F450552

General Info

Members Datasets Scaffolds Average Seq Length
471 224 461 504

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100012931|Ga0070699_1000129315
Length 563
Sequence VTSRNSHQKSGANQDNRNTQFVPDYDYELAVSYNVVQHIGRFFLVANPAGEGHMATAASVNWQEKHEQIGRAAGSCVLVLFGASGDLTRRKLVPSLFNLAKAKLLPKNFAVVGVSFDDLSLEKFRDQVTGFLQAEDRGTEAWEWFTQRLYYQRGDFADPATYSTLTAGLTEVDRQHSTEANYLFYLATAPKYFAPIVQQLGKAGLSNQDNGQWRRVVIEKPFGHDLESARALNRDVKAVLAENQIYRIDHYLGKETVQNIMVFRFDNAIFEPIWNRRYIDHVQITNAETVGVEQRGGYFDNAGTLRDMVPNHIMQLLSLTAMEPPVSFQADAVRNEQAKILRAVQPLDSEDVLHSSVRGQYGEGVIGGERVAAYRSEPGVAPESKTETFLALKLNIDNWRWAGVPFYVRTGKRLARRHTEITIQFKRTPFEIFRNAPVHNHTNQLVIQIQPVEAISLSFGAKVPGPVLRVGSVDMSFEYTKYFGADAYTGYEVLLYECMIGDATLFQRADMVEAGWSIVDPVLDVWQALPPRRFPNYPSGAWGPVESDELLARDGRQWRKIEP

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2643221651 Afipia sp. Root123D2 Isolate Unclassified
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
7 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
8 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
9 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.21
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 4.88
Rhizosphere 91.08
Stem 0
Stem Tuber 0
Unclassified 3.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003133 3300001976 Bacteria 2182
2 Ga0070658_10008172 3300005327 Bacteria 8411
3 Ga0070658_10062994 3300005327 Bacteria 3022
4 Ga0070676_10001792 3300005328 Bacteria 10938
5 Ga0070676_10007386 3300005328 Bacteria 5895
6 Ga0070683_100006666 3300005329 Bacteria 9698
7 Ga0070683_100020747 3300005329 Bacteria 5852
8 Ga0070670_100006813 3300005331 Bacteria 9675
9 Ga0070670_100019200 3300005331 Bacteria 5861
10 Ga0070666_10015834 3300005335 Bacteria 4816
11 Ga0070680_100010748 3300005336 Bacteria 7065
12 Ga0070680_100026631 3300005336 Bacteria 4624
13 Ga0070680_100130149 3300005336 Bacteria 2105
14 Ga0068868_100012055 3300005338 Bacteria 6312
15 Ga0068868_100149072 3300005338 Bacteria 1925
16 Ga0070689_100050517 3300005340 Bacteria 3213
17 Ga0070689_100055794 3300005340 Bacteria 3062
18 Ga0070687_100029801 3300005343 Bacteria 2661
19 Ga0070661_100002005 3300005344 Bacteria 14083
20 Ga0070668_100019291 3300005347 Bacteria 5132
21 Ga0070669_100097825 3300005353 Bacteria 2210
22 Ga0070675_100023044 3300005354 Bacteria 4975
23 Ga0070673_100013279 3300005364 Bacteria 5689
24 Ga0070688_100004903 3300005365 Bacteria 7002
25 Ga0070659_100007287 3300005366 Bacteria 8030
26 Ga0070659_100023178 3300005366 Bacteria 4747
27 Ga0070667_100003228 3300005367 Bacteria 13952
28 Ga0070667_100226009 3300005367 Bacteria 1667
29 Ga0070709_10002746 3300005434 Bacteria 9525
30 Ga0070709_10032354 3300005434 Bacteria 3153
31 Ga0070709_10103360 3300005434 Bacteria 1902
32 Ga0070714_100000781 3300005435 Bacteria 22569
33 Ga0070714_100026896 3300005435 Bacteria 4759
34 Ga0070714_100044629 3300005435 Bacteria 3753
35 Ga0070714_100191134 3300005435 Bacteria 1868
36 Ga0070713_100003699 3300005436 Bacteria 10124
37 Ga0070713_100004617 3300005436 Bacteria 9286
38 Ga0070713_100018501 3300005436 Bacteria 5294
39 Ga0070713_100042082 3300005436 Bacteria 3726
40 Ga0070713_100047267 3300005436 Bacteria 3536
41 Ga0070713_100100947 3300005436 Bacteria 2499
42 Ga0070710_10021671 3300005437 Bacteria 3353
43 Ga0070711_100000597 3300005439 Bacteria 18816
44 Ga0070711_100004279 3300005439 Bacteria 8399
45 Ga0070711_100112790 3300005439 Bacteria 1998
46 Ga0070694_100033574 3300005444 Bacteria 3378
47 Ga0070708_100000443 3300005445 Bacteria 30954
48 Ga0070708_100003046 3300005445 Bacteria 13014
49 Ga0070708_100008128 3300005445 Bacteria 8413
50 Ga0070708_100008510 3300005445 Bacteria 8243
51 Ga0070708_100010869 3300005445 Bacteria 7394
52 Ga0070708_100034542 3300005445 Bacteria 4400
53 Ga0070663_100004983 3300005455 Bacteria 7842
54 Ga0070678_100150857 3300005456 Bacteria 1872
55 Ga0070662_100002217 3300005457 Bacteria 11932
56 Ga0070662_100068313 3300005457 Bacteria 2612
57 Ga0070662_100122669 3300005457 Bacteria 1993
58 Ga0070681_10001215 3300005458 Bacteria 22413
59 Ga0070681_10027213 3300005458 Bacteria 5750
60 Ga0070681_10038176 3300005458 Bacteria 4816
61 Ga0070681_10093099 3300005458 Bacteria 2962
62 Ga0068867_100020670 3300005459 Bacteria 4691
63 Ga0068867_100075414 3300005459 Bacteria 2530
64 Ga0068867_100094773 3300005459 Bacteria 2270
65 Ga0068867_100117106 3300005459 Bacteria 2054
66 Ga0070685_10013968 3300005466 Bacteria 4248
67 Ga0070706_100000778 3300005467 Bacteria 35677
68 Ga0070706_100004970 3300005467 Bacteria 12731
69 Ga0070706_100037627 3300005467 Bacteria 4468
70 Ga0070706_100085566 3300005467 Bacteria 2921
71 Ga0070706_100127766 3300005467 Bacteria 2371
72 Ga0070706_100129984 3300005467 Bacteria 2350
73 Ga0070707_100000076 3300005468 Bacteria 86928
74 Ga0070707_100000668 3300005468 Bacteria 34057
75 Ga0070707_100018342 3300005468 Bacteria 6585
76 Ga0070707_100133957 3300005468 Bacteria 2410
77 Ga0070698_100000050 3300005471 Bacteria 83255
78 Ga0070698_100075464 3300005471 Bacteria 3375
79 Ga0070698_100141963 3300005471 Bacteria 2352
80 Ga0070699_100012931 3300005518 Bacteria 7196
81 Ga0070699_100013355 3300005518 Bacteria 7079
82 Ga0070699_100015540 3300005518 Bacteria 6542
83 Ga0070699_100054940 3300005518 Bacteria 3448
84 Ga0070679_100038232 3300005530 Bacteria 4771
85 Ga0070679_100045309 3300005530 Bacteria 4383
86 Ga0070684_100008222 3300005535 Bacteria 8152
87 Ga0070684_100016911 3300005535 Bacteria 5974
88 Ga0070684_100217884 3300005535 Bacteria 1741
89 Ga0070697_100000190 3300005536 Bacteria 50723
90 Ga0070697_100000488 3300005536 Bacteria 30188
91 Ga0070697_100001083 3300005536 Bacteria 20588
92 Ga0070697_100002086 3300005536 Bacteria 15297
93 Ga0070697_100005113 3300005536 Bacteria 10072
94 Ga0070697_100030510 3300005536 Bacteria 4331
95 Ga0068853_100006218 3300005539 Bacteria 9457
96 Ga0068853_100020631 3300005539 Bacteria 5479
97 Ga0070695_100032333 3300005545 Bacteria 3270
98 Ga0070693_100060866 3300005547 Bacteria 2193
99 Ga0070665_100014040 3300005548 Bacteria 8052
100 Ga0070704_100001930 3300005549 Bacteria 11459
101 Ga0068855_100004612 3300005563 Bacteria 16821
102 Ga0068855_100035941 3300005563 Bacteria 5899
103 Ga0068855_100055061 3300005563 Bacteria 4673
104 Ga0068855_100237659 3300005563 Bacteria 2037
105 Ga0070664_100004506 3300005564 Bacteria 11177
106 Ga0070664_100007626 3300005564 Bacteria 8738
107 Ga0070664_100087102 3300005564 Bacteria 2699
108 Ga0068857_100008164 3300005577 Bacteria 9041
109 Ga0068857_100020375 3300005577 Bacteria 5832
110 Ga0068854_100000855 3300005578 Bacteria 18216
111 Ga0068856_100000273 3300005614 Bacteria 56215
112 Ga0068856_100003303 3300005614 Bacteria 16391
113 Ga0068856_100003852 3300005614 Bacteria 15057
