174_497 107
335 3300041999 Ga0439433_0000038 Ga0439433_0000038_10844_11167 107
336 3300041999 Ga0439433_0087400 Ga0439433_0087400_355_684 107
337 3300042002 Ga0439442_022837 Ga0439442_022837_632_955 107
338 3300042007 Ga0439449_0002085 Ga0439449_0002085_7390_7713 107
339 3300042010 Ga0439452_038085 Ga0439452_038085_578_901 107
340 3300042011 Ga0439454_025239 Ga0439454_025239_468_791 107
341 3300042014 Ga0439457_000430 Ga0439457_000430_8881_9204 107
342 3300042014 Ga0439457_003779 Ga0439457_003779_2334_2663 107
343 3300042015 Ga0439462_0000066 Ga0439462_0000066_4779_5102 107
344 3300042115 Ga0450911_000257 Ga0450911_000257_3597_3920 107
345 3300042115 Ga0450911_000750 Ga0450911_000750_4874_5203 107
346 3300042122 Ga0450920_000283 Ga0450920_000283_4339_4668 107
347 3300042125 Ga0450923_067956 Ga0450923_067956_222_551 107
348 3300042128 Ga0450897_000005 Ga0450897_000005_10583_10906 107
349 3300042128 Ga0450897_000028 Ga0450897_000028_2334_2663 107
350 3300042131 Ga0450894_000009 Ga0450894_000009_16049_16372 107
351 3300042131 Ga0450894_001628 Ga0450894_001628_508_837 107
352 3300042131 Ga0450894_002366 Ga0450894_002366_2082_2405 107
353 3300042132 Ga0450895_000014 Ga0450895_000014_5945_6274 107
354 3300042132 Ga0450895_000056 Ga0450895_000056_3653_3976 107
355 3300042133 Ga0450896_000185 Ga0450896_000185_3671_4000 107
356 3300042134 Ga0450898_000002 Ga0450898_000002_8746_9069 107
357 3300042134 Ga0450898_000893 Ga0450898_000893_447_770 107
358 3300042134 Ga0450898_001033 Ga0450898_001033_2188_2517 107
359 3300042135 Ga0450899_000002 Ga0450899_000002_12010_12333 107
360 3300042135 Ga0450899_000756 Ga0450899_000756_1491_1820 107
361 3300042138 Ga0450903_006635 Ga0450903_006635_110_442 107
362 3300042145 Ga0450906_002777 Ga0450906_002777_1491_1820 107
363 3300042145 Ga0450906_010693 Ga0450906_010693_282_605 107
364 3300042146 Ga0450907_002370 Ga0450907_002370_636_965 107
365 3300042147 Ga0450910_000345 Ga0450910_000345_3565_3894 107
366 3300042147 Ga0450910_000776 Ga0450910_000776_1956_2279 107
367 3300042184 Ga0450908_003109 Ga0450908_003109_1854_2177 107
368 3300042184 Ga0450908_004060 Ga0450908_004060_508_837 107
369 3300042185 Ga0450909_000264 Ga0450909_000264_4983_5312 107
370 3300042531 Ga0450918_010269 Ga0450918_010269_420_749 107
371 3300042532 Ga0450893_0065729 Ga0450893_0065729_245_574 107
372 3300042533 Ga0450901_000004 Ga0450901_000004_25042_25374 107
373 3300046512 Ga0495610_0127751 Ga0495610_0127751_548_874 107
374 3300046536 Ga0495587_0800458 Ga0495587_0800458_155_481 107
375 3300046679 Ga0495623_0593582 Ga0495623_0593582_116_442 107
376 3300046692 Ga0495671_0605504 Ga0495671_0605504_50_376 107
377 3300046809 Ga0495600_0759028 Ga0495600_0759028_201_527 107
378 3300047317 Ga0495604_0080694 Ga0495604_0080694_1408_1734 107
379 3300047318 Ga0495636_0020947 Ga0495636_0020947_842_1165 107
380 3300047318 Ga0495636_0034727 Ga0495636_0034727_1347_1670 107
381 3300047323 Ga0495683_0010013 Ga0495683_0010013_72_398 107
382 3300047443 Ga0495687_003115 Ga0495687_003115_1997_2323 107
383 3300047445 Ga0495677_0051442 Ga0495677_0051442_386_709 107
384 3300047445 Ga0495677_0332474 Ga0495677_0332474_264_587 107
385 3300047470 Ga0495681_0056693 Ga0495681_0056693_277_603 107
386 3300048091 Ga0495626_0298337 Ga0495626_0298337_23_349 107
387 3300048907 Ga0496104_1485965 Ga0496104_1485965_220_546 107
