F449609

General Info

Members Datasets Scaffolds Average Seq Length
466 251 932 406

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10023469|Ga0070666_100234692
Length 438
Sequence MASVDPERLNFHPENREITTVERREFITSAVLAGVASSAADSAVTRRKSERATDDRQYMLDLLVRMARPVLASMSEGKLQAVFKPELSPTWDGRNVKVAYLEGFGRLISGIAPWLALPDDDSTEGKLRAALRQQALASYAHSVDPASPDYLLWREHGQALVDSAYFTNAFLRAPRQLWEPLDATTKKRVIEEIKGLRHVSPPYTNWLLFAAMNEAFLLSIGEQWDPVRIDLAVRKINEWYVGDGWYADGAHFHFDHYGSYVIHPMLVEILEVLLATKATFNSLNAAVLLDQAYKRMQRHGEQLERIIGPEGSYAPIGRSLTYRTAVFQPLGLLAWRKRLPQSLPEGQVRAATVAAQRAIFRFPSNFDDNGFLTLGFTGHQPKLADWYSNGGSMYIAAESLIALGLPAGDSYWTSPPLPWTSKKAFSGEEFPKDYYVEY

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
204 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
207 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
208 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
225 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
226 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
227 2643221556 Massilia sp. Root1485 Isolate Unclassified
228 2643221583 Caulobacter sp. Root655 Isolate Unclassified
229 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
230 2643221638 Duganella sp. Root336D2 Isolate Unclassified
231 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
232 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
233 2643221684 Massilia sp. Root133 Isolate Unclassified
234 2738541297 Duganella sp. GV083 Isolate Unclassified
235 2738541300 Massilia sp. GV016 Isolate Unclassified
236 2738541357 Duganella sp. GV053 Isolate Unclassified
237 2738543003 Duganella sp. GV066 Isolate Unclassified
238 2738543018 Massilia sp. GV045 Isolate Unclassified
239 2738543026 Duganella sp. GV089 Isolate Unclassified
240 2738543029 Duganella sp. GV039 Isolate Unclassified
241 2738543030 Massilia sp. GV097 Isolate Unclassified
242 2739367651 Pedobacter sp. OK291 Isolate Unclassified
243 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
244 2821131069 Duganella sp. 1224 Isolate Unclassified
245 2842711865 Duganella sp. R-73148 Isolate Unclassified
246 2857553236 Duganella sp. R-74557 Isolate Unclassified
247 2857558681 Duganella sp. R-74565 Isolate Unclassified
248 2857564685 Duganella sp. R-74599 Isolate Unclassified
249 2904424332 Duganella sp. 1411 Isolate Rhizosphere
250 2919476304 Duganella sp. 3397 Isolate Unclassified
251 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.99
Metatranscriptomes 0
Isolates 6.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.17
Nodule 0.43
Rhizoplane 1.29
Rhizosphere 70.82
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10023469 3300005335 Bacteria 4015
2 JGI24735J21928_10005526 3300002067 Bacteria 4192
3 JGI25158J39367_1003788 3300002739 Bacteria 2304
4 JGI25152J39213_1000026 3300002773 Bacteria 101759
5 JGI25150J39212_1000702 3300002774 Bacteria 12125
6 JGI25150J39212_1001460 3300002774 Bacteria 6582
7 JGI25153J46596_10004743 3300003215 Bacteria 7244
8 JGI25153J46596_10011212 3300003215 Bacteria 3980
9 rootH1_10011933 3300003316 Bacteria 7632
10 rootL2_10017193 3300003322 Bacteria 7182
11 rootL2_10019745 3300003322 Bacteria 19961
12 rootL2_10075160 3300003322 Bacteria 3111