114 Ga0068856_100034032 3300005614 Bacteria 4991
115 Ga0068856_100044141 3300005614 Bacteria 4386
116 Ga0068856_100107955 3300005614 Bacteria 2779
117 Ga0068859_100001440 3300005617 Bacteria 24102
118 Ga0068859_100014905 3300005617 Bacteria 7804
119 Ga0068864_100005850 3300005618 Bacteria 10083
120 Ga0068864_100035495 3300005618 Bacteria 4245
121 Ga0068866_10036632 3300005718 Bacteria 2404
122 Ga0068861_100021800 3300005719 Bacteria 4607
123 Ga0068851_10004326 3300005834 Bacteria 6397
124 Ga0068870_10023132 3300005840 Bacteria 3062
125 Ga0068870_10023544 3300005840 Bacteria 3039
126 Ga0068863_100021011 3300005841 Bacteria 6235
127 Ga0068863_100054480 3300005841 Bacteria 3789
128 Ga0068863_100121739 3300005841 Bacteria 2488
129 Ga0068863_100186384 3300005841 Bacteria 1993
130 Ga0068858_100002929 3300005842 Bacteria 17176
131 Ga0068858_100028286 3300005842 Bacteria 5208
132 Ga0068858_100035303 3300005842 Bacteria 4638
133 Ga0068860_100028567 3300005843 Bacteria 5370
134 Ga0081538_10032628 3300005981 Bacteria 3484
135 Ga0070717_10000685 3300006028 Bacteria 21839
136 Ga0070717_10001418 3300006028 Bacteria 16527
137 Ga0070717_10001705 3300006028 Bacteria 15310
138 Ga0070717_10004143 3300006028 Bacteria 10453
139 Ga0070717_10004202 3300006028 Bacteria 10386
140 Ga0070717_10009012 3300006028 Bacteria 7487
141 Ga0070717_10024000 3300006028 Bacteria 4839
142 Ga0070717_10041308 3300006028 Bacteria 3760
143 Ga0070717_10045623 3300006028 Bacteria 3583
144 Ga0070717_10114287 3300006028 Bacteria 2306
145 Ga0070717_10116059 3300006028 Bacteria 2288
146 Ga0070717_10201670 3300006028 Bacteria 1743
147 Ga0070715_10001937 3300006163 Bacteria 6228
148 Ga0070715_10002389 3300006163 Bacteria 5749
149 Ga0070716_100011816 3300006173 Bacteria 4406
150 Ga0070712_100000422 3300006175 Bacteria 24266
151 Ga0070712_100001314 3300006175 Bacteria 15043
152 Ga0070712_100003292 3300006175 Bacteria 9939
153 Ga0070712_100029927 3300006175 Bacteria 3654
154 Ga0070712_100030032 3300006175 Bacteria 3649
155 Ga0097621_100006893 3300006237 Bacteria 8084
156 Ga0068871_100012488 3300006358 Bacteria 6266
157 Ga0075433_10001451 3300006852 Bacteria 17504
158 Ga0075433_10017759 3300006852 Bacteria 5902
159 Ga0075433_10040678 3300006852 Bacteria 4024
160 Ga0075434_100000216 3300006871 Bacteria 39542
161 Ga0075434_100001578 3300006871 Bacteria 19305
162 Ga0075434_100007444 3300006871 Bacteria 10125
163 Ga0075434_100010531 3300006871 Bacteria 8674
164 Ga0068865_100025592 3300006881 Bacteria 3884
165 Ga0068865_100049625 3300006881 Bacteria 2894
166 Ga0075436_100000879 3300006914 Bacteria 19927
167 Ga0075436_100007045 3300006914 Bacteria 7697
168 Ga0075436_100046908 3300006914 Bacteria 2980
169 Ga0075436_100101381 3300006914 Bacteria 2005
170 Ga0097620_100001440 3300006931 Bacteria 24102
171 Ga0097620_100014905 3300006931 Bacteria 7804
172 Ga0075435_100000186 3300007076 Bacteria 37017
173 Ga0075435_100003448 3300007076 Bacteria 10730
174 Ga0099794_10017134 3300007265 Bacteria 3225
175 Ga0099794_10062985 3300007265 Bacteria 1805
176 Ga0105240_10005869 3300009093 Bacteria 18195
177 Ga0105240_10008346 3300009093 Bacteria 14824
178 Ga0105240_10012547 3300009093 Bacteria 11691
179 Ga0105240_10018502 3300009093 Bacteria 9352
180 Ga0105240_10051256 3300009093 Bacteria 5196
181 Ga0105240_10084494 3300009093 Bacteria 3892
182 Ga0105240_10089880 3300009093 Bacteria 3755
183 Ga0105245_10055944 3300009098 Unclassified 3545
184 Ga0105247_10015250 3300009101 Bacteria 4606
185 Ga0105247_10023736 3300009101 Bacteria 3696
186 Ga0105241_10004842 3300009174 Bacteria 9927
187 Ga0105241_10008999 3300009174 Bacteria 7343
188 Ga0105241_10024456 3300009174 Bacteria 4485
189 Ga0105241_10141139 3300009174 Bacteria 1962
190 Ga0105242_10022632 3300009176 Bacteria 4946
191 Ga0105242_10069418 3300009176 Bacteria 2919
192 Ga0105237_10038811 3300009545 Bacteria 4809
193 Ga0105237_10240824 3300009545 Bacteria 1810
194 Ga0105238_10014816 3300009551 Bacteria 7887
195 Ga0105238_10061858 3300009551 Bacteria 3746
196 Ga0105238_10095344 3300009551 Bacteria 2963
197 Ga0105238_10211855 3300009551 Bacteria 1914
198 Ga0105249_10009226 3300009553 Bacteria 8629
199 Ga0105249_10023234 3300009553 Bacteria 5562
200 Ga0105239_10016968 3300010375 Bacteria 8048
201 Ga0105246_10001911 3300011119 Bacteria 12552
202 Ga0105246_10010773 3300011119 Bacteria 5668
203 Ga0105246_10023645 3300011119 Bacteria 3979
204 Ga0157373_10014776 3300013100 Bacteria 5718
205 Ga0157371_10046612 3300013102 Bacteria 3083
206 Ga0157370_10050330 3300013104 Bacteria 3982
207 Ga0157370_10054475 3300013104 Bacteria 3813
208 Ga0157370_10090798 3300013104 Bacteria 2868
209 Ga0157370_10176247 3300013104 Bacteria 1987
210 Ga0157369_10007673 3300013105 Bacteria 12415
211 Ga0157369_10009064 3300013105 Bacteria 11392
212 Ga0157369_10010773 3300013105 Bacteria 10410
213 Ga0157369_10078067 3300013105 Bacteria 3548
214 Ga0157374_10000340 3300013296 Bacteria 43245
215 Ga0157374_10003771 3300013296 Bacteria 12744
216 Ga0157374_10083159 3300013296 Bacteria 3041
217 Ga0157378_10000371 3300013297 Bacteria 44375
218 Ga0163162_10004988 3300013306 Bacteria 12791
219 Ga0163162_10011526 3300013306 Bacteria 8623
220 Ga0157372_10001024 3300013307 Bacteria 30552
221 Ga0157372_10006105 3300013307 Bacteria 12801
222 Ga0157372_10026720 3300013307 Bacteria 6282
223 Ga0157372_10027308 3300013307 Bacteria 6215
224 Ga0157375_10210337 3300013308 Bacteria 2102
225 Ga0163163_10008060 3300014325 Bacteria 9333
226 Ga0163163_10095001 3300014325 Bacteria 3000
227 Ga0157380_10102511 3300014326 Bacteria 2386
228 Ga0182008_10007117 3300014497 Bacteria 6196
229 Ga0157377_10005464 3300014745 Bacteria 5975
230 Ga0157379_10000265 3300014968 Bacteria 41177
231 Ga0157379_10022282 3300014968 Bacteria 5611
232 Ga0157379_10079521 3300014968 Bacteria 2936
233 Ga0157376_10002452 3300014969 Bacteria 12546
234 Ga0157376_10021417 3300014969 Bacteria 5020
235 Ga0182006_1038209 3300015261 Bacteria 1899
236 Ga0182007_10000188 3300015262 Bacteria 41467
237 Ga0213875_10032192 3300021388 Bacteria 2478
238 Ga0207697_10011682 3300025315 Bacteria 3707
239 Ga0207656_10025909 3300025321 Bacteria 2385
240 Ga0207692_10022960 3300025898 Bacteria 2879
241 Ga0207710_10024868 3300025900 Bacteria 2582
242 Ga0207688_10011992 3300025901 Bacteria 4717
243 Ga0207680_10009286 3300025903 Bacteria 4872
244 Ga0207647_10019091 3300025904 Bacteria 4617
245 Ga0207685_10000337 3300025905 Bacteria 7589
246 Ga0207685_10001150 3300025905 Bacteria 5295
247 Ga0207699_10003355 3300025906 Bacteria 7631
248 Ga0207699_10024235 3300025906 Bacteria 3315
249 Ga0207699_10047279 3300025906 Bacteria 2522
250 Ga0207699_10126259 3300025906 Bacteria 1661