388 3300003316 rootH1_10004517 rootH1_1000451714 108
389 3300005467 Ga0070706_100225353 Ga0070706_1002253532 108
390 3300005468 Ga0070707_100215708 Ga0070707_1002157082 108
391 3300005614 Ga0068856_100107182 Ga0068856_1001071825 108
392 3300005937 Ga0081455_10447338 Ga0081455_104473382 108
393 3300025910 Ga0207684_10301812 Ga0207684_103018123 108
394 3300025922 Ga0207646_10181661 Ga0207646_101816614 108
395 3300026078 Ga0207702_10041602 Ga0207702_100416023 108
396 3300037312 Ga0395899_0556285 Ga0395899_0556285_294_623 108
397 3300037418 Ga0395900_0165916 Ga0395900_0165916_906_1235 108
398 3300037418 Ga0395900_0166704 Ga0395900_0166704_909_1238 108
399 3300037466 Ga0395898_0051947 Ga0395898_0051947_1644_1973 108
400 3300037471 Ga0395905_0089888 Ga0395905_0089888_1644_1973 108
401 3300038443 Ga0395901_0949760 Ga0395901_0949760_396_725 108
402 3300041512 Ga0451853_1429319 Ga0451853_1429319_323_649 108
403 3300042007 Ga0439449_0021154 Ga0439449_0021154_742_1068 108
404 3300042010 Ga0439452_036914 Ga0439452_036914_684_1010 108
405 3300045976 Ga0466967_1167601 Ga0466967_1167601_392_718 108
406 3300046454 Ga0495592_0227898 Ga0495592_0227898_543_869 108
407 3300046455 Ga0495603_0000125 Ga0495603_0000125_28806_29135 108
408 3300046455 Ga0495603_0003152 Ga0495603_0003152_7018_7347 108
409 3300046455 Ga0495603_0036542 Ga0495603_0036542_59_388 108
410 3300046455 Ga0495603_0060157 Ga0495603_0060157_1355_1684 108
411 3300046455 Ga0495603_0638142 Ga0495603_0638142_218_547 108
412 3300046455 Ga0495603_0870340 Ga0495603_0870340_37_366 108
413 3300046459 Ga0495629_0025854 Ga0495629_0025854_1592_1921 108
414 3300046459 Ga0495629_0104689 Ga0495629_0104689_340_669 108
415 3300046459 Ga0495629_0378505 Ga0495629_0378505_57_386 108
416 3300046462 Ga0495651_0687124 Ga0495651_0687124_234_560 108
417 3300046473 Ga0495582_0775601 Ga0495582_0775601_98_427 108
418 3300046474 Ga0495605_0003017 Ga0495605_0003017_3065_3394 108
419 3300046476 Ga0495662_0064180 Ga0495662_0064180_82_411 108
420 3300046492 Ga0495585_0035521 Ga0495585_0035521_672_1001 108
421 3300046492 Ga0495585_0366309 Ga0495585_0366309_244_573 108
422 3300046499 Ga0495594_0000040 Ga0495594_0000040_28159_28488 108
423 3300046499 Ga0495594_0000059 Ga0495594_0000059_21594_21923 108
424 3300046499 Ga0495594_0033651 Ga0495594_0033651_651_980 108
425 3300046499 Ga0495594_0168236 Ga0495594_0168236_524_853 108
426 3300046499 Ga0495594_0238010 Ga0495594_0238010_71_400 108
427 3300046506 Ga0495583_0003943 Ga0495583_0003943_2739_3068 108
428 3300046506 Ga0495583_0023814 Ga0495583_0023814_2693_3022 108
429 3300046506 Ga0495583_0049342 Ga0495583_0049342_85_414 108
430 3300046507 Ga0495606_0022487 Ga0495606_0022487_3394_3723 108
431 3300046512 Ga0495610_0077897 Ga0495610_0077897_659_988 108
432 3300046513 Ga0495616_0038747 Ga0495616_0038747_321_650 108
433 3300046522 Ga0495643_0520807 Ga0495643_0520807_137_466 108
434 3300046524 Ga0495648_0296870 Ga0495648_0296870_272_601 108
435 3300046526 Ga0495666_0195792 Ga0495666_0195792_548_877 108
436 3300046542 Ga0495597_0075548 Ga0495597_0075548_91_420 108
437 3300046542 Ga0495597_0146951 Ga0495597_0146951_566_895 108
438 3300046557 Ga0495622_0005332 Ga0495622_0005332_87_416 108
439 3300046557 Ga0495622_0006009 Ga0495622_0006009_5103_5432 108
440 3300046557 Ga0495622_0022551 Ga0495622_0022551_113_442 108
441 3300046557 Ga0495622_0041168 Ga0495622_0041168_1571_1900 108
