F449683

General Info

Members Datasets Scaffolds Average Seq Length
466 222 932 150

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10505078|Ga0207685_105050782
Length 174
Sequence VPKVNAADDIAPHRGRRRRVATSLAEINVVPLVDVMLVLLIIFMVAAPMIQRGIDVNLPVARRAQPITGERVEVTVPLTYRSNHQVYLGRDAVNVAVLQERVRQKMENAPKKDVFLRGDRGVTLGELMEVTDLLKAAGVENVGLVVASQSRAAELALDDLRCARGARFTNTRHG

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.79
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10505078 3300025905 Bacteria 637
2 JGI25406J46586_10107807 3300003203 Bacteria 826
3 Ga0065712_10097792 3300005290 Bacteria 2139
4 Ga0065712_10128600 3300005290 Bacteria 1577
5 Ga0065712_10192992 3300005290 Bacteria 1140
6 Ga0065715_10434132 3300005293 Bacteria 843
7 Ga0065715_10497681 3300005293 Bacteria 782
8 Ga0070676_10685644 3300005328 Bacteria 747
9 Ga0070676_11134779 3300005328 Bacteria 592
10 Ga0070690_100178185 3300005330 Bacteria 1467
11 Ga0070690_100401832 3300005330 Bacteria 1006
12 Ga0070670_100189050 3300005331 Bacteria 1788
13 Ga0070670_100481916 3300005331 Bacteria 1102
14 Ga0070670_101959162 3300005331 Bacteria 540
15 Ga0070677_10073045 3300005333 Bacteria 1448
16 Ga0070677_10405148 3300005333 Bacteria 720
17 Ga0068869_100433887 3300005334 Bacteria 1086
18 Ga0068869_101620039 3300005334 Bacteria 577
19 Ga0070666_10174094 3300005335 Bacteria 1508
20 Ga0070666_10525787 3300005335 Bacteria 859
21 Ga0070666_10721494 3300005335 Bacteria 732
22 Ga0070680_100441536 3300005336 Bacteria 1111
23 Ga0070682_100626704 3300005337 Bacteria 853
24 Ga0068868_100847404 3300005338 Bacteria 828
25 Ga0068868_101468664 3300005338 Bacteria 637
26 Ga0070660_100465997 3300005339 Bacteria 1049
27 Ga0070691_10015212 3300005341 Bacteria 3534
28 Ga0070661_100230999 3300005344 Bacteria 1422
29 Ga0070668_100020373 3300005347 Bacteria 5004
30 Ga0070668_100288423 3300005347 Bacteria 1373
31 Ga0070669_100010731 3300005353 Bacteria 6501
32 Ga0070669_100035649 3300005353 Bacteria 3604
33 Ga0070669_100309100 3300005353 Bacteria 1273
34 Ga0070669_100425933 3300005353 Bacteria 1090
35 Ga0070675_100185858 3300005354 Bacteria 1798
36 Ga0070675_100205249 3300005354 Bacteria 1711
37 Ga0070675_100377300 3300005354 Bacteria 1262
38 Ga0070675_101412338 3300005354 Bacteria 642
39 Ga0070671_100423025 3300005355 Bacteria 1141
40 Ga0070671_101414434 3300005355 Bacteria 615
41 Ga0070674_100002227 3300005356 Bacteria 10668
42 Ga0070674_100172219 3300005356 Bacteria 1651
43 Ga0070673_100095246 3300005364 Bacteria 2442
44 Ga0070673_100542425 3300005364 Bacteria 1056
45 Ga0070673_100556095 3300005364 Bacteria 1043
46 Ga0070673_100916877 3300005364 Bacteria 813
47 Ga0070688_100727054 3300005365 Bacteria 771
48 Ga0070688_100928706 3300005365 Bacteria 688
49 Ga0070659_100127995 3300005366 Bacteria 2061
50 Ga0070667_100103905 3300005367 Bacteria 2457
51 Ga0070709_10135585 3300005434 Bacteria 1686
52 Ga0070710_10130467 3300005437 Bacteria 1532
53 Ga0070701_10216464 3300005438 Bacteria 1140
54 Ga0070705_100004627 3300005440 Bacteria 6698
55 Ga0070705_100199777 3300005440 Bacteria 1370
56 Ga0070700_100671292 3300005441 Bacteria 820
57 Ga0070700_100868961 3300005441 Bacteria 732
58 Ga0070700_101259852 3300005441 Bacteria 620
59 Ga0070700_101507100 3300005441 Bacteria 572
60 Ga0070694_101426194 3300005444 Bacteria 585
61 Ga0070708_100013026 3300005445 Bacteria 6797
62 Ga0070678_100007232 3300005456 Bacteria 6571
63 Ga0070678_100902360 3300005456 Bacteria 808
64 Ga0070678_101778385 3300005456 Bacteria 581
65 Ga0070662_100443290 3300005457 Bacteria 1077
66 Ga0070681_10052700 3300005458 Bacteria 4058
67 Ga0070681_10230240 3300005458 Bacteria 1768
68 Ga0070681_10382761 3300005458 Bacteria 1318
69 Ga0068867_100073117 3300005459 Bacteria 2568
70 Ga0068867_100078665 3300005459 Bacteria 2480
71 Ga0068867_100236370 3300005459 Bacteria 1480
72 Ga0068867_100847388 3300005459 Bacteria 819
73 Ga0068867_101406891 3300005459 Bacteria 647
74 Ga0070685_10517732 3300005466 Bacteria 847
75 Ga0070685_10790062 3300005466 Bacteria 699
76 Ga0070707_100294798 3300005468 Bacteria 1576
77 Ga0070698_100431924 3300005471 Bacteria 1252
78 Ga0070698_101355677 3300005471 Bacteria 662
79 Ga0070699_100020173 3300005518 Bacteria 5745