251 Ga0207645_10012752 3300025907 Bacteria 5698
252 Ga0207643_10000172 3300025908 Bacteria 44395
253 Ga0207643_10027398 3300025908 Bacteria 3159
254 Ga0207705_10012888 3300025909 Bacteria 6036
255 Ga0207684_10000641 3300025910 Bacteria 41415
256 Ga0207684_10042712 3300025910 Bacteria 3844
257 Ga0207684_10076056 3300025910 Bacteria 2853
258 Ga0207684_10138371 3300025910 Bacteria 2092
259 Ga0207654_10031881 3300025911 Bacteria 2907
260 Ga0207707_10007765 3300025912 Bacteria 9337
261 Ga0207707_10017531 3300025912 Bacteria 6245
262 Ga0207707_10022888 3300025912 Bacteria 5465
263 Ga0207695_10001508 3300025913 Bacteria 38700
264 Ga0207695_10002608 3300025913 Bacteria 26414
265 Ga0207695_10008157 3300025913 Bacteria 13169
266 Ga0207695_10014641 3300025913 Bacteria 9276
267 Ga0207695_10116208 3300025913 Bacteria 2649
268 Ga0207671_10081717 3300025914 Bacteria 2424
269 Ga0207693_10000509 3300025915 Bacteria 35091
270 Ga0207693_10000977 3300025915 Bacteria 25718
271 Ga0207693_10001135 3300025915 Bacteria 23860
272 Ga0207693_10001584 3300025915 Bacteria 20129
273 Ga0207693_10045176 3300025915 Bacteria 3461
274 Ga0207693_10059705 3300025915 Bacteria 2987
275 Ga0207663_10000833 3300025916 Bacteria 13963
276 Ga0207663_10002444 3300025916 Bacteria 8931
277 Ga0207663_10005476 3300025916 Bacteria 6399
278 Ga0207663_10096949 3300025916 Bacteria 1971
279 Ga0207663_10134231 3300025916 Bacteria 1715
280 Ga0207660_10017098 3300025917 Bacteria 4812
281 Ga0207662_10006523 3300025918 Bacteria 6304
282 Ga0207657_10000511 3300025919 Bacteria 41041
283 Ga0207657_10003279 3300025919 Bacteria 17320
284 Ga0207657_10037727 3300025919 Bacteria 4311
285 Ga0207649_10000739 3300025920 Bacteria 21460
286 Ga0207652_10026056 3300025921 Bacteria 4867
287 Ga0207652_10032071 3300025921 Bacteria 4413
288 Ga0207652_10140153 3300025921 Bacteria 2162
289 Ga0207646_10000463 3300025922 Bacteria 54224
290 Ga0207646_10002220 3300025922 Bacteria 23118
291 Ga0207646_10002755 3300025922 Bacteria 20542
292 Ga0207681_10055077 3300025923 Bacteria 2707
293 Ga0207694_10017005 3300025924 Bacteria 5495
294 Ga0207650_10000059 3300025925 Bacteria 151427
295 Ga0207650_10029046 3300025925 Bacteria 3970
296 Ga0207687_10005122 3300025927 Bacteria 8689
297 Ga0207687_10015636 3300025927 Bacteria 4978
298 Ga0207700_10003358 3300025928 Bacteria 9289
299 Ga0207700_10011905 3300025928 Bacteria 5576
300 Ga0207700_10034800 3300025928 Bacteria 3620
301 Ga0207700_10079047 3300025928 Bacteria 2560
302 Ga0207664_10001715 3300025929 Bacteria 14448
303 Ga0207664_10077757 3300025929 Bacteria 2689
304 Ga0207664_10091985 3300025929 Bacteria 2489
305 Ga0207664_10107133 3300025929 Bacteria 2318
306 Ga0207664_10119243 3300025929 Bacteria 2206
307 Ga0207690_10051949 3300025932 Bacteria 2743
308 Ga0207706_10000130 3300025933 Bacteria 81196
309 Ga0207706_10038906 3300025933 Bacteria 4218
310 Ga0207706_10057594 3300025933 Bacteria 3423
311 Ga0207686_10074272 3300025934 Bacteria 2196
312 Ga0207670_10060716 3300025936 Bacteria 2577
313 Ga0207665_10001042 3300025939 Bacteria 18657
314 Ga0207665_10029707 3300025939 Bacteria 3612
315 Ga0207691_10022883 3300025940 Bacteria 5890
316 Ga0207711_10000861 3300025941 Bacteria 29357
317 Ga0207711_10006896 3300025941 Bacteria 9538
318 Ga0207689_10025199 3300025942 Bacteria 4986
319 Ga0207679_10000427 3300025945 Bacteria 29877
320 Ga0207679_10027184 3300025945 Bacteria 3954
321 Ga0207667_10004047 3300025949 Bacteria 18009
322 Ga0207667_10044278 3300025949 Bacteria 4717
323 Ga0207667_10174404 3300025949 Bacteria 2209
324 Ga0207712_10049776 3300025961 Bacteria 2922
325 Ga0207668_10099991 3300025972 Bacteria 2152
326 Ga0207677_10003872 3300026023 Bacteria 7971
327 Ga0207677_10018179 3300026023 Bacteria 4214
328 Ga0207703_10004766 3300026035 Bacteria 11061
329 Ga0207639_10050008 3300026041 Bacteria 3173
330 Ga0207678_10000169 3300026067 Bacteria 54815
331 Ga0207678_10014461 3300026067 Bacteria 6938
332 Ga0207702_10000796 3300026078 Bacteria 33448
333 Ga0207702_10009076 3300026078 Bacteria 8369
334 Ga0207702_10020580 3300026078 Bacteria 5462
335 Ga0207702_10048191 3300026078 Bacteria 3593
336 Ga0207702_10070744 3300026078 Bacteria 3001
337 Ga0207641_10000025 3300026088 Bacteria 247727
338 Ga0207641_10038024 3300026088 Bacteria 4023
339 Ga0207641_10043945 3300026088 Bacteria 3755
340 Ga0207641_10053447 3300026088 Bacteria 3424
341 Ga0207641_10104923 3300026088 Bacteria 2496
342 Ga0207641_10158124 3300026088 Bacteria 2058
343 Ga0207648_10000151 3300026089 Bacteria 69912
344 Ga0207648_10033089 3300026089 Bacteria 4561
345 Ga0207648_10038173 3300026089 Bacteria 4227
346 Ga0207648_10150359 3300026089 Bacteria 2054
347 Ga0207676_10000252 3300026095 Bacteria 46432
348 Ga0207676_10097967 3300026095 Bacteria 2423
349 Ga0207674_10000162 3300026116 Bacteria 79631
350 Ga0207674_10001344 3300026116 Bacteria 31814
351 Ga0207674_10075529 3300026116 Bacteria 3379
352 Ga0207675_100030890 3300026118 Bacteria 4989
353 Ga0207683_10000225 3300026121 Bacteria 49694
354 Ga0207683_10090183 3300026121 Bacteria 2729
355 Ga0207698_10038661 3300026142 Bacteria 3527
356 Ga0265356_1000868 3300028017 Bacteria 4960
357 Ga0268266_10020527 3300028379 Bacteria 5631
358 Ga0268265_10050030 3300028380 Bacteria 3147
359 Ga0268264_10009309 3300028381 Bacteria 8132
360 Ga0268264_10025658 3300028381 Bacteria 4814
361 Ga0268264_10036556 3300028381 Bacteria 4047
362 Ga0307517_10011680 3300028786 Bacteria 12151
363 Ga0265338_10007423 3300028800 Bacteria 13605
364 Ga0265338_10028722 3300028800 Bacteria 5539
365 Ga0307512_10012127 3300030522 Bacteria 8147
366 Ga0265760_10005433 3300031090 Bacteria 3655
367 Ga0265330_10023690 3300031235 Bacteria 2787
368 Ga0265316_10039529 3300031344 Bacteria 3788
369 Ga0265342_10047895 3300031712 Bacteria 2564
370 Ga0307416_100061144 3300032002 Bacteria 3072
371 Ga0373928_0009824 3300035084 Bacteria 1873
372 Ga0373936_0009866 3300035113 Bacteria 3604
373 Ga0373936_0018627 3300035113 Bacteria 2683
374 Ga0373953_0010075 3300035117 Bacteria 3276
375 Ga0373946_0002788 3300035171 Bacteria 6182
376 Ga0373955_0012350 3300035172 Bacteria 4105
377 Ga0373955_0012549 3300035172 Bacteria 4073
378 Ga0373931_0039276 3300035691 Bacteria 2480
379 Ga0373931_0053937 3300035691 Bacteria 2147
380 Ga0373931_0059942 3300035691 Bacteria 2048
381 Ga0373927_0000094 3300035695 Bacteria 66764
382 Ga0373937_0048972 3300036401 Bacteria 3869
383 Ga0373925_0000583 3300037068 Bacteria 35281
384 Ga0373925_0032455 3300037068 Bacteria 3844
385 Ga0373925_0062557 3300037068 Bacteria 2799
386 Ga0395905_0005868 3300037471 Bacteria 12470
387 Ga0395905_0012358 3300037471 Bacteria 8220
388 Ga0395905_0012753 3300037471 Bacteria 8084
389 Ga0395905_0109966 3300037471 Bacteria 2588