13 rootL2_10098821 3300003322 Bacteria 4133
14 rootL2_10125882 3300003322 Bacteria 7022
15 rootH1_10053794 3300003323 Unclassified 2035
16 JGI25161J50226_1005860 3300003374 Bacteria 2306
17 Ga0055525_1000047 3300003759 Bacteria 261507
18 Ga0055529_1000076 3300003763 Bacteria 156104
19 Ga0055526_1000119 3300003771 Bacteria 69036
20 Ga0055526_1003278 3300003771 Bacteria 10375
21 Ga0055537_1002239 3300003773 Bacteria 6669
22 Ga0055524_1000335 3300003775 Bacteria 43434
23 Ga0055524_1001522 3300003775 Bacteria 13122
24 Ga0055534_1012976 3300003784 Bacteria 1622
25 Ga0055528_1007250 3300003790 Bacteria 4923
26 Ga0055528_1019235 3300003790 Bacteria 2275
27 Ga0055530_10000040 3300003791 Bacteria 114823
28 Ga0055530_10000058 3300003791 Bacteria 97066
29 Ga0055530_10008189 3300003791 Bacteria 4233
30 Ga0055531_10000009 3300003794 Bacteria 210399
31 Ga0055531_10002854 3300003794 Bacteria 11275
32 Ga0055531_10019342 3300003794 Bacteria 2760
33 Ga0055543_1013003 3300004625 Bacteria 1656
34 Ga0065165_1001320 3300005262 Bacteria 27647
35 Ga0065165_1002801 3300005262 Bacteria 13721
36 Ga0070658_10000542 3300005327 Bacteria 32750
37 Ga0070658_10002213 3300005327 Bacteria 16316
38 Ga0070658_10047605 3300005327 Bacteria 3470
39 Ga0070666_10107880 3300005335 Bacteria 1924
40 Ga0070660_100002228 3300005339 Bacteria 13356
41 Ga0070660_100037955 3300005339 Bacteria 3654
42 Ga0070660_100064769 3300005339 Bacteria 2844
43 Ga0070660_100067425 3300005339 Bacteria 2788
44 Ga0070687_100041977 3300005343 Unclassified 2315
45 Ga0070661_100042667 3300005344 Bacteria 3311
46 Ga0070671_100002504 3300005355 Bacteria 14225
47 Ga0070671_100084986 3300005355 Bacteria 2646
48 Ga0070671_100209784 3300005355 Bacteria 1652
49 Ga0070667_100006938 3300005367 Bacteria 9411
50 Ga0068853_100129008 3300005539 Bacteria 2262
51 Ga0068855_100048712 3300005563 Bacteria 5000
52 Ga0070664_100047317 3300005564 Bacteria 3633
53 Ga0068859_100017013 3300005617 Bacteria 7300
54 Ga0068863_100002917 3300005841 Bacteria 16960
55 Ga0068858_100000776 3300005842 Bacteria 33350
56 Ga0068860_100088371 3300005843 Bacteria 2950
57 Ga0075370_10002628 3300006353 Bacteria 8384
58 Ga0097620_100017013 3300006931 Bacteria 7300
59 Ga0099826_10000001 3300006948 Bacteria 1155201
60 Ga0105244_10000678 3300009036 Bacteria 29866
61 Ga0105244_10007662 3300009036 Bacteria 6841
62 Ga0105250_10020683 3300009092 Bacteria 2658
63 Ga0105240_10003796 3300009093 Bacteria 23330
64 Ga0105240_10039831 3300009093 Bacteria 6015
65 Ga0105245_10032519 3300009098 Bacteria 4618
66 Ga0105247_10007059 3300009101 Bacteria 6908
67 Ga0105243_10178133 3300009148 Bacteria 1847
68 Ga0105248_10054859 3300009177 Bacteria 4470
69 Ga0105237_10076759 3300009545 Bacteria 3331
70 Ga0105238_10109132 3300009551 Bacteria 2748
71 Ga0105238_10119950 3300009551 Bacteria 2610
72 Ga0105238_10249333 3300009551 Bacteria 1753
73 Ga0105249_10334742 3300009553 Bacteria 1529
74 Ga0105239_10018191 3300010375 Bacteria 7769
75 Ga0157373_10094893 3300013100 Bacteria 2100
76 Ga0157370_10000337 3300013104 Bacteria 59072
77 Ga0157370_10057786 3300013104 Bacteria 3687
78 Ga0157369_10217397 3300013105 Bacteria 2001