80 Ga0070699_101358189 3300005518 Bacteria 652
81 Ga0070679_100065476 3300005530 Bacteria 3623
82 Ga0070679_100159168 3300005530 Bacteria 2233
83 Ga0070679_100297101 3300005530 Bacteria 1566
84 Ga0070697_100280033 3300005536 Bacteria 1431
85 Ga0070697_100290942 3300005536 Bacteria 1403
86 Ga0070697_100444632 3300005536 Bacteria 1129
87 Ga0070672_100356803 3300005543 Bacteria 1247
88 Ga0070672_101003894 3300005543 Bacteria 740
89 Ga0070686_100042551 3300005544 Bacteria 2846
90 Ga0070686_100050748 3300005544 Bacteria 2638
91 Ga0070686_100388149 3300005544 Bacteria 1059
92 Ga0070686_101143121 3300005544 Bacteria 645
93 Ga0070695_100014624 3300005545 Bacteria 4732
94 Ga0070695_100034842 3300005545 Bacteria 3159
95 Ga0070695_100250470 3300005545 Bacteria 1289
96 Ga0070696_100002672 3300005546 Bacteria 11810
97 Ga0070696_100025274 3300005546 Bacteria 4037
98 Ga0070696_100039721 3300005546 Bacteria 3249
99 Ga0070696_100898396 3300005546 Bacteria 735
100 Ga0070693_100596609 3300005547 Bacteria 797
101 Ga0070665_100014293 3300005548 Bacteria 7972
102 Ga0070665_100047603 3300005548 Bacteria 4303
103 Ga0070665_101061329 3300005548 Bacteria 822
104 Ga0070704_100020027 3300005549 Bacteria 4306
105 Ga0070704_100028867 3300005549 Bacteria 3697
106 Ga0070704_100176247 3300005549 Bacteria 1706
107 Ga0068855_100010225 3300005563 Bacteria 11310
108 Ga0068855_100393789 3300005563 Bacteria 1519
109 Ga0070664_100155770 3300005564 Bacteria 2019
110 Ga0070664_100672551 3300005564 Bacteria 963
111 Ga0068857_100923084 3300005577 Bacteria 838
112 Ga0068856_100129088 3300005614 Bacteria 2532
113 Ga0070702_100002187 3300005615 Bacteria 8335
114 Ga0070702_100711452 3300005615 Bacteria 767
115 Ga0068852_100142993 3300005616 Bacteria 2216
116 Ga0068852_102186886 3300005616 Bacteria 575
117 Ga0068859_100015365 3300005617 Bacteria 7691
118 Ga0068859_100032919 3300005617 Bacteria 5207
119 Ga0068859_100142977 3300005617 Bacteria 2466
120 Ga0068864_100049144 3300005618 Bacteria 3628
121 Ga0068864_100188712 3300005618 Bacteria 1888
122 Ga0068864_100565268 3300005618 Bacteria 1101
123 Ga0068866_10184419 3300005718 Bacteria 1235
124 Ga0068866_10271402 3300005718 Bacteria 1047
125 Ga0068866_10282511 3300005718 Bacteria 1029
126 Ga0068861_100012408 3300005719 Bacteria 5941
127 Ga0068861_100127355 3300005719 Bacteria 2062
128 Ga0068861_100197726 3300005719 Bacteria 1685
129 Ga0068861_100228046 3300005719 Bacteria 1578
130 Ga0068861_100334957 3300005719 Bacteria 1322
131 Ga0068861_101762671 3300005719 Bacteria 613
132 Ga0068863_100322949 3300005841 Bacteria 1499
133 Ga0068863_100674640 3300005841 Bacteria 1026
134 Ga0068863_101079812 3300005841 Bacteria 807
135 Ga0068858_100002817 3300005842 Bacteria 17483
136 Ga0068858_100077308 3300005842 Bacteria 3092
137 Ga0068858_100244631 3300005842 Bacteria 1703
138 Ga0068858_100443274 3300005842 Bacteria 1251
139 Ga0068858_101161356 3300005842 Bacteria 759
140 Ga0068860_100045550 3300005843 Bacteria 4183
141 Ga0068860_100347652 3300005843 Bacteria 1459
142 Ga0068860_100353643 3300005843 Bacteria 1446
143 Ga0068860_101056969 3300005843 Bacteria 831
144 Ga0068860_101159628 3300005843 Bacteria 793
145 Ga0068860_101450424 3300005843 Bacteria 708
146 Ga0068862_100278419 3300005844 Bacteria 1532
147 Ga0068862_100310480 3300005844 Bacteria 1453
148 Ga0081455_10061181 3300005937 Bacteria 3170
149 Ga0081539_10011228 3300005985 Bacteria 7122
150 Ga0070717_11293534 3300006028 Bacteria 663
151 Ga0070716_100130499 3300006173 Bacteria 1588
152 Ga0097621_100034775 3300006237 Bacteria 4021
153 Ga0097621_100085629 3300006237 Bacteria 2629
154 Ga0097621_100107178 3300006237 Bacteria 2358
155 Ga0068871_100002033 3300006358 Bacteria 13708
156 Ga0068871_100027753 3300006358 Bacteria 4430
157 Ga0068871_100284321 3300006358 Bacteria 1448
158 Ga0068871_101168746 3300006358 Bacteria 721
159 Ga0075428_100685710 3300006844 Bacteria 1092
160 Ga0075431_100361078 3300006847 Bacteria 1459
161 Ga0075431_100528753 3300006847 Bacteria 1168
162 Ga0075433_10065352 3300006852 Bacteria 3191
163 Ga0075434_100128631 3300006871 Bacteria 2550
164 Ga0075434_100130095 3300006871 Bacteria 2536
165 Ga0075434_100179149 3300006871 Bacteria 2139
166 Ga0075434_100440603 3300006871 Bacteria 1324