390 Ga0436364_0188179 3300037853 Bacteria 1745
391 Ga0436364_0360454 3300037853 Bacteria 27225
392 Ga0436364_1001807 3300037853 Bacteria 5235
393 Ga0436364_1552374 3300037853 Bacteria 9444
394 Ga0436365_0601983 3300039437 Bacteria 5901
395 Ga0436365_1014216 3300039437 Bacteria 4454
396 Ga0436365_1511156 3300039437 Bacteria 6565
397 Ga0436363_0240569 3300039450 Bacteria 4087
398 Ga0436363_0387480 3300039450 Bacteria 3859
399 Ga0436363_0533151 3300039450 Bacteria 2144
400 Ga0436363_1383917 3300039450 Bacteria 4385
401 Ga0466972_0008588 3300044658 Bacteria 5125
402 Ga0466972_0013962 3300044658 Bacteria 4029
403 Ga0453683_0015176 3300044673 Bacteria 4998
404 Ga0466964_0034039 3300044706 Bacteria 2032
405 Ga0451576_0028302 3300045051 Bacteria 6006
406 Ga0466958_0011257 3300045836 Bacteria 5036
407 Ga0495603_0045849 3300046455 Bacteria 2606
408 Ga0495580_0000162 3300046472 Bacteria 49248
409 Ga0495580_0000188 3300046472 Bacteria 46789
410 Ga0495580_0004889 3300046472 Bacteria 11203
411 Ga0495580_0018230 3300046472 Bacteria 5229
412 Ga0495580_0031357 3300046472 Bacteria 3841
413 Ga0495580_0063314 3300046472 Bacteria 2594
414 Ga0495664_0003452 3300046477 Bacteria 8601
415 Ga0495635_0060759 3300046663 Bacteria 2597
416 Ga0495674_0026827 3300047319 Bacteria 5268
417 Ga0495602_0025391 3300048088 Bacteria 5736
418 Ga0496102_0004651 3300048905 Bacteria 11620
419 Ga0496102_0103756 3300048905 Bacteria 2644
420 Ga0496103_0010566 3300048906 Bacteria 5466
421 Ga0496104_0018834 3300048907 Bacteria 6306
422 Ga0496104_0019386 3300048907 Bacteria 6222
423 Ga0496104_0101447 3300048907 Bacteria 2755
424 Ga0496106_0181494 3300048909 Bacteria 1671
425 Ga0496107_0113006 3300048910 Bacteria 1997
426 Ga0496108_0000210 3300048911 Bacteria 53448
427 Ga0496109_0000228 3300048912 Bacteria 54849
428 Ga0496109_0089340 3300048912 Bacteria 2848
429 Ga0496109_0108185 3300048912 Bacteria 2584
430 Ga0496110_0000145 3300048913 Bacteria 41800
431 Ga0496110_0012562 3300048913 Bacteria 6967
432 Ga0496111_0009110 3300048914 Bacteria 6607
433 Ga0496112_0000048 3300048915 Bacteria 84789
434 Ga0496112_0004487 3300048915 Bacteria 11841
435 Ga0496112_0019079 3300048915 Bacteria 6464
436 Ga0496112_0046808 3300048915 Bacteria 4243
437 Ga0496112_0061491 3300048915 Bacteria 3702
438 Ga0496113_0001549 3300048916 Bacteria 12890
439 Ga0496113_0108991 3300048916 Bacteria 2153
440 Ga0496115_0004990 3300048918 Bacteria 9636
441 Ga0501046_0058030 3300049580 Bacteria 3035
442 Ga0501046_0161198 3300049580 Bacteria 1687
443 Ga0501070_0135180 3300049586 Bacteria 2036
444 Ga0501076_0122816 3300049592 Bacteria 2103
445 Ga0501079_0053966 3300049741 Bacteria 3101
446 Ga0501044_0000495 3300049823 Bacteria 47801
447 Ga0501044_0001219 3300049823 Bacteria 30541
448 Ga0501044_0095688 3300049823 Bacteria 2992
449 nmdc:mga05p37_91458_c1 3300050507 Bacteria 3749
450 nmdc:mga0n895_16022_c1 3300050512 Bacteria 6865
451 nmdc:mga0n895_235_c1 3300050512 Bacteria 35123
452 nmdc:mga0n895_5251_c1 3300050512 Bacteria 10790
453 nmdc:mga0rr50_382_c1 3300050513 Bacteria 24211
454 nmdc:mga0rr50_3967_c1 3300050513 Bacteria 8613
455 nmdc:mga08x19_89377_c1 3300050514 Bacteria 2031
456 nmdc:mga08x19_9755_c1 3300050514 Bacteria 5752
457 nmdc:mga0a205_212_c1 3300050515 Bacteria 40921
458 nmdc:mga0a205_27359_c1 3300050515 Bacteria 5447
459 nmdc:mga0a205_41997_c1 3300050515 Bacteria 4406
460 Ga0500643_001041 3300053087 Bacteria 16872
461 Ga0466962_0026927 3300061719 Bacteria 2760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10032354 Ga0070709_100323541 446
2 3300025906 Ga0207699_10126259 Ga0207699_101262591 446
3 3300026142 Ga0207698_10038661 Ga0207698_100386612 447
4 iso_pu_bacteria 2912715099 2912721863 463
5 iso_pu_bacteria 2912757875 2912759322 463
6 3300014497 Ga0182008_10007117 Ga0182008_100071174 467
7 3300015261 Ga0182006_1038209 Ga0182006_10382092 467
8 3300015262 Ga0182007_10000188 Ga0182007_1000018834 467
9 3300007265 Ga0099794_10062985 Ga0099794_100629851 471
10 3300048916 Ga0496113_0108991 Ga0496113_0108991_665_2125 471
11 3300021388 Ga0213875_10032192 Ga0213875_100321922 472
12 3300037853 Ga0436364_0360454 Ga0436364_0360454_17048_18634 472
13 3300005327 Ga0070658_10008172 Ga0070658_100081726 473
14 3300005436 Ga0070713_100100947 Ga0070713_1001009471 473
15 3300005530 Ga0070679_100045309 Ga0070679_1000453092 473
16 3300025909 Ga0207705_10012888 Ga0207705_100128884 473
17 3300025921 Ga0207652_10026056 Ga0207652_100260564 473
18 3300044658 Ga0466972_0008588 Ga0466972_0008588_1845_3272 473
19 3300061719 Ga0466962_0026927 Ga0466962_0026927_397_1824 473
20 3300009551 Ga0105238_10095344 Ga0105238_100953442 474
21 3300045836 Ga0466958_0011257 Ga0466958_0011257_3415_4887 474
22 3300005328 Ga0070676_10007386 Ga0070676_100073863 476
23 3300005329 Ga0070683_100020747 Ga0070683_1000207476 476
24 3300005331 Ga0070670_100019200 Ga0070670_1000192003 476
25 3300005336 Ga0070680_100026631 Ga0070680_1000266312 476
26 3300005338 Ga0068868_100149072 Ga0068868_1001490721 476
27 3300005343 Ga0070687_100029801 Ga0070687_1000298012 476
28 3300005364 Ga0070673_100013279 Ga0070673_1000132794 476
29 3300005365 Ga0070688_100004903 Ga0070688_1000049034 476
30 3300005459 Ga0068867_100020670 Ga0068867_1000206703 476
31 3300005530 Ga0070679_100038232 Ga0070679_1000382322 476
32 3300005535 Ga0070684_100016911 Ga0070684_1000169113 476
33 3300005539 Ga0068853_100020631 Ga0068853_1000206313 476
34 3300005841 Ga0068863_100021011 Ga0068863_1000210112 476
35 3300013104 Ga0157370_10054475 Ga0157370_100544752 476
36 3300025921 Ga0207652_10032071 Ga0207652_100320714 476
37 3300025928 Ga0207700_10034800 Ga0207700_100348002 476
38 3300025972 Ga0207668_10099991 Ga0207668_100999912 476
39 3300026023 Ga0207677_10018179 Ga0207677_100181792 476
40 3300026088 Ga0207641_10043945 Ga0207641_100439452 476
41 3300028380 Ga0268265_10050030 Ga0268265_100500301 476
42 3300025912 Ga0207707_10017531 Ga0207707_100175314 477
43 3300005445 Ga0070708_100034542 Ga0070708_1000345423 479
44 3300035113 Ga0373936_0009866 Ga0373936_0009866_811_2253 480
45 3300049580 Ga0501046_0161198 Ga0501046_0161198_184_1647 481
46 3300006028 Ga0070717_10004143 Ga0070717_100041436 485
47 3300006852 Ga0075433_10001451 Ga0075433_100014519 485
48 3300006871 Ga0075434_100000216 Ga0075434_10000021633 485
49 3300006914 Ga0075436_100000879 Ga0075436_1000008799 485
50 3300007076 Ga0075435_100000186 Ga0075435_10000018610 485
51 3300048915 Ga0496112_0061491 Ga0496112_0061491_1482_2939 485
52 3300050512 nmdc:mga0n895_235_c1 nmdc:mga0n895_235_c1_20514_21971 485
53 3300050513 nmdc:mga0rr50_382_c1 nmdc:mga0rr50_382_c1_14373_15830 485
54 3300050515 nmdc:mga0a205_212_c1 nmdc:mga0a205_212_c1_24506_25963 485