79 Ga0157369_10276211 3300013105 Bacteria 1750
80 Ga0163162_10036816 3300013306 Bacteria 4880
81 Ga0163162_10321116 3300013306 Bacteria 1681
82 Ga0163163_10044415 3300014325 Bacteria 4359
83 Ga0182006_1000150 3300015261 Bacteria 74692
84 Ga0182005_1000052 3300015265 Bacteria 113532
85 Ga0209436_100211 3300025208 Bacteria 26922
86 Ga0209563_100003 3300025230 Bacteria 1932942
87 Ga0207425_1000017 3300025245 Bacteria 423851
88 Ga0207425_1000085 3300025245 Bacteria 95577
89 Ga0207425_1000458 3300025245 Bacteria 26307
90 Ga0207425_1001670 3300025245 Bacteria 8868
91 Ga0207425_1002668 3300025245 Bacteria 6129
92 Ga0209129_1000162 3300025258 Bacteria 101248
93 Ga0209129_1009136 3300025258 Bacteria 2654
94 Ga0209565_1000030 3300025263 Bacteria 325058
95 Ga0209565_1000452 3300025263 Bacteria 31667
96 Ga0209455_1000073 3300025272 Bacteria 291417
97 Ga0209673_1000768 3300025273 Bacteria 43336
98 Ga0209673_1027933 3300025273 Bacteria 1826
99 Ga0209130_1001638 3300025284 Bacteria 13733
100 Ga0209675_1003386 3300025291 Bacteria 7599
101 Ga0209025_1006702 3300025294 Bacteria 8840
102 Ga0209564_1000038 3300025295 Bacteria 414357
103 Ga0209564_1014461 3300025295 Bacteria 3281
104 Ga0209758_1000250 3300025297 Bacteria 109992
105 Ga0209758_1001927 3300025297 Bacteria 22570
106 Ga0209758_1002585 3300025297 Bacteria 18171
107 Ga0209050_1000014 3300025298 Bacteria 774327
108 Ga0209050_1000612 3300025298 Bacteria 56207
109 Ga0209050_1001648 3300025298 Bacteria 22754
110 Ga0209050_1005502 3300025298 Bacteria 7923
111 Ga0209256_1000046 3300025299 Bacteria 325040
112 Ga0209256_1000285 3300025299 Bacteria 88890
113 Ga0209256_1000503 3300025299 Bacteria 57448
114 Ga0207426_1002708 3300025302 Bacteria 10794
115 Ga0207426_1006100 3300025302 Bacteria 5310
116 Ga0209257_1000019 3300025304 Bacteria 774261
117 Ga0209257_1000123 3300025304 Bacteria 219092
118 Ga0209257_1000533 3300025304 Bacteria 66037
119 Ga0209257_1002302 3300025304 Bacteria 19351
120 Ga0207655_1007633 3300025728 Bacteria 6984
121 Ga0207655_1011178 3300025728 Bacteria 5367
122 Ga0207710_10000118 3300025900 Bacteria 97453
123 Ga0207710_10003225 3300025900 Bacteria 7298
124 Ga0207680_10066273 3300025903 Bacteria 2220
125 Ga0207680_10077791 3300025903 Bacteria 2076
126 Ga0207705_10000044 3300025909 Bacteria 180886
127 Ga0207705_10000520 3300025909 Bacteria 32771
128 Ga0207705_10010729 3300025909 Bacteria 6650
129 Ga0207707_10173096 3300025912 Bacteria 1886
130 Ga0207695_10007280 3300025913 Bacteria 14133
131 Ga0207695_10010625 3300025913 Bacteria 11249
132 Ga0207671_10029296 3300025914 Bacteria 4110
133 Ga0207693_10110323 3300025915 Bacteria 2157
134 Ga0207657_10000253 3300025919 Bacteria 56919
135 Ga0207657_10001066 3300025919 Bacteria 29046
136 Ga0207657_10037726 3300025919 Bacteria 4311
137 Ga0207657_10039722 3300025919 Bacteria 4179
138 Ga0207657_10045461 3300025919 Bacteria 3853
139 Ga0207649_10093591 3300025920 Bacteria 1973
140 Ga0207652_10068875 3300025921 Bacteria 3071
141 Ga0207681_10066112 3300025923 Bacteria 2502
142 Ga0207650_10020247 3300025925 Bacteria 4690
143 Ga0207644_10012849 3300025931 Bacteria 5570
144 Ga0207644_10014711 3300025931 Bacteria 5243