167 Ga0068865_100007092 3300006881 Bacteria 6880
168 Ga0068865_100009515 3300006881 Bacteria 6028
169 Ga0075436_100008238 3300006914 Bacteria 7131
170 Ga0075436_100063141 3300006914 Bacteria 2560
171 Ga0075436_100072132 3300006914 Bacteria 2389
172 Ga0075436_100330694 3300006914 Bacteria 1096
173 Ga0097620_100015365 3300006931 Bacteria 7691
174 Ga0097620_100032919 3300006931 Bacteria 5207
175 Ga0097620_100142977 3300006931 Bacteria 2466
176 Ga0075435_100030455 3300007076 Bacteria 4244
177 Ga0075435_100042480 3300007076 Bacteria 3637
178 Ga0075435_100172998 3300007076 Bacteria 1822
179 Ga0105251_10120498 3300009011 Bacteria 1192
180 Ga0111539_10004497 3300009094 Bacteria 18235
181 Ga0111539_10023807 3300009094 Bacteria 7524
182 Ga0111539_10121093 3300009094 Bacteria 3066
183 Ga0105245_10145130 3300009098 Bacteria 2239
184 Ga0105245_11581115 3300009098 Bacteria 707
185 Ga0105247_10041387 3300009101 Bacteria 2820
186 Ga0114129_10002052 3300009147 Bacteria 27655
187 Ga0114129_10013715 3300009147 Bacteria 11549
188 Ga0114129_10028594 3300009147 Bacteria 7898
189 Ga0114129_10749288 3300009147 Bacteria 1250
190 Ga0105243_10020463 3300009148 Bacteria 5017
191 Ga0105243_10057293 3300009148 Bacteria 3102
192 Ga0105241_10919420 3300009174 Bacteria 814
193 Ga0105242_10038413 3300009176 Bacteria 3850
194 Ga0105242_10217770 3300009176 Bacteria 1705
195 Ga0105242_10298737 3300009176 Bacteria 1469
196 Ga0105242_10447106 3300009176 Bacteria 1217
197 Ga0105242_11204810 3300009176 Bacteria 777
198 Ga0105242_11912615 3300009176 Bacteria 634
199 Ga0105248_10008235 3300009177 Bacteria 11454
200 Ga0105248_10019766 3300009177 Bacteria 7458
201 Ga0105248_10020566 3300009177 Bacteria 7314
202 Ga0105248_10203359 3300009177 Bacteria 2231
203 Ga0105248_10227264 3300009177 Bacteria 2101
204 Ga0105248_10643883 3300009177 Bacteria 1196
205 Ga0105248_10883400 3300009177 Bacteria 1009
206 Ga0105248_11004942 3300009177 Bacteria 942
207 Ga0105248_11181002 3300009177 Bacteria 865
208 Ga0105238_10039703 3300009551 Bacteria 4773
209 Ga0105249_10105699 3300009553 Bacteria 2655
210 Ga0105249_11412665 3300009553 Bacteria 768
211 Ga0157374_10030919 3300013296 Bacteria 4863
212 Ga0157374_10174240 3300013296 Bacteria 2100
213 Ga0157374_11030978 3300013296 Bacteria 842
214 Ga0157374_11191972 3300013296 Bacteria 783
215 Ga0157374_12083013 3300013296 Bacteria 594
216 Ga0157378_10228220 3300013297 Bacteria 1773
217 Ga0157378_10973595 3300013297 Bacteria 882
218 Ga0157378_11421588 3300013297 Bacteria 737
219 Ga0163162_10538234 3300013306 Bacteria 1297
220 Ga0163162_10652866 3300013306 Bacteria 1176
221 Ga0163162_11420378 3300013306 Bacteria 790
222 Ga0157375_10187546 3300013308 Bacteria 2222
223 Ga0157375_10296921 3300013308 Bacteria 1779
224 Ga0157375_10901373 3300013308 Bacteria 1028
225 Ga0157375_12924553 3300013308 Bacteria 571
226 Ga0163163_10016066 3300014325 Bacteria 6942
227 Ga0163163_10075990 3300014325 Bacteria 3353
228 Ga0163163_10531004 3300014325 Bacteria 1239
229 Ga0157380_10018135 3300014326 Bacteria 5221
230 Ga0157380_10176164 3300014326 Bacteria 1874
231 Ga0157377_11385911 3300014745 Bacteria 554
232 Ga0157379_11286073 3300014968 Bacteria 706
233 Ga0157379_11580618 3300014968 Bacteria 640
234 Ga0157376_10017474 3300014969 Bacteria 5472
235 Ga0157376_10076972 3300014969 Bacteria 2852
236 Ga0157376_10242778 3300014969 Bacteria 1678
237 Ga0157376_10475055 3300014969 Bacteria 1224
238 Ga0157376_12286512 3300014969 Bacteria 580
239 Ga0163161_10251553 3300017792 Bacteria 1377
240 Ga0206354_10040446 3300020081 Bacteria 848
241 Ga0224712_10369556 3300022467 Bacteria 680
242 Ga0207697_10044567 3300025315 Bacteria 1825
243 Ga0207697_10178910 3300025315 Bacteria 929
244 Ga0207642_10061929 3300025899 Bacteria 1742
245 Ga0207710_10140985 3300025900 Bacteria 1164
246 Ga0207680_10163154 3300025903 Bacteria 1496
247 Ga0207680_10202895 3300025903 Bacteria 1352
248 Ga0207680_10676920 3300025903 Bacteria 739
249 Ga0207699_10040525 3300025906 Bacteria 2684
250 Ga0207645_10001664 3300025907 Bacteria 18110
251 Ga0207645_10026733 3300025907 Bacteria 3728
252 Ga0207645_10842861 3300025907 Bacteria 623
253 Ga0207643_10194566 3300025908 Bacteria 1232
254 Ga0207707_10022136 3300025912 Bacteria 5555