55 3300025906 Ga0207699_10024235 Ga0207699_100242353 486
56 3300025921 Ga0207652_10140153 Ga0207652_101401531 487
57 3300037853 Ga0436364_0188179 Ga0436364_0188179_198_1682 487
58 3300039437 Ga0436365_1511156 Ga0436365_1511156_4662_6146 487
59 3300039450 Ga0436363_0240569 Ga0436363_0240569_2102_3568 487
60 3300046472 Ga0495580_0000188 Ga0495580_0000188_14086_15549 487
61 3300005435 Ga0070714_100191134 Ga0070714_1001911342 488
62 3300009093 Ga0105240_10084494 Ga0105240_100844942 488
63 3300025913 Ga0207695_10001508 Ga0207695_1000150828 488
64 3300031712 Ga0265342_10047895 Ga0265342_100478952 488
65 3300049592 Ga0501076_0122816 Ga0501076_0122816_540_2006 488
66 3300049741 Ga0501079_0053966 Ga0501079_0053966_1191_2657 488
67 3300005614 Ga0068856_100000273 Ga0068856_10000027356 489
68 3300006914 Ga0075436_100007045 Ga0075436_1000070454 489
69 3300006914 Ga0075436_100046908 Ga0075436_1000469082 489
70 3300026078 Ga0207702_10000796 Ga0207702_1000079611 489
71 3300037471 Ga0395905_0012358 Ga0395905_0012358_5338_6807 489
72 3300005471 Ga0070698_100141963 Ga0070698_1001419632 490
73 3300005536 Ga0070697_100030510 Ga0070697_1000305102 490
74 3300007265 Ga0099794_10017134 Ga0099794_100171343 490
75 3300031235 Ga0265330_10023690 Ga0265330_100236902 490
76 3300044673 Ga0453683_0015176 Ga0453683_0015176_304_1791 490
77 3300044706 Ga0466964_0034039 Ga0466964_0034039_541_2013 490
78 3300049823 Ga0501044_0000495 Ga0501044_0000495_19133_20653 491
79 3300005536 Ga0070697_100005113 Ga0070697_1000051133 492
80 3300006163 Ga0070715_10001937 Ga0070715_100019376 492
81 3300006175 Ga0070712_100000422 Ga0070712_1000004229 492
82 3300025905 Ga0207685_10001150 Ga0207685_100011504 492
83 3300025915 Ga0207693_10000509 Ga0207693_1000050924 492
84 3300025916 Ga0207663_10000833 Ga0207663_100008333 492
85 3300050507 nmdc:mga05p37_91458_c1 nmdc:mga05p37_91458_c1_888_2423 492
86 3300005434 Ga0070709_10002746 Ga0070709_100027466 493
87 3300005436 Ga0070713_100003699 Ga0070713_1000036992 493
88 3300005437 Ga0070710_10021671 Ga0070710_100216712 493
89 3300006175 Ga0070712_100003292 Ga0070712_1000032923 493
90 3300006914 Ga0075436_100101381 Ga0075436_1001013812 493
91 3300025898 Ga0207692_10022960 Ga0207692_100229602 493
92 3300025906 Ga0207699_10003355 Ga0207699_100033558 493
93 3300025912 Ga0207707_10022888 Ga0207707_100228882 493
94 3300025915 Ga0207693_10001584 Ga0207693_1000158420 493
95 3300025928 Ga0207700_10003358 Ga0207700_100033584 493
96 3300050514 nmdc:mga08x19_89377_c1 nmdc:mga08x19_89377_c1_356_1888 493
97 iso_pu_bacteria 2808606359 2808848184 493
98 3300005434 Ga0070709_10103360 Ga0070709_101033602 494
99 3300005614 Ga0068856_100003852 Ga0068856_1000038526 494
100 3300005841 Ga0068863_100121739 Ga0068863_1001217392 494
101 3300006028 Ga0070717_10001705 Ga0070717_100017055 494
102 3300006237 Ga0097621_100006893 Ga0097621_1000068933 494
103 3300006881 Ga0068865_100025592 Ga0068865_1000255922 494
104 3300009093 Ga0105240_10051256 Ga0105240_100512562 494
105 3300009174 Ga0105241_10024456 Ga0105241_100244562 494
106 3300009551 Ga0105238_10014816 Ga0105238_100148165 494
107 3300013306 Ga0163162_10004988 Ga0163162_100049883 494
108 3300014969 Ga0157376_10021417 Ga0157376_100214171 494
109 3300025916 Ga0207663_10134231 Ga0207663_101342312 494
110 3300026078 Ga0207702_10020580 Ga0207702_100205801 494
111 3300026088 Ga0207641_10158124 Ga0207641_101581241 494
112 3300037068 Ga0373925_0032455 Ga0373925_0032455_1038_2570 494
113 3300046472 Ga0495580_0004889 Ga0495580_0004889_8681_10213 494
114 3300046663 Ga0495635_0060759 Ga0495635_0060759_542_2074 494
115 3300048907 Ga0496104_0018834 Ga0496104_0018834_4190_5722 494
116 3300048910 Ga0496107_0113006 Ga0496107_0113006_112_1644 494
117 3300048912 Ga0496109_0089340 Ga0496109_0089340_46_1578 494
118 3300048918 Ga0496115_0004990 Ga0496115_0004990_7816_9348 494
119 3300049586 Ga0501070_0135180 Ga0501070_0135180_263_1783 494
120 3300049823 Ga0501044_0001219 Ga0501044_0001219_20812_22332 494
121 3300005328 Ga0070676_10001792 Ga0070676_100017926 495
122 3300005340 Ga0070689_100050517 Ga0070689_1000505172 495
123 3300005344 Ga0070661_100002005 Ga0070661_1000020059 495
124 3300005347 Ga0070668_100019291 Ga0070668_1000192916 495
125 3300005456 Ga0070678_100150857 Ga0070678_1001508572 495
126 3300005457 Ga0070662_100002217 Ga0070662_1000022177 495
127 3300005548 Ga0070665_100014040 Ga0070665_1000140403 495
128 3300005563 Ga0068855_100004612 Ga0068855_1000046128 495
129 3300005617 Ga0068859_100014905 Ga0068859_1000149056 495
130 3300005618 Ga0068864_100035495 Ga0068864_1000354952 495
131 3300006931 Ga0097620_100014905 Ga0097620_1000149056 495
132 3300009093 Ga0105240_10012547 Ga0105240_100125475 495
133 3300009101 Ga0105247_10023736 Ga0105247_100237362 495
134 3300009551 Ga0105238_10061858 Ga0105238_100618582 495
135 3300009553 Ga0105249_10009226 Ga0105249_100092266 495
136 3300013102 Ga0157371_10046612 Ga0157371_100466123 495
137 3300013104 Ga0157370_10176247 Ga0157370_101762471 495
138 3300013105 Ga0157369_10010773 Ga0157369_100107738 495
139 3300013306 Ga0163162_10011526 Ga0163162_100115263 495
140 3300013308 Ga0157375_10210337 Ga0157375_102103372 495
141 3300014325 Ga0163163_10008060 Ga0163163_100080602 495
142 3300014968 Ga0157379_10079521 Ga0157379_100795211 495
143 3300025900 Ga0207710_10024868 Ga0207710_100248682 495
144 3300025903 Ga0207680_10009286 Ga0207680_100092863 495
145 3300025907 Ga0207645_10012752 Ga0207645_100127523 495
146 3300025913 Ga0207695_10008157 Ga0207695_100081577 495
147 3300025927 Ga0207687_10005122 Ga0207687_100051223 495
148 3300025933 Ga0207706_10000130 Ga0207706_1000013035 495
149 3300025941 Ga0207711_10000861 Ga0207711_100008613 495
150 3300025949 Ga0207667_10004047 Ga0207667_100040478 495
151 3300025961 Ga0207712_10049776 Ga0207712_100497762 495
152 3300026023 Ga0207677_10003872 Ga0207677_100038727 495
153 3300026088 Ga0207641_10104923 Ga0207641_101049232 495
154 3300028379 Ga0268266_10020527 Ga0268266_100205272 495
155 3300028381 Ga0268264_10036556 Ga0268264_100365562 495
156 3300048915 Ga0496112_0004487 Ga0496112_0004487_1932_3464 495
157 3300025321 Ga0207656_10025909 Ga0207656_100259092 496
158 3300006028 Ga0070717_10001418 Ga0070717_1000141814 497
159 3300009098 Ga0105245_10055944 Ga0105245_100559442 497
160 3300009101 Ga0105247_10015250 Ga0105247_100152503 497
161 3300009174 Ga0105241_10008999 Ga0105241_100089993 497
162 3300014325 Ga0163163_10095001 Ga0163163_100950012 497
163 3300014968 Ga0157379_10000265 Ga0157379_100002653 497
164 3300014968 Ga0157379_10022282 Ga0157379_100222822 497
165 3300025927 Ga0207687_10015636 Ga0207687_100156363 497
166 3300035691 Ga0373931_0053937 Ga0373931_0053937_350_1924 497