145 Ga0207709_10092215 3300025935 Bacteria 1983
146 Ga0207711_10204047 3300025941 Bacteria 1805
147 Ga0207667_10066480 3300025949 Bacteria 3758
148 Ga0207667_10220476 3300025949 Unclassified 1943
149 Ga0207658_10003686 3300025986 Bacteria 10805
150 Ga0207703_10000495 3300026035 Bacteria 40916
151 Ga0207703_10001175 3300026035 Bacteria 24706
152 Ga0207639_10100685 3300026041 Bacteria 2335
153 Ga0207639_10126520 3300026041 Bacteria 2108
154 Ga0207641_10000734 3300026088 Bacteria 35187
155 Ga0207674_10171100 3300026116 Unclassified 2126
156 Ga0207675_100002257 3300026118 Bacteria 19154
157 Ga0209282_1000001 3300027666 Bacteria 2450367
158 Ga0268264_10000881 3300028381 Bacteria 31651
159 Ga0268264_10026730 3300028381 Bacteria 4716
160 Ga0268264_10069764 3300028381 Bacteria 2973
161 Ga0307408_100000010 3300031548 Bacteria 420048
162 Ga0307408_100000092 3300031548 Bacteria 98953
163 Ga0307408_100000467 3300031548 Bacteria 35394
164 Ga0307408_100001502 3300031548 Bacteria 17318
165 Ga0307408_100035528 3300031548 Bacteria 3498
166 Ga0307408_100041363 3300031548 Bacteria 3267
167 Ga0307508_10001321 3300031616 Bacteria 28091
168 Ga0307518_10049123 3300031838 Bacteria 3067
169 Ga0373951_0001493 3300035091 Bacteria 6104
170 Ga0373939_0000036 3300035114 Bacteria 48825
171 Ga0373960_0003377 3300035121 Bacteria 3611
172 Ga0395899_0000086 3300037312 Bacteria 157725
173 Ga0395899_0011019 3300037312 Bacteria 6925
174 Ga0395899_0044512 3300037312 Bacteria 3307
175 Ga0395899_0054147 3300037312 Bacteria 2969
176 Ga0395899_0073762 3300037312 Bacteria 2494
177 Ga0395900_0000171 3300037418 Bacteria 105316
178 Ga0395900_0003301 3300037418 Bacteria 17459
179 Ga0395900_0019637 3300037418 Bacteria 6890
180 Ga0395900_0044803 3300037418 Bacteria 4557
181 Ga0395900_0083898 3300037418 Bacteria 3273
182 Ga0395900_0106396 3300037418 Bacteria 2881
183 Ga0395900_0121261 3300037418 Bacteria 2682
184 Ga0395900_0186804 3300037418 Bacteria 2103
185 Ga0395900_0543369 3300037418 Bacteria 1107
186 Ga0395898_0009934 3300037466 Bacteria 9967
187 Ga0395898_0039441 3300037466 Bacteria 4674
188 Ga0395898_0083005 3300037466 Bacteria 3088
189 Ga0395898_0150211 3300037466 Bacteria 2229
190 Ga0395905_0000484 3300037471 Bacteria 54907
191 Ga0395905_0036827 3300037471 Bacteria 4594
192 Ga0395905_0089251 3300037471 Bacteria 2889
193 Ga0395905_0181801 3300037471 Bacteria 1974
194 Ga0395901_0000237 3300038443 Bacteria 69208
195 Ga0395901_0030865 3300038443 Bacteria 5523
196 Ga0395901_0076172 3300038443 Bacteria 3499
197 Ga0395901_0146093 3300038443 Bacteria 2485
198 Ga0395901_0155542 3300038443 Bacteria 2401
199 Ga0395901_0186134 3300038443 Bacteria 2178
200 Ga0395901_0194323 3300038443 Bacteria 2128
201 Ga0439461_0001044 3300041410 Bacteria 4182
202 Ga0439465_0000600 3300041413 Bacteria 10901
203 Ga0439465_0001622 3300041413 Bacteria 7323
204 Ga0439431_0000661 3300041997 Bacteria 7335
205 Ga0439431_0007632 3300041997 Bacteria 2415
206 Ga0439442_001798 3300042002 Bacteria 4194
207 Ga0439445_0002379 3300042004 Bacteria 4185
208 Ga0439445_0005222 3300042004 Bacteria 2954
209 Ga0439445_0008704 3300042004 Bacteria 2379
210 Ga0439448_0014312 3300042005 Bacteria 2392