255 Ga0207695_10356101 3300025913 Bacteria 1350
256 Ga0207693_10096895 3300025915 Bacteria 2313
257 Ga0207660_10119239 3300025917 Bacteria 1996
258 Ga0207662_10094347 3300025918 Bacteria 1846
259 Ga0207662_10504584 3300025918 Bacteria 833
260 Ga0207657_10001144 3300025919 Bacteria 28206
261 Ga0207657_10342545 3300025919 Bacteria 1180
262 Ga0207652_10034382 3300025921 Bacteria 4271
263 Ga0207652_10053720 3300025921 Bacteria 3461
264 Ga0207646_10252416 3300025922 Bacteria 1594
265 Ga0207681_10014520 3300025923 Bacteria 4897
266 Ga0207681_10016781 3300025923 Bacteria 4588
267 Ga0207681_10133207 3300025923 Bacteria 1840
268 Ga0207681_10642757 3300025923 Bacteria 879
269 Ga0207681_10854740 3300025923 Bacteria 761
270 Ga0207650_11127708 3300025925 Bacteria 667
271 Ga0207659_10084090 3300025926 Bacteria 2361
272 Ga0207659_10236393 3300025926 Bacteria 1476
273 Ga0207659_10481559 3300025926 Bacteria 1048
274 Ga0207687_10029667 3300025927 Bacteria 3681
275 Ga0207644_10119722 3300025931 Bacteria 2003
276 Ga0207690_10036855 3300025932 Bacteria 3170
277 Ga0207686_10008087 3300025934 Bacteria 5673
278 Ga0207686_10010424 3300025934 Bacteria 5061
279 Ga0207686_10300952 3300025934 Bacteria 1191
280 Ga0207686_10412558 3300025934 Bacteria 1031
281 Ga0207686_11240937 3300025934 Bacteria 611
282 Ga0207709_10040029 3300025935 Bacteria 2804
283 Ga0207670_10473592 3300025936 Bacteria 1013
284 Ga0207669_10011119 3300025937 Bacteria 4366
285 Ga0207669_10486285 3300025937 Bacteria 985
286 Ga0207669_11496961 3300025937 Bacteria 575
287 Ga0207704_10010081 3300025938 Bacteria 4587
288 Ga0207704_10081831 3300025938 Bacteria 2090
289 Ga0207704_10116658 3300025938 Bacteria 1817
290 Ga0207704_10842223 3300025938 Bacteria 768
291 Ga0207665_10143136 3300025939 Bacteria 1707
292 Ga0207665_10385346 3300025939 Bacteria 1065
293 Ga0207691_10026845 3300025940 Bacteria 5403
294 Ga0207691_10101649 3300025940 Bacteria 2565
295 Ga0207691_10177523 3300025940 Bacteria 1862
296 Ga0207691_10890097 3300025940 Bacteria 746
297 Ga0207711_10012385 3300025941 Bacteria 7089
298 Ga0207711_10014207 3300025941 Bacteria 6613
299 Ga0207711_10115745 3300025941 Bacteria 2389
300 Ga0207711_10129919 3300025941 Bacteria 2258
301 Ga0207711_10478263 3300025941 Bacteria 1160
302 Ga0207711_10821192 3300025941 Bacteria 866
303 Ga0207711_11589823 3300025941 Bacteria 597
304 Ga0207689_10220342 3300025942 Bacteria 1568
305 Ga0207689_11040869 3300025942 Bacteria 690
306 Ga0207679_10012933 3300025945 Bacteria 5461
307 Ga0207679_11153752 3300025945 Bacteria 711
308 Ga0207651_10337690 3300025960 Bacteria 1265
309 Ga0207651_10607582 3300025960 Bacteria 956
310 Ga0207712_10054617 3300025961 Bacteria 2806
311 Ga0207712_10407297 3300025961 Bacteria 1144
312 Ga0207668_10108412 3300025972 Bacteria 2079
313 Ga0207668_10263610 3300025972 Bacteria 1405
314 Ga0207668_10358573 3300025972 Bacteria 1221
315 Ga0207658_11256344 3300025986 Bacteria 677
316 Ga0207677_10332487 3300026023 Bacteria 1267
317 Ga0207703_10039358 3300026035 Bacteria 3778
318 Ga0207703_10078216 3300026035 Bacteria 2747
319 Ga0207703_10259588 3300026035 Bacteria 1570
320 Ga0207708_10002261 3300026075 Bacteria 14190
321 Ga0207708_10019115 3300026075 Bacteria 5159
322 Ga0207708_10362178 3300026075 Bacteria 1192
323 Ga0207641_11798759 3300026088 Bacteria 614
324 Ga0207648_10021992 3300026089 Bacteria 5728
325 Ga0207648_10042151 3300026089 Bacteria 4007
326 Ga0207648_10070534 3300026089 Bacteria 3046
327 Ga0207648_10133986 3300026089 Bacteria 2181
328 Ga0207648_10475908 3300026089 Bacteria 1140
329 Ga0207648_11039448 3300026089 Bacteria 768
330 Ga0207648_11156465 3300026089 Bacteria 726
331 Ga0207676_10012248 3300026095 Bacteria 6138
332 Ga0207676_10060107 3300026095 Bacteria 3004
333 Ga0207676_10254217 3300026095 Bacteria 1583
334 Ga0207674_10314649 3300026116 Bacteria 1515
335 Ga0207674_10727247 3300026116 Bacteria 958
336 Ga0207675_100006704 3300026118 Bacteria 10888
337 Ga0207675_100124722 3300026118 Bacteria 2439
338 Ga0207675_100584378 3300026118 Bacteria 1119
339 Ga0207675_100755474 3300026118 Bacteria 984
340 Ga0207683_10004066 3300026121 Bacteria 12643
341 Ga0207683_10934559 3300026121 Bacteria 805
342 Ga0207698_10381487 3300026142 Bacteria 1341
343 Ga0207428_10041127 3300027907 Bacteria 3744