167 3300048905 Ga0496102_0004651 Ga0496102_0004651_6554_8128 497
168 3300048906 Ga0496103_0010566 Ga0496103_0010566_1536_3110 497
169 3300048907 Ga0496104_0019386 Ga0496104_0019386_3832_5406 497
170 3300005535 Ga0070684_100217884 Ga0070684_1002178842 498
171 3300009093 Ga0105240_10089880 Ga0105240_100898802 498
172 3300025913 Ga0207695_10014641 Ga0207695_100146416 498
173 3300025919 Ga0207657_10037727 Ga0207657_100377272 498
174 3300005445 Ga0070708_100008510 Ga0070708_1000085103 499
175 3300005467 Ga0070706_100000778 Ga0070706_10000077821 499
176 3300005468 Ga0070707_100000668 Ga0070707_10000066822 499
177 3300005471 Ga0070698_100000050 Ga0070698_10000005060 499
178 3300005518 Ga0070699_100013355 Ga0070699_1000133554 499
179 3300005536 Ga0070697_100000488 Ga0070697_1000004882 499
180 3300025910 Ga0207684_10000641 Ga0207684_1000064134 499
181 3300025922 Ga0207646_10000463 Ga0207646_1000046338 499
182 3300030522 Ga0307512_10012127 Ga0307512_100121273 499
183 iso_pu_bacteria 2547132111 2547412987 499
184 iso_pu_bacteria 2554235005 2554259131 499
185 iso_pu_bacteria 2582581314 2585314324 499
186 iso_pu_bacteria 2643221651 2644290661 499
187 iso_pu_bacteria 2947224130 2947231285 499
188 iso_pu_bacteria 8025530807 8025535554 499
189 3300005468 Ga0070707_100000076 Ga0070707_10000007649 500
190 3300005549 Ga0070704_100001930 Ga0070704_1000019309 500
191 3300025922 Ga0207646_10002220 Ga0207646_1000222014 500
192 3300025939 Ga0207665_10029707 Ga0207665_100297072 500
193 3300005435 Ga0070714_100000781 Ga0070714_1000007818 501
194 3300005439 Ga0070711_100000597 Ga0070711_1000005979 501
195 3300025916 Ga0207663_10005476 Ga0207663_100054761 501
196 3300025929 Ga0207664_10001715 Ga0207664_1000171510 501
197 3300032002 Ga0307416_100061144 Ga0307416_1000611441 501
198 3300035113 Ga0373936_0018627 Ga0373936_0018627_809_2344 501
199 3300035117 Ga0373953_0010075 Ga0373953_0010075_1356_2891 501
200 3300035171 Ga0373946_0002788 Ga0373946_0002788_1642_3177 501
201 3300035172 Ga0373955_0012350 Ga0373955_0012350_1641_3176 501
202 3300035695 Ga0373927_0000094 Ga0373927_0000094_17846_19381 501
203 3300037068 Ga0373925_0000583 Ga0373925_0000583_32700_34235 501
204 3300046477 Ga0495664_0003452 Ga0495664_0003452_2489_4024 501
205 3300047319 Ga0495674_0026827 Ga0495674_0026827_3324_4859 501
206 3300048088 Ga0495602_0025391 Ga0495602_0025391_1021_2556 501
207 3300005981 Ga0081538_10032628 Ga0081538_100326281 502
208 3300005467 Ga0070706_100127766 Ga0070706_1001277662 503
209 3300005614 Ga0068856_100044141 Ga0068856_1000441413 503
210 3300026078 Ga0207702_10048191 Ga0207702_100481913 503
211 3300049580 Ga0501046_0058030 Ga0501046_0058030_1501_3018 503
212 3300005327 Ga0070658_10062994 Ga0070658_100629942 504
213 3300005458 Ga0070681_10093099 Ga0070681_100930992 504
214 3300005459 Ga0068867_100075414 Ga0068867_1000754142 504
215 3300006028 Ga0070717_10004202 Ga0070717_100042024 504
216 3300006175 Ga0070712_100029927 Ga0070712_1000299273 504
217 3300009176 Ga0105242_10069418 Ga0105242_100694182 504
218 3300025915 Ga0207693_10059705 Ga0207693_100597053 504
219 3300025934 Ga0207686_10074272 Ga0207686_100742722 504
220 3300026089 Ga0207648_10038173 Ga0207648_100381735 504
221 3300044658 Ga0466972_0013962 Ga0466972_0013962_1061_2599 504
222 3300049823 Ga0501044_0095688 Ga0501044_0095688_384_1922 504
223 3300005444 Ga0070694_100033574 Ga0070694_1000335741 505
224 3300005458 Ga0070681_10038176 Ga0070681_100381762 505
225 3300005577 Ga0068857_100020375 Ga0068857_1000203753 505
226 3300011119 Ga0105246_10023645 Ga0105246_100236452 505
227 3300025914 Ga0207671_10081717 Ga0207671_100817171 505
228 3300026116 Ga0207674_10075529 Ga0207674_100755292 505
229 3300028786 Ga0307517_10011680 Ga0307517_100116803 505
230 3300037471 Ga0395905_0109966 Ga0395905_0109966_675_2234 505
231 3300037853 Ga0436364_1001807 Ga0436364_1001807_2102_3625 505
232 3300039450 Ga0436363_0387480 Ga0436363_0387480_504_2027 505
233 3300053087 Ga0500643_001041 Ga0500643_001041_10181_11710 505
234 iso_pu_bacteria 2856741275 2856745816 505
235 3300005436 Ga0070713_100004617 Ga0070713_1000046179 506
236 3300005439 Ga0070711_100112790 Ga0070711_1001127902 506
237 3300005467 Ga0070706_100085566 Ga0070706_1000855662 506
238 3300005467 Ga0070706_100129984 Ga0070706_1001299843 506
239 3300009093 Ga0105240_10018502 Ga0105240_100185025 506
240 3300009174 Ga0105241_10004842 Ga0105241_100048426 506
241 3300009545 Ga0105237_10240824 Ga0105237_102408241 506
242 3300009551 Ga0105238_10211855 Ga0105238_102118552 506
243 3300013104 Ga0157370_10090798 Ga0157370_100907983 506
244 3300013105 Ga0157369_10007673 Ga0157369_100076739 506
245 3300013296 Ga0157374_10083159 Ga0157374_100831592 506
246 3300013307 Ga0157372_10006105 Ga0157372_100061052 506
247 3300025910 Ga0207684_10076056 Ga0207684_100760562 506
248 3300025910 Ga0207684_10138371 Ga0207684_101383712 506
249 3300025913 Ga0207695_10116208 Ga0207695_101162082 506
250 3300025928 Ga0207700_10011905 Ga0207700_100119055 506
251 3300035691 Ga0373931_0039276 Ga0373931_0039276_267_1793 506
252 3300039450 Ga0436363_0533151 Ga0436363_0533151_251_1777 506
253 3300046472 Ga0495580_0063314 Ga0495580_0063314_554_2080 506
254 3300005331 Ga0070670_100006813 Ga0070670_1000068134 507
255 3300005336 Ga0070680_100130149 Ga0070680_1001301491 507
256 3300005338 Ga0068868_100012055 Ga0068868_1000120553 507
257 3300005436 Ga0070713_100042082 Ga0070713_1000420824 507
258 3300005445 Ga0070708_100008128 Ga0070708_1000081287 507
259 3300005457 Ga0070662_100122669 Ga0070662_1001226692 507
260 3300005458 Ga0070681_10001215 Ga0070681_100012154 507
261 3300005459 Ga0068867_100117106 Ga0068867_1001171062 507
262 3300005468 Ga0070707_100018342 Ga0070707_1000183425 507
263 3300005563 Ga0068855_100055061 Ga0068855_1000550612 507
264 3300005564 Ga0070664_100004506 Ga0070664_1000045067 507
265 3300005577 Ga0068857_100008164 Ga0068857_1000081643 507
266 3300005614 Ga0068856_100003303 Ga0068856_10000330310 507
267 3300005617 Ga0068859_100001440 Ga0068859_1000014405 507
268 3300005618 Ga0068864_100005850 Ga0068864_1000058504 507
269 3300005718 Ga0068866_10036632 Ga0068866_100366322 507
270 3300005840 Ga0068870_10023544 Ga0068870_100235442 507
271 3300005841 Ga0068863_100186384 Ga0068863_1001863842 507
272 3300005842 Ga0068858_100002929 Ga0068858_10000292911 507
273 3300005843 Ga0068860_100028567 Ga0068860_1000285672 507
274 3300006028 Ga0070717_10000685 Ga0070717_100006856 507
275 3300006028 Ga0070717_10009012 Ga0070717_100090123 507
276 3300006028 Ga0070717_10045623 Ga0070717_100456232 507
277 3300006028 Ga0070717_10114287 Ga0070717_101142872 507
278 3300006028 Ga0070717_10116059 Ga0070717_101160592 507
279 3300006163 Ga0070715_10002389 Ga0070715_100023892 507