211 Ga0439432_000736 3300042006 Bacteria 12263
212 Ga0439450_001598 3300042008 Bacteria 3358
213 Ga0439452_025127 3300042010 Bacteria 1515
214 Ga0439455_0000587 3300042012 Bacteria 5238
215 Ga0450892_001580 3300042130 Bacteria 2155
216 Ga0439446_0030119 3300042156 Bacteria 1568
217 Ga0439458_0000951 3300042157 Bacteria 7454
218 Ga0439458_0009551 3300042157 Bacteria 2161
219 Ga0439434_0001517 3300042435 Bacteria 6687
220 Ga0466969_0015856 3300044656 Bacteria 3949
221 Ga0466969_0057808 3300044656 Bacteria 1890
222 Ga0466972_0001019 3300044658 Bacteria 13428
223 Ga0466965_0001196 3300044683 Bacteria 10264
224 Ga0466965_0095046 3300044683 Bacteria 1519
225 Ga0466966_0002012 3300044684 Bacteria 13189
226 Ga0466966_0029034 3300044684 Bacteria 3600
227 Ga0466966_0030618 3300044684 Bacteria 3491
228 Ga0466966_0051423 3300044684 Bacteria 2619
229 Ga0466961_0006179 3300044693 Bacteria 7604
230 Ga0466961_0036947 3300044693 Bacteria 3134
231 Ga0466961_0079289 3300044693 Bacteria 2079
232 Ga0466964_0001890 3300044706 Bacteria 7316
233 Ga0466964_0009311 3300044706 Bacteria 3695
234 Ga0466968_0002339 3300044735 Bacteria 6934
235 Ga0466970_0033611 3300044765 Bacteria 2711
236 Ga0466957_0018069 3300044842 Bacteria 4136
237 Ga0466957_0038836 3300044842 Bacteria 2870
238 Ga0466959_0000499 3300045049 Bacteria 22878
239 Ga0466959_0018706 3300045049 Bacteria 5088
240 Ga0466959_0037060 3300045049 Bacteria 3602
241 Ga0466959_0098758 3300045049 Bacteria 2091
242 Ga0466958_0002020 3300045836 Bacteria 10002
243 Ga0466958_0037718 3300045836 Bacteria 2896
244 Ga0466967_0151414 3300045976 Bacteria 2168
245 Ga0495617_000007 3300046452 Bacteria 369986
246 Ga0495627_000006 3300046453 Bacteria 581750
247 Ga0495627_000464 3300046453 Bacteria 35052
248 Ga0495590_0006790 3300046457 Bacteria 4447
249 Ga0495638_0000528 3300046460 Bacteria 44566
250 Ga0495638_0007341 3300046460 Bacteria 7912
251 Ga0495638_0052732 3300046460 Bacteria 2533
252 Ga0495638_0068530 3300046460 Bacteria 2175
253 Ga0495653_0000042 3300046463 Bacteria 117284
254 Ga0495650_0000151 3300046471 Bacteria 157969
255 Ga0495650_0000579 3300046471 Bacteria 51254
256 Ga0495580_0143871 3300046472 Bacteria 1652
257 Ga0495582_0002554 3300046473 Bacteria 10127
258 Ga0495605_0000015 3300046474 Bacteria 300227
259 Ga0495605_0010560 3300046474 Bacteria 5165
260 Ga0495605_0073705 3300046474 Bacteria 1607
261 Ga0495584_0000107 3300046491 Bacteria 56834
262 Ga0495584_0001510 3300046491 Bacteria 13843
263 Ga0495585_0006849 3300046492 Bacteria 7029
264 Ga0495585_0033572 3300046492 Bacteria 2904
265 Ga0495585_0061999 3300046492 Bacteria 2054
266 Ga0495596_0016605 3300046500 Bacteria 3055
267 Ga0495607_0000964 3300046501 Bacteria 26608
268 Ga0495607_0002653 3300046501 Bacteria 14345
269 Ga0495607_0010550 3300046501 Bacteria 6206
270 Ga0495607_0014928 3300046501 Bacteria 5049
271 Ga0495607_0015141 3300046501 Bacteria 5007
272 Ga0495607_0032322 3300046501 Bacteria 3195
273 Ga0495583_0000074 3300046506 Bacteria 177273
274 Ga0495606_0000290 3300046507 Bacteria 87022
275 Ga0495606_0000331 3300046507 Bacteria 81871
276 Ga0495606_0002968 3300046507 Bacteria 18678
277 Ga0495606_0006957 3300046507 Bacteria 10282