344 Ga0207428_10080677 3300027907 Bacteria 2541
345 Ga0268266_10024744 3300028379 Bacteria 5108
346 Ga0268266_10554504 3300028379 Bacteria 1101
347 Ga0268265_10025476 3300028380 Bacteria 4199
348 Ga0268265_10040865 3300028380 Bacteria 3427
349 Ga0268265_11339616 3300028380 Bacteria 717
350 Ga0268264_10016333 3300028381 Bacteria 6079
351 Ga0268264_10290576 3300028381 Bacteria 1535
352 Ga0268264_10350087 3300028381 Bacteria 1406
353 Ga0268264_11008951 3300028381 Bacteria 839
354 Ga0268264_11160664 3300028381 Bacteria 781
355 Ga0307513_10259139 3300031456 Bacteria 1530
356 Ga0265314_10057116 3300031711 Bacteria 2683
357 Ga0307406_11500285 3300031901 Bacteria 593
358 Ga0307416_100827362 3300032002 Bacteria 1023
359 Ga0373929_0171349 3300035085 Bacteria 594
360 Ga0373934_0181436 3300035086 Bacteria 865
361 Ga0373949_0022228 3300035090 Bacteria 1461
362 Ga0373923_0165106 3300035111 Bacteria 1012
363 Ga0373953_0220845 3300035117 Bacteria 821
364 Ga0373956_0230601 3300035119 Bacteria 879
365 Ga0373943_0096899 3300035170 Bacteria 1536
366 Ga0373943_0266916 3300035170 Bacteria 965
367 Ga0373935_1503801 3300035692 Bacteria 504
368 Ga0373933_0275951 3300035724 Bacteria 1086
369 Ga0373937_0058188 3300036401 Bacteria 3551
370 Ga0373937_0106502 3300036401 Bacteria 2606
371 Ga0373937_0250461 3300036401 Bacteria 1670
372 Ga0373937_0829650 3300036401 Bacteria 873
373 Ga0373925_0140558 3300037068 Bacteria 1889
374 Ga0373925_0364472 3300037068 Bacteria 1175
375 Ga0395900_1408337 3300037418 Bacteria 610
376 Ga0450914_002121 3300042118 Bacteria 1371
377 Ga0439464_0098650 3300042439 Bacteria 886
378 Ga0466963_0039627 3300044694 Bacteria 3086
379 Ga0451576_1623756 3300045051 Bacteria 670
380 Ga0466967_0810608 3300045976 Bacteria 930
381 Ga0495603_0413025 3300046455 Bacteria 773
382 Ga0495629_0130335 3300046459 Bacteria 1752
383 Ga0495580_0185712 3300046472 Bacteria 1435
384 Ga0495582_0098878 3300046473 Bacteria 1633
385 Ga0495582_0534981 3300046473 Bacteria 678
386 Ga0495664_0240120 3300046477 Bacteria 1096
387 Ga0495608_0024773 3300046511 Bacteria 4100
388 Ga0495618_0340300 3300046514 Bacteria 926
389 Ga0495628_0075376 3300046516 Bacteria 2627
390 Ga0495630_0054723 3300046517 Bacteria 2989
391 Ga0495652_0027677 3300046529 Bacteria 4994
392 Ga0495640_0532171 3300046533 Bacteria 713
393 Ga0495586_0086906 3300046535 Bacteria 1724
394 Ga0495587_0022964 3300046536 Bacteria 3836
395 Ga0495645_0000774 3300046543 Bacteria 21888
396 Ga0495667_0885357 3300046559 Bacteria 548
397 Ga0495599_0076799 3300046678 Bacteria 2086
398 Ga0495599_0245874 3300046678 Bacteria 1090
399 Ga0495599_0554516 3300046678 Bacteria 673
400 Ga0495647_0063037 3300046681 Bacteria 1467
401 Ga0495658_0032840 3300046683 Bacteria 2837
402 Ga0495658_0039085 3300046683 Bacteria 2631
403 Ga0495658_0055416 3300046683 Bacteria 2258
404 Ga0495658_0885415 3300046683 Bacteria 571
405 Ga0495613_0000598 3300046689 Bacteria 29033
406 Ga0495600_0472484 3300046809 Bacteria 773
407 Ga0495604_0126383 3300047317 Bacteria 1843
408 Ga0495674_0009694 3300047319 Bacteria 9141
409 Ga0495684_0003405 3300047471 Bacteria 12475
410 Ga0495602_0464011 3300048088 Bacteria 892
411 Ga0496104_0061606 3300048907 Bacteria 3557
412 Ga0496104_0111251 3300048907 Bacteria 2626
413 Ga0496104_0546279 3300048907 Bacteria 1069
414 Ga0496108_0024360 3300048911 Bacteria 4982
415 Ga0496108_0145251 3300048911 Bacteria 2045
416 Ga0496109_0540007 3300048912 Bacteria 1100
417 Ga0496109_1429943 3300048912 Bacteria 627
418 Ga0496112_0010301 3300048915 Bacteria 8476
419 Ga0496112_0112829 3300048915 Bacteria 2689
420 Ga0496112_1478899 3300048915 Bacteria 593
421 Ga0496113_0501856 3300048916 Bacteria 974
422 Ga0496113_1000750 3300048916 Bacteria 658
423 Ga0496114_0178677 3300048917 Bacteria 1852
424 Ga0501034_0012433 3300049571 Bacteria 8792
425 Ga0501034_0116093 3300049571 Bacteria 2665
426 Ga0501043_1007130 3300049579 Bacteria 593
427 Ga0501047_0020449 3300049581 Bacteria 6356
428 Ga0501047_0182591 3300049581 Bacteria 1964
429 Ga0501048_0788548 3300049582 Bacteria 683
430 Ga0501070_0361345 3300049586 Bacteria 1178
431 Ga0501073_0538720 3300049589 Bacteria 807
432 Ga0501074_0375928 3300049590 Bacteria 1008
433 Ga0501035_0915907 3300049822 Bacteria 694