280 3300006173 Ga0070716_100011816 Ga0070716_1000118162 507
281 3300006358 Ga0068871_100012488 Ga0068871_1000124883 507
282 3300006871 Ga0075434_100010531 Ga0075434_1000105312 507
283 3300006881 Ga0068865_100049625 Ga0068865_1000496252 507
284 3300006931 Ga0097620_100001440 Ga0097620_10000144011 507
285 3300007076 Ga0075435_100003448 Ga0075435_1000034484 507
286 3300009093 Ga0105240_10008346 Ga0105240_100083462 507
287 3300009174 Ga0105241_10141139 Ga0105241_101411392 507
288 3300013296 Ga0157374_10000340 Ga0157374_1000034016 507
289 3300013297 Ga0157378_10000371 Ga0157378_1000037117 507
290 3300013307 Ga0157372_10001024 Ga0157372_100010249 507
291 3300013307 Ga0157372_10026720 Ga0157372_100267203 507
292 3300025905 Ga0207685_10000337 Ga0207685_100003372 507
293 3300025906 Ga0207699_10047279 Ga0207699_100472792 507
294 3300025908 Ga0207643_10027398 Ga0207643_100273982 507
295 3300025912 Ga0207707_10007765 Ga0207707_100077655 507
296 3300025913 Ga0207695_10002608 Ga0207695_100026083 507
297 3300025915 Ga0207693_10000977 Ga0207693_100009777 507
298 3300025925 Ga0207650_10029046 Ga0207650_100290462 507
299 3300025928 Ga0207700_10079047 Ga0207700_100790472 507
300 3300025929 Ga0207664_10077757 Ga0207664_100777571 507
301 3300025933 Ga0207706_10057594 Ga0207706_100575944 507
302 3300025936 Ga0207670_10060716 Ga0207670_100607162 507
303 3300025939 Ga0207665_10001042 Ga0207665_100010422 507
304 3300025945 Ga0207679_10027184 Ga0207679_100271843 507
305 3300025949 Ga0207667_10044278 Ga0207667_100442782 507
306 3300026035 Ga0207703_10004766 Ga0207703_100047665 507
307 3300026078 Ga0207702_10009076 Ga0207702_100090763 507
308 3300026088 Ga0207641_10038024 Ga0207641_100380244 507
309 3300026089 Ga0207648_10150359 Ga0207648_101503591 507
310 3300026095 Ga0207676_10097967 Ga0207676_100979672 507
311 3300026116 Ga0207674_10001344 Ga0207674_1000134414 507
312 3300028381 Ga0268264_10009309 Ga0268264_100093093 507
313 3300036401 Ga0373937_0048972 Ga0373937_0048972_118_1650 507
314 3300037068 Ga0373925_0062557 Ga0373925_0062557_319_1848 507
315 3300046472 Ga0495580_0000162 Ga0495580_0000162_33713_35242 507
316 3300048915 Ga0496112_0019079 Ga0496112_0019079_3475_5004 507
317 3300050512 nmdc:mga0n895_5251_c1 nmdc:mga0n895_5251_c1_6373_7902 507
318 3300050513 nmdc:mga0rr50_3967_c1 nmdc:mga0rr50_3967_c1_1374_2903 507
319 3300005329 Ga0070683_100006666 Ga0070683_1000066664 508
320 3300005335 Ga0070666_10015834 Ga0070666_100158343 508
321 3300005353 Ga0070669_100097825 Ga0070669_1000978252 508
322 3300005366 Ga0070659_100007287 Ga0070659_1000072876 508
323 3300005367 Ga0070667_100003228 Ga0070667_1000032287 508
324 3300005435 Ga0070714_100044629 Ga0070714_1000446292 508
325 3300005445 Ga0070708_100000443 Ga0070708_1000004435 508
326 3300005455 Ga0070663_100004983 Ga0070663_1000049837 508
327 3300005459 Ga0068867_100094773 Ga0068867_1000947731 508
328 3300005518 Ga0070699_100012931 Ga0070699_1000129315 508
329 3300005535 Ga0070684_100008222 Ga0070684_1000082223 508
330 3300005536 Ga0070697_100000190 Ga0070697_10000019018 508
331 3300005539 Ga0068853_100006218 Ga0068853_1000062184 508
332 3300005545 Ga0070695_100032333 Ga0070695_1000323332 508
333 3300005564 Ga0070664_100007626 Ga0070664_1000076263 508
334 3300005578 Ga0068854_100000855 Ga0068854_1000008558 508
335 3300005842 Ga0068858_100035303 Ga0068858_1000353032 508
336 3300011119 Ga0105246_10001911 Ga0105246_100019118 508
337 3300013296 Ga0157374_10003771 Ga0157374_100037718 508
338 3300014969 Ga0157376_10002452 Ga0157376_100024525 508
339 3300025911 Ga0207654_10031881 Ga0207654_100318812 508
340 3300025919 Ga0207657_10000511 Ga0207657_100005119 508
341 3300025923 Ga0207681_10055077 Ga0207681_100550772 508
342 3300025924 Ga0207694_10017005 Ga0207694_100170052 508
343 3300025929 Ga0207664_10091985 Ga0207664_100919852 508
344 3300025932 Ga0207690_10051949 Ga0207690_100519492 508
345 3300026067 Ga0207678_10000169 Ga0207678_1000016926 508
346 3300026089 Ga0207648_10033089 Ga0207648_100330892 508
347 3300026121 Ga0207683_10090183 Ga0207683_100901832 508
348 3300028017 Ga0265356_1000868 Ga0265356_10008682 508
349 3300031090 Ga0265760_10005433 Ga0265760_100054332 508
350 3300035084 Ga0373928_0009824 Ga0373928_0009824_218_1750 508
351 3300048905 Ga0496102_0103756 Ga0496102_0103756_783_2315 508
352 3300005436 Ga0070713_100018501 Ga0070713_1000185012 509
353 3300005439 Ga0070711_100004279 Ga0070711_1000042791 509
354 3300005445 Ga0070708_100003046 Ga0070708_10000304610 509
355 3300005467 Ga0070706_100004970 Ga0070706_10000497010 509
356 3300005467 Ga0070706_100037627 Ga0070706_1000376273 509
357 3300005471 Ga0070698_100075464 Ga0070698_1000754642 509
358 3300005518 Ga0070699_100015540 Ga0070699_1000155404 509
359 3300005536 Ga0070697_100001083 Ga0070697_10000108316 509
360 3300005563 Ga0068855_100237659 Ga0068855_1002376592 509
361 3300006028 Ga0070717_10024000 Ga0070717_100240002 509
362 3300006028 Ga0070717_10041308 Ga0070717_100413083 509
363 3300006028 Ga0070717_10201670 Ga0070717_102016702 509
364 3300006175 Ga0070712_100001314 Ga0070712_10000131410 509
365 3300006852 Ga0075433_10017759 Ga0075433_100177592 509
366 3300006871 Ga0075434_100007444 Ga0075434_1000074449 509
367 3300025910 Ga0207684_10042712 Ga0207684_100427121 509
368 3300025915 Ga0207693_10001135 Ga0207693_1000113510 509
369 3300025915 Ga0207693_10045176 Ga0207693_100451762 509
370 3300025916 Ga0207663_10002444 Ga0207663_100024445 509
371 3300025922 Ga0207646_10002755 Ga0207646_1000275514 509
372 3300025929 Ga0207664_10107133 Ga0207664_101071332 509
373 3300025949 Ga0207667_10174404 Ga0207667_101744042 509
374 3300028800 Ga0265338_10007423 Ga0265338_100074237 509
375 3300028800 Ga0265338_10028722 Ga0265338_100287222 509
376 3300031344 Ga0265316_10039529 Ga0265316_100395294 509
377 3300035691 Ga0373931_0059942 Ga0373931_0059942_467_2002 509
378 3300046455 Ga0495603_0045849 Ga0495603_0045849_443_1975 509
379 3300050512 nmdc:mga0n895_16022_c1 nmdc:mga0n895_16022_c1_4756_6291 509
380 3300050515 nmdc:mga0a205_27359_c1 nmdc:mga0a205_27359_c1_987_2522 509
381 3300005340 Ga0070689_100055794 Ga0070689_1000557941 510
382 3300005354 Ga0070675_100023044 Ga0070675_1000230445 510
383 3300005366 Ga0070659_100023178 Ga0070659_1000231782 510
384 3300005367 Ga0070667_100226009 Ga0070667_1002260091 510
385 3300005457 Ga0070662_100068313 Ga0070662_1000683132 510
386 3300005466 Ga0070685_10013968 Ga0070685_100139682 510
387 3300005547 Ga0070693_100060866 Ga0070693_1000608662 510
388 3300005564 Ga0070664_100087102 Ga0070664_1000871021 510
389 3300005614 Ga0068856_100034032 Ga0068856_1000340323 510
390 3300005719 Ga0068861_100021800 Ga0068861_1000218002 510