278 Ga0495606_0007099 3300046507 Bacteria 10129
279 Ga0495610_0000004 3300046512 Bacteria 1006135
280 Ga0495610_0000040 3300046512 Bacteria 165165
281 Ga0495610_0001223 3300046512 Bacteria 23116
282 Ga0495610_0007648 3300046512 Bacteria 7143
283 Ga0495610_0008899 3300046512 Bacteria 6428
284 Ga0495610_0040737 3300046512 Bacteria 2338
285 Ga0495616_0000959 3300046513 Bacteria 20691
286 Ga0495616_0003486 3300046513 Bacteria 10062
287 Ga0495630_0018182 3300046517 Bacteria 5161
288 Ga0495631_0002492 3300046518 Bacteria 10363
289 Ga0495632_0000348 3300046519 Bacteria 44014
290 Ga0495632_0002932 3300046519 Bacteria 12513
291 Ga0495637_0000338 3300046520 Bacteria 36248
292 Ga0495643_0000233 3300046522 Bacteria 84175
293 Ga0495643_0000493 3300046522 Bacteria 49721
294 Ga0495643_0099420 3300046522 Bacteria 1492
295 Ga0495644_0002664 3300046523 Bacteria 7096
296 Ga0495644_0015160 3300046523 Bacteria 2952
297 Ga0495644_0016694 3300046523 Bacteria 2809
298 Ga0495648_0001623 3300046524 Bacteria 21830
299 Ga0495648_0012841 3300046524 Bacteria 6219
300 Ga0495648_0091236 3300046524 Bacteria 1705
301 Ga0495642_0000730 3300046528 Bacteria 16340
302 Ga0495642_0004462 3300046528 Bacteria 5430
303 Ga0495642_0008723 3300046528 Bacteria 3874
304 Ga0495642_0018273 3300046528 Bacteria 2744
305 Ga0495642_0020216 3300046528 Bacteria 2614
306 Ga0495652_0041113 3300046529 Bacteria 3992
307 Ga0495654_0000004 3300046530 Bacteria 515304
308 Ga0495654_0018339 3300046530 Bacteria 3669
309 Ga0495640_0131169 3300046533 Bacteria 1622
310 Ga0495609_0000001 3300046538 Bacteria 1060094
311 Ga0495609_0000900 3300046538 Bacteria 21694
312 Ga0495609_0003241 3300046538 Bacteria 9429
313 Ga0495609_0015061 3300046538 Bacteria 3624
314 Ga0495597_0001578 3300046542 Bacteria 16051
315 Ga0495597_0025123 3300046542 Bacteria 2744
316 Ga0495597_0056296 3300046542 Bacteria 1722
317 Ga0495633_0000148 3300046558 Bacteria 93134
318 Ga0495633_0000692 3300046558 Bacteria 30813
319 Ga0495633_0015861 3300046558 Bacteria 3900
320 Ga0495633_0019585 3300046558 Bacteria 3421
321 Ga0495633_0071420 3300046558 Bacteria 1619
322 Ga0495668_0000109 3300046616 Bacteria 132453
323 Ga0495668_0000177 3300046616 Bacteria 94811
324 Ga0495668_0001394 3300046616 Bacteria 23536
325 Ga0495668_0002312 3300046616 Bacteria 15953
326 Ga0495668_0010768 3300046616 Bacteria 5521
327 Ga0495634_0099489 3300046642 Bacteria 1880
328 Ga0495611_0009910 3300046648 Bacteria 4032
329 Ga0495625_0000085 3300046660 Bacteria 151877
330 Ga0495625_0000099 3300046660 Bacteria 140467
331 Ga0495625_0000828 3300046660 Bacteria 42577
332 Ga0495625_0003295 3300046660 Bacteria 16292
333 Ga0495625_0008157 3300046660 Bacteria 8970
334 Ga0495625_0013340 3300046660 Bacteria 6606
335 Ga0495625_0013997 3300046660 Bacteria 6425
336 Ga0495659_0000040 3300046664 Bacteria 59388
337 Ga0495661_0000053 3300046665 Bacteria 140234
338 Ga0495661_0002288 3300046665 Bacteria 14802
339 Ga0495661_0009308 3300046665 Bacteria 6742
340 Ga0495661_0029162 3300046665 Bacteria 3525
341 Ga0495661_0034926 3300046665 Bacteria 3159
342 Ga0495588_0000291 3300046674 Bacteria 36136
343 Ga0495669_0026309 3300046684 Bacteria 2542