434 Ga0501044_0001483 3300049823 Bacteria 27518
435 nmdc:mga05p37_31370_c1 3300050507 Bacteria 6490
436 nmdc:mga05p37_35786_c1 3300050507 Bacteria 6090
437 nmdc:mga0qj67_1190232_c1 3300050509 Bacteria 593
438 nmdc:mga06r32_994089_c1 3300050510 Bacteria 792
439 nmdc:mga08y16_34482_c1 3300050511 Bacteria 5316
440 nmdc:mga08y16_8409_c1 3300050511 Bacteria 10800
441 nmdc:mga0n895_1210852_c1 3300050512 Bacteria 729
442 nmdc:mga0n895_24897_c1 3300050512 Bacteria 5648
443 nmdc:mga0n895_34876_c1 3300050512 Bacteria 4846
444 nmdc:mga0n895_358701_c1 3300050512 Bacteria 1476
445 nmdc:mga0n895_482432_c1 3300050512 Bacteria 1250
446 nmdc:mga0n895_536935_c1 3300050512 Bacteria 1176
447 nmdc:mga0n895_614460_c1 3300050512 Bacteria 1088
448 nmdc:mga0rr50_2152_c1 3300050513 Bacteria 11013
449 nmdc:mga0rr50_279686_c1 3300050513 Bacteria 1392
450 nmdc:mga0rr50_663786_c1 3300050513 Bacteria 890
451 nmdc:mga0rr50_72094_c1 3300050513 Bacteria 2637
452 nmdc:mga08x19_17333_c1 3300050514 Bacteria 4405
453 nmdc:mga08x19_191542_c1 3300050514 Bacteria 1399
454 nmdc:mga08x19_24590_c1 3300050514 Bacteria 3746
455 nmdc:mga08x19_321936_c1 3300050514 Bacteria 1076
456 nmdc:mga0a205_103981_c1 3300050515 Bacteria 2739
457 nmdc:mga0a205_342277_c1 3300050515 Bacteria 1364
458 Ga0495601_0010674 3300053077 Bacteria 5476
459 Ga0495595_0037794 3300053084 Bacteria 2197
460 Ga0495595_0094997 3300053084 Bacteria 1434
461 Ga0495595_0459174 3300053084 Bacteria 648
462 Ga0495619_0005032 3300053085 Bacteria 8397
463 Ga0495619_0097026 3300053085 Bacteria 2002
464 Ga0495619_0991027 3300053085 Bacteria 562
465 Ga0501084_0196957 3300054114 Bacteria 1700
466 Ga0501082_0668541 3300060353 Bacteria 909
467 Ga0207685_10505078
468 JGI25406J46586_10107807
469 Ga0065712_10097792
470 Ga0065712_10128600
471 Ga0065712_10192992
472 Ga0065715_10434132
473 Ga0065715_10497681
474 Ga0070676_10685644
475 Ga0070676_11134779
476 Ga0070690_100178185
477 Ga0070690_100401832
478 Ga0070670_100189050
479 Ga0070670_100481916
480 Ga0070670_101959162
481 Ga0070677_10073045
482 Ga0070677_10405148
483 Ga0068869_100433887
484 Ga0068869_101620039
485 Ga0070666_10174094
486 Ga0070666_10525787
487 Ga0070666_10721494
488 Ga0070680_100441536
489 Ga0070682_100626704
490 Ga0068868_100847404
491 Ga0068868_101468664
492 Ga0070660_100465997
493 Ga0070691_10015212
494 Ga0070661_100230999
495 Ga0070668_100020373
496 Ga0070668_100288423
497 Ga0070669_100010731
498 Ga0070669_100035649
499 Ga0070669_100309100
500 Ga0070669_100425933
501 Ga0070675_100185858
502 Ga0070675_100205249
503 Ga0070675_100377300
504 Ga0070675_101412338
505 Ga0070671_100423025
506 Ga0070671_101414434
507 Ga0070674_100002227
508 Ga0070674_100172219
509 Ga0070673_100095246
510 Ga0070673_100542425
511 Ga0070673_100556095
512 Ga0070673_100916877
513 Ga0070688_100727054
514 Ga0070688_100928706
515 Ga0070659_100127995
516 Ga0070667_100103905
517 Ga0070709_10135585
518 Ga0070710_10130467
519 Ga0070701_10216464
520 Ga0070705_100004627
521 Ga0070705_100199777
522 Ga0070700_100671292
523 Ga0070700_100868961
524 Ga0070700_101259852
525 Ga0070700_101507100
526 Ga0070694_101426194
527 Ga0070708_100013026
528 Ga0070678_100007232
529 Ga0070678_100902360
530 Ga0070678_101778385
531 Ga0070662_100443290
532 Ga0070681_10052700
533 Ga0070681_10230240
534 Ga0070681_10382761
535 Ga0068867_100073117
536 Ga0068867_100078665
537 Ga0068867_100236370
538 Ga0068867_100847388
539 Ga0068867_101406891
540 Ga0070685_10517732
541 Ga0070685_10790062
542 Ga0070707_100294798
543 Ga0070698_100431924
544 Ga0070698_101355677
545 Ga0070699_100020173
546 Ga0070699_101358189
547 Ga0070679_100065476
548 Ga0070679_100159168
549 Ga0070679_100297101
550 Ga0070697_100280033
551 Ga0070697_100290942
552 Ga0070697_100444632
553 Ga0070672_100356803
554 Ga0070672_101003894
555 Ga0070686_100042551
556 Ga0070686_100050748
557 Ga0070686_100388149
558 Ga0070686_101143121
559 Ga0070695_100014624
560 Ga0070695_100034842
561 Ga0070695_100250470
562 Ga0070696_100002672
563 Ga0070696_100025274
564 Ga0070696_100039721
565 Ga0070696_100898396
566 Ga0070693_100596609
567 Ga0070665_100014293
568 Ga0070665_100047603
569 Ga0070665_101061329
570 Ga0070704_100020027
571 Ga0070704_100028867
572 Ga0070704_100176247