442 3300046616 Ga0495668_0001726 Ga0495668_0001726_135_464 108
443 3300046616 Ga0495668_0270134 Ga0495668_0270134_50_379 108
444 3300046642 Ga0495634_0132256 Ga0495634_0132256_1006_1335 108
445 3300046648 Ga0495611_0082497 Ga0495611_0082497_87_416 108
446 3300046648 Ga0495611_0092193 Ga0495611_0092193_955_1284 108
447 3300046660 Ga0495625_0035808 Ga0495625_0035808_438_767 108
448 3300046660 Ga0495625_0267093 Ga0495625_0267093_740_1069 108
449 3300046689 Ga0495613_0086856 Ga0495613_0086856_49_378 108
450 3300046689 Ga0495613_0205798 Ga0495613_0205798_11_340 108
451 3300046691 Ga0495670_0096678 Ga0495670_0096678_508_837 108
452 3300046794 Ga0495589_0325232 Ga0495589_0325232_121_450 108
453 3300046809 Ga0495600_0338652 Ga0495600_0338652_179_508 108
454 3300047315 Ga0495581_0254401 Ga0495581_0254401_529_858 108
455 3300047317 Ga0495604_0174668 Ga0495604_0174668_818_1147 108
456 3300047318 Ga0495636_0145885 Ga0495636_0145885_588_917 108
457 3300047318 Ga0495636_0604503 Ga0495636_0604503_78_407 108
458 3300047321 Ga0495676_0088009 Ga0495676_0088009_217_546 108
459 3300047443 Ga0495687_006993 Ga0495687_006993_4518_4847 108
460 3300047443 Ga0495687_035100 Ga0495687_035100_68_397 108
461 3300047443 Ga0495687_083625 Ga0495687_083625_213_542 108
462 3300047444 Ga0495675_0631279 Ga0495675_0631279_111_440 108
463 3300047445 Ga0495677_0042070 Ga0495677_0042070_1122_1451 108
464 3300047447 Ga0495685_001611 Ga0495685_001611_5183_5512 108
465 3300047447 Ga0495685_006819 Ga0495685_006819_733_1062 108
466 3300047447 Ga0495685_041271 Ga0495685_041271_1163_1492 108
467 3300047447 Ga0495685_103440 Ga0495685_103440_540_869 108
468 3300047470 Ga0495681_0033334 Ga0495681_0033334_1463_1792 108
469 3300047470 Ga0495681_0077414 Ga0495681_0077414_1017_1346 108
470 3300047472 Ga0495686_0000343 Ga0495686_0000343_49987_50316 108
471 3300048089 Ga0495614_0033642 Ga0495614_0033642_91_420 108
472 3300048089 Ga0495614_0311797 Ga0495614_0311797_306_635 108

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abv-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.6248 4 82
6w7t-assembly1.cif.gz_H structure of pap3 small terminase 0.597 8 62
4jo7-assembly1.cif.gz_A crystal structure of the human nup49ccs2+3* nup57ccs3* complex with 2:2 stoichiometry 0.5885 34 106
8gs8-assembly1.cif.gz_D cryo-em structure of the human respiratory complex ii 0.5693 6 83
4yxd-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with flutolanil 0.5222 2 94
ID Description Score Start End Superfamily
af_Q86HH3_394_633_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6391 4 83 1.20.1070.10
3aefD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6314 4 82 1.20.1300.10
3abvD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6248 4 82 1.20.1300.10
af_H2L011_279_413_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5887 1 75 1.25.10.10
3aebD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5726 4 96 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A6G2VK66-F1-model_v4 Holin 0.6185 1 97 GO:0016020
AF-A0A1Q3TT42-F1-model_v4 Holin 0.5989 7 106 GO:0016020
AF-A0A6G2VK66-F1-model_v4 Holin 0.5692 1 97 GO:0016020
AF-A0A1Q3TST3-F1-model_v4 Holin 0.5607 8 97 GO:0016020
AF-A0A7Y0B6Z7-F1-model_v4 Holin 0.5547 1 97 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.59 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map