391 3300005834 Ga0068851_10004326 Ga0068851_100043263 510
392 3300005840 Ga0068870_10023132 Ga0068870_100231321 510
393 3300005841 Ga0068863_100054480 Ga0068863_1000544803 510
394 3300005842 Ga0068858_100028286 Ga0068858_1000282863 510
395 3300009176 Ga0105242_10022632 Ga0105242_100226323 510
396 3300009545 Ga0105237_10038811 Ga0105237_100388113 510
397 3300009553 Ga0105249_10023234 Ga0105249_100232343 510
398 3300010375 Ga0105239_10016968 Ga0105239_100169682 510
399 3300011119 Ga0105246_10010773 Ga0105246_100107733 510
400 3300013100 Ga0157373_10014776 Ga0157373_100147763 510
401 3300013105 Ga0157369_10009064 Ga0157369_100090645 510
402 3300013307 Ga0157372_10027308 Ga0157372_100273083 510
403 3300014326 Ga0157380_10102511 Ga0157380_101025112 510
404 3300014745 Ga0157377_10005464 Ga0157377_100054643 510
405 3300025315 Ga0207697_10011682 Ga0207697_100116823 510
406 3300025901 Ga0207688_10011992 Ga0207688_100119922 510
407 3300025904 Ga0207647_10019091 Ga0207647_100190912 510
408 3300025908 Ga0207643_10000172 Ga0207643_1000017233 510
409 3300025918 Ga0207662_10006523 Ga0207662_100065235 510
410 3300025919 Ga0207657_10003279 Ga0207657_100032793 510
411 3300025920 Ga0207649_10000739 Ga0207649_100007395 510
412 3300025925 Ga0207650_10000059 Ga0207650_1000005915 510
413 3300025933 Ga0207706_10038906 Ga0207706_100389064 510
414 3300025940 Ga0207691_10022883 Ga0207691_100228833 510
415 3300025941 Ga0207711_10006896 Ga0207711_100068963 510
416 3300025942 Ga0207689_10025199 Ga0207689_100251992 510
417 3300025945 Ga0207679_10000427 Ga0207679_1000042719 510
418 3300026041 Ga0207639_10050008 Ga0207639_100500082 510
419 3300026067 Ga0207678_10014461 Ga0207678_100144612 510
420 3300026078 Ga0207702_10070744 Ga0207702_100707442 510
421 3300026088 Ga0207641_10000025 Ga0207641_1000002517 510
422 3300026088 Ga0207641_10053447 Ga0207641_100534472 510
423 3300026089 Ga0207648_10000151 Ga0207648_1000015110 510
424 3300026095 Ga0207676_10000252 Ga0207676_1000025212 510
425 3300026116 Ga0207674_10000162 Ga0207674_1000016247 510
426 3300026118 Ga0207675_100030890 Ga0207675_1000308902 510
427 3300026121 Ga0207683_10000225 Ga0207683_100002253 510
428 3300028381 Ga0268264_10025658 Ga0268264_100256583 510
429 3300045051 Ga0451576_0028302 Ga0451576_0028302_1619_3151 510
430 3300048909 Ga0496106_0181494 Ga0496106_0181494_52_1596 510
431 3300048911 Ga0496108_0000210 Ga0496108_0000210_47146_48690 510
432 3300048912 Ga0496109_0000228 Ga0496109_0000228_27131_28675 510
433 3300048913 Ga0496110_0000145 Ga0496110_0000145_7276_8820 510
434 3300048915 Ga0496112_0000048 Ga0496112_0000048_26840_28384 510
435 3300048916 Ga0496113_0001549 Ga0496113_0001549_8175_9719 510
436 3300005336 Ga0070680_100010748 Ga0070680_1000107485 511
437 3300005435 Ga0070714_100026896 Ga0070714_1000268965 511
438 3300005563 Ga0068855_100035941 Ga0068855_1000359415 511
439 3300009093 Ga0105240_10005869 Ga0105240_1000586913 511
440 3300013104 Ga0157370_10050330 Ga0157370_100503302 511
441 3300013105 Ga0157369_10078067 Ga0157369_100780672 511
442 3300025916 Ga0207663_10096949 Ga0207663_100969492 511
443 3300025917 Ga0207660_10017098 Ga0207660_100170982 511
444 3300025929 Ga0207664_10119243 Ga0207664_101192432 511
445 3300037471 Ga0395905_0012753 Ga0395905_0012753_257_1804 511
446 3300039437 Ga0436365_0601983 Ga0436365_0601983_3178_4719 511
447 3300048913 Ga0496110_0012562 Ga0496110_0012562_2675_4222 511
448 3300048914 Ga0496111_0009110 Ga0496111_0009110_2734_4281 511
449 3300050514 nmdc:mga08x19_9755_c1 nmdc:mga08x19_9755_c1_3821_5362 511
450 3300005445 Ga0070708_100010869 Ga0070708_1000108693 512
451 3300005458 Ga0070681_10027213 Ga0070681_100272132 512
452 3300005468 Ga0070707_100133957 Ga0070707_1001339572 512
453 3300005518 Ga0070699_100054940 Ga0070699_1000549402 512
454 3300006175 Ga0070712_100030032 Ga0070712_1000300322 512
455 3300037471 Ga0395905_0005868 Ga0395905_0005868_796_2346 512
456 3300037853 Ga0436364_1552374 Ga0436364_1552374_1430_2980 512
457 3300039437 Ga0436365_1014216 Ga0436365_1014216_2699_4249 512
458 3300039450 Ga0436363_1383917 Ga0436363_1383917_591_2141 512
459 3300046472 Ga0495580_0031357 Ga0495580_0031357_1940_3517 512
460 3300048907 Ga0496104_0101447 Ga0496104_0101447_990_2567 512
461 3300048912 Ga0496109_0108185 Ga0496109_0108185_703_2280 512
462 3300048915 Ga0496112_0046808 Ga0496112_0046808_2150_3727 512
463 3300001976 JGI24752J21851_1003133 JGI24752J21851_10031332 513
464 3300005436 Ga0070713_100047267 Ga0070713_1000472672 513
465 3300005536 Ga0070697_100002086 Ga0070697_1000020864 513
466 3300005614 Ga0068856_100107955 Ga0068856_1001079552 513
467 3300006852 Ga0075433_10040678 Ga0075433_100406785 513
468 3300006871 Ga0075434_100001578 Ga0075434_10000157813 513
469 3300035172 Ga0373955_0012549 Ga0373955_0012549_382_1932 513
470 3300046472 Ga0495580_0018230 Ga0495580_0018230_1543_3084 513
471 3300050515 nmdc:mga0a205_41997_c1 nmdc:mga0a205_41997_c1_88_1629 513

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

261

559

0.98

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

79

259

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e77-assembly1.cif.gz_A complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate 0.9483 17 510
1h93-assembly1.cif.gz_A active mutant (s215->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9473 18 510
7snh-assembly1.cif.gz_D structure of g6pd-d200n tetramer bound to nadp+ 0.9463 19 510
1e7m-assembly1.cif.gz_A active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9461 18 510
1dpg-assembly1.cif.gz_B glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9427 17 510
ID Description Score Start End Superfamily
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 26 199 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 26 199 3.40.50.720
af_Q2FY66_6_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 19 196 3.40.50.720
af_P9WN73_204_512_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 197 509 3.40.50.720
af_Q2FY66_180_491_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9573 197 510 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2V9L8L6-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9947 235 366 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-X1A683-F1-model_v4 Glucose-6-phosphate dehydrogenase C-terminal domain-containing protein 0.985 235 509 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A0L8NUJ8-F1-model_v4 deleted 0.9801 236 379
AF-A0A7I0BZY7-F1-model_v4 deleted 0.9784 271 365
AF-A0A3M3WFC8-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9775 129 511 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Feature Viewer

pLDDT pTM Quality
90.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map