573 Ga0068855_100010225
574 Ga0068855_100393789
575 Ga0070664_100155770
576 Ga0070664_100672551
577 Ga0068857_100923084
578 Ga0068856_100129088
579 Ga0070702_100002187
580 Ga0070702_100711452
581 Ga0068852_100142993
582 Ga0068852_102186886
583 Ga0068859_100015365
584 Ga0068859_100032919
585 Ga0068859_100142977
586 Ga0068864_100049144
587 Ga0068864_100188712
588 Ga0068864_100565268
589 Ga0068866_10184419
590 Ga0068866_10271402
591 Ga0068866_10282511
592 Ga0068861_100012408
593 Ga0068861_100127355
594 Ga0068861_100197726
595 Ga0068861_100228046
596 Ga0068861_100334957
597 Ga0068861_101762671
598 Ga0068863_100322949
599 Ga0068863_100674640
600 Ga0068863_101079812
601 Ga0068858_100002817
602 Ga0068858_100077308
603 Ga0068858_100244631
604 Ga0068858_100443274
605 Ga0068858_101161356
606 Ga0068860_100045550
607 Ga0068860_100347652
608 Ga0068860_100353643
609 Ga0068860_101056969
610 Ga0068860_101159628
611 Ga0068860_101450424
612 Ga0068862_100278419
613 Ga0068862_100310480
614 Ga0081455_10061181
615 Ga0081539_10011228
616 Ga0070717_11293534
617 Ga0070716_100130499
618 Ga0097621_100034775
619 Ga0097621_100085629
620 Ga0097621_100107178
621 Ga0068871_100002033
622 Ga0068871_100027753
623 Ga0068871_100284321
624 Ga0068871_101168746
625 Ga0075428_100685710
626 Ga0075431_100361078
627 Ga0075431_100528753
628 Ga0075433_10065352
629 Ga0075434_100128631
630 Ga0075434_100130095
631 Ga0075434_100179149
632 Ga0075434_100440603
633 Ga0068865_100007092
634 Ga0068865_100009515
635 Ga0075436_100008238
636 Ga0075436_100063141
637 Ga0075436_100072132
638 Ga0075436_100330694
639 Ga0097620_100015365
640 Ga0097620_100032919
641 Ga0097620_100142977
642 Ga0075435_100030455
643 Ga0075435_100042480
644 Ga0075435_100172998
645 Ga0105251_10120498
646 Ga0111539_10004497
647 Ga0111539_10023807
648 Ga0111539_10121093
649 Ga0105245_10145130
650 Ga0105245_11581115
651 Ga0105247_10041387
652 Ga0114129_10002052
653 Ga0114129_10013715
654 Ga0114129_10028594
655 Ga0114129_10749288
656 Ga0105243_10020463
657 Ga0105243_10057293
658 Ga0105241_10919420
659 Ga0105242_10038413
660 Ga0105242_10217770
661 Ga0105242_10298737
662 Ga0105242_10447106
663 Ga0105242_11204810
664 Ga0105242_11912615
665 Ga0105248_10008235
666 Ga0105248_10019766
667 Ga0105248_10020566
668 Ga0105248_10203359
669 Ga0105248_10227264
670 Ga0105248_10643883
671 Ga0105248_10883400
672 Ga0105248_11004942
673 Ga0105248_11181002
674 Ga0105238_10039703
675 Ga0105249_10105699
676 Ga0105249_11412665
677 Ga0157374_10030919
678 Ga0157374_10174240
679 Ga0157374_11030978
680 Ga0157374_11191972
681 Ga0157374_12083013
682 Ga0157378_10228220
683 Ga0157378_10973595
684 Ga0157378_11421588
685 Ga0163162_10538234
686 Ga0163162_10652866
687 Ga0163162_11420378
688 Ga0157375_10187546
689 Ga0157375_10296921
690 Ga0157375_10901373
691 Ga0157375_12924553
692 Ga0163163_10016066
693 Ga0163163_10075990
694 Ga0163163_10531004
695 Ga0157380_10018135
696 Ga0157380_10176164
697 Ga0157377_11385911
698 Ga0157379_11286073
699 Ga0157379_11580618
700 Ga0157376_10017474
701 Ga0157376_10076972
702 Ga0157376_10242778
703 Ga0157376_10475055
704 Ga0157376_12286512
705 Ga0163161_10251553
706 Ga0206354_10040446
707 Ga0224712_10369556
708 Ga0207697_10044567
709 Ga0207697_10178910
710 Ga0207642_10061929
711 Ga0207710_10140985
712 Ga0207680_10163154
713 Ga0207680_10202895
714 Ga0207680_10676920
715 Ga0207699_10040525
716 Ga0207645_10001664
717 Ga0207645_10026733
718 Ga0207645_10842861
719 Ga0207643_10194566
720 Ga0207707_10022136
721 Ga0207695_10356101
722 Ga0207693_10096895
723 Ga0207660_10119239
724 Ga0207662_10094347
725 Ga0207662_10504584
726 Ga0207657_10001144
727 Ga0207657_10342545
728 Ga0207652_10034382
729 Ga0207652_10053720
730 Ga0207646_10252416
731 Ga0207681_10014520
732 Ga0207681_10016781
733 Ga0207681_10133207
734 Ga0207681_10642757
735 Ga0207681_10854740
736 Ga0207650_11127708
737 Ga0207659_10084090
738 Ga0207659_10236393
739 Ga0207659_10481559
740 Ga0207687_10029667
741 Ga0207644_10119722
742 Ga0207690_10036855
743 Ga0207686_10008087
744 Ga0207686_10010424
745 Ga0207686_10300952
746 Ga0207686_10412558
747 Ga0207686_11240937
748 Ga0207709_10040029
749 Ga0207670_10473592
750 Ga0207669_10011119
751 Ga0207669_10486285
752 Ga0207669_11496961
753 Ga0207704_10010081
754 Ga0207704_10081831
755 Ga0207704_10116658
756 Ga0207704_10842223
757 Ga0207665_10143136
758 Ga0207665_10385346
759 Ga0207691_10026845
760 Ga0207691_10101649
761 Ga0207691_10177523
762 Ga0207691_10890097
763 Ga0207711_10012385
764 Ga0207711_10014207
765 Ga0207711_10115745
766 Ga0207711_10129919
767 Ga0207711_10478263
768 Ga0207711_10821192
769 Ga0207711_11589823
770 Ga0207689_10220342
771 Ga0207689_11040869
772 Ga0207679_10012933
773 Ga0207679_11153752
774 Ga0207651_10337690
775 Ga0207651_10607582
776 Ga0207712_10054617
777 Ga0207712_10407297
778 Ga0207668_10108412
779 Ga0207668_10263610
780 Ga0207668_10358573
781 Ga0207658_11256344
782 Ga0207677_10332487
783 Ga0207703_10039358
784 Ga0207703_10078216
785 Ga0207703_10259588
786 Ga0207708_10002261
787 Ga0207708_10019115
788 Ga0207708_10362178
789 Ga0207641_11798759
790 Ga0207648_10021992
791 Ga0207648_10042151
792 Ga0207648_10070534
793 Ga0207648_10133986
794 Ga0207648_10475908
795 Ga0207648_11039448
796 Ga0207648_11156465
797 Ga0207676_10012248
798 Ga0207676_10060107
799 Ga0207676_10254217
800 Ga0207674_10314649
801 Ga0207674_10727247
802 Ga0207675_100006704
803 Ga0207675_100124722
804 Ga0207675_100584378
805 Ga0207675_100755474
806 Ga0207683_10004066
807 Ga0207683_10934559
808 Ga0207698_10381487
809 Ga0207428_10041127
810 Ga0207428_10080677
811 Ga0268266_10024744
812 Ga0268266_10554504
813 Ga0268265_10025476
814 Ga0268265_10040865
815 Ga0268265_11339616
816 Ga0268264_10016333
817 Ga0268264_10290576
818 Ga0268264_10350087
819 Ga0268264_11008951
820 Ga0268264_11160664
821 Ga0307513_10259139
822 Ga0265314_10057116
823 Ga0307406_11500285
824 Ga0307416_100827362
825 Ga0373929_0171349
826 Ga0373934_0181436
827 Ga0373949_0022228
828 Ga0373923_0165106
829 Ga0373953_0220845
830 Ga0373956_0230601
831 Ga0373943_0096899
832 Ga0373943_0266916
833 Ga0373935_1503801
834 Ga0373933_0275951
835 Ga0373937_0058188
836 Ga0373937_0106502
837 Ga0373937_0250461
838 Ga0373937_0829650
839 Ga0373925_0140558
840 Ga0373925_0364472
841 Ga0395900_1408337
842 Ga0450914_002121
843 Ga0439464_0098650
844 Ga0466963_0039627
845 Ga0451576_1623756
846 Ga0466967_0810608
847 Ga0495603_0413025
848 Ga0495629_0130335
849 Ga0495580_0185712
850 Ga0495582_0098878
851 Ga0495582_0534981
852 Ga0495664_0240120
853 Ga0495608_0024773
854 Ga0495618_0340300
855 Ga0495628_0075376
856 Ga0495630_0054723
857 Ga0495652_0027677
858 Ga0495640_0532171
859 Ga0495586_0086906
860 Ga0495587_0022964
861 Ga0495645_0000774
862 Ga0495667_0885357
863 Ga0495599_0076799
864 Ga0495599_0245874
865 Ga0495599_0554516
866 Ga0495647_0063037
867 Ga0495658_0032840
868 Ga0495658_0039085
869 Ga0495658_0055416
870 Ga0495658_0885415
871 Ga0495613_0000598
872 Ga0495600_0472484
873 Ga0495604_0126383
874 Ga0495674_0009694
875 Ga0495684_0003405
876 Ga0495602_0464011
877 Ga0496104_0061606
878 Ga0496104_0111251
879 Ga0496104_0546279
880 Ga0496108_0024360
881 Ga0496108_0145251
882 Ga0496109_0540007
883 Ga0496109_1429943
884 Ga0496112_0010301
885 Ga0496112_0112829
886 Ga0496112_1478899
887 Ga0496113_0501856
888 Ga0496113_1000750
889 Ga0496114_0178677
890 Ga0501034_0012433
891 Ga0501034_0116093
892 Ga0501043_1007130
893 Ga0501047_0020449
894 Ga0501047_0182591
895 Ga0501048_0788548
896 Ga0501070_0361345
897 Ga0501073_0538720
898 Ga0501074_0375928
899 Ga0501035_0915907
900 Ga0501044_0001483
901 nmdc:mga05p37_31370_c1
902 nmdc:mga05p37_35786_c1
903 nmdc:mga0qj67_1190232_c1
904 nmdc:mga06r32_994089_c1
905 nmdc:mga08y16_34482_c1
906 nmdc:mga08y16_8409_c1
907 nmdc:mga0n895_1210852_c1
908 nmdc:mga0n895_24897_c1
909 nmdc:mga0n895_34876_c1
910 nmdc:mga0n895_358701_c1
911 nmdc:mga0n895_482432_c1
912 nmdc:mga0n895_536935_c1
913 nmdc:mga0n895_614460_c1
914 nmdc:mga0rr50_2152_c1
915 nmdc:mga0rr50_279686_c1
916 nmdc:mga0rr50_663786_c1
917 nmdc:mga0rr50_72094_c1
918 nmdc:mga08x19_17333_c1
919 nmdc:mga08x19_191542_c1
920 nmdc:mga08x19_24590_c1
921 nmdc:mga08x19_321936_c1
922 nmdc:mga0a205_103981_c1
923 nmdc:mga0a205_342277_c1
924 Ga0495601_0010674
925 Ga0495595_0037794
926 Ga0495595_0094997
927 Ga0495595_0459174
928 Ga0495619_0005032
929 Ga0495619_0097026
930 Ga0495619_0991027
931 Ga0501084_0196957
932 Ga0501082_0668541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

21

149

0.9

Map