344 Ga0495669_0094034 3300046684 Bacteria 1387
345 Ga0495670_0000010 3300046691 Bacteria 174071
346 Ga0495671_0000177 3300046692 Bacteria 56452
347 Ga0495671_0001867 3300046692 Bacteria 13543
348 Ga0495671_0034354 3300046692 Bacteria 2578
349 Ga0495649_0004457 3300046694 Bacteria 9148
350 Ga0495649_0004898 3300046694 Bacteria 8639
351 Ga0495649_0022198 3300046694 Bacteria 3551
352 Ga0495589_0000147 3300046794 Bacteria 65369
353 Ga0495589_0014737 3300046794 Bacteria 4023
354 Ga0495589_0054999 3300046794 Bacteria 1962
355 Ga0495589_0060814 3300046794 Bacteria 1854
356 Ga0495660_0000079 3300046810 Bacteria 104002
357 Ga0495660_0000383 3300046810 Bacteria 38501
358 Ga0495660_0000852 3300046810 Bacteria 22522
359 Ga0495660_0002426 3300046810 Bacteria 11882
360 Ga0495660_0002811 3300046810 Bacteria 10957
361 Ga0495660_0004034 3300046810 Bacteria 8962
362 Ga0495660_0019218 3300046810 Bacteria 3923
363 Ga0495604_0075420 3300047317 Bacteria 2539
364 Ga0495672_0000136 3300047320 Bacteria 108633
365 Ga0495672_0000206 3300047320 Bacteria 84222
366 Ga0495672_0008907 3300047320 Bacteria 7332
367 Ga0495672_0079036 3300047320 Bacteria 1838
368 Ga0495683_0011668 3300047323 Bacteria 4623
369 Ga0495683_0034052 3300047323 Bacteria 2591
370 Ga0495687_000019 3300047443 Bacteria 341756
371 Ga0495687_000036 3300047443 Bacteria 255427
372 Ga0495687_000534 3300047443 Bacteria 45469
373 Ga0495677_0000009 3300047445 Bacteria 170927
374 Ga0495677_0001324 3300047445 Bacteria 9920
375 Ga0495677_0002387 3300047445 Bacteria 7383
376 Ga0495673_0000017 3300047469 Bacteria 574970
377 Ga0495673_0000027 3300047469 Bacteria 475440
378 Ga0495681_0000909 3300047470 Bacteria 22844
379 Ga0495681_0021973 3300047470 Bacteria 3424
380 Ga0495681_0036720 3300047470 Bacteria 2420
381 Ga0495681_0041762 3300047470 Bacteria 2225
382 Ga0495686_0056658 3300047472 Bacteria 2448
383 Ga0495626_0000628 3300048091 Bacteria 34342
384 Ga0495626_0006280 3300048091 Bacteria 6784
385 Ga0495626_0015571 3300048091 Bacteria 3888
386 Ga0496102_0008995 3300048905 Bacteria 8571
387 Ga0496106_0040168 3300048909 Bacteria 3503
388 Ga0496107_0027830 3300048910 Bacteria 4016
389 Ga0496108_0151290 3300048911 Bacteria 2002
390 Ga0496112_0099091 3300048915 Bacteria 2884
391 Ga0496113_0040498 3300048916 Bacteria 3433
392 Ga0496116_0032202 3300048919 Bacteria 3741
393 Ga0496121_0003496 3300048924 Bacteria 22338
394 Ga0496122_0012788 3300048925 Bacteria 8305
395 Ga0496122_0041161 3300048925 Bacteria 3658
396 Ga0496122_0055785 3300048925 Bacteria 2952
397 Ga0496123_0001553 3300048926 Bacteria 31611
398 Ga0496123_0005867 3300048926 Bacteria 12162
399 Ga0496124_0030659 3300048927 Bacteria 4769
400 Ga0496124_0061618 3300048927 Bacteria 3144
401 Ga0496124_0129581 3300048927 Bacteria 2005
402 Ga0496125_0000509 3300048928 Bacteria 67449
403 Ga0496125_0005615 3300048928 Bacteria 13850
404 Ga0496125_0174539 3300048928 Bacteria 1440
405 Ga0496126_0022644 3300048929 Bacteria 6106
406 Ga0496126_0025008 3300048929 Bacteria 5755
407 Ga0495678_000013 3300049459 Bacteria 316375
408 Ga0495678_000339 3300049459 Bacteria 49120
409 Ga0495678_002168 3300049459 Bacteria 13848
410 Ga0495678_012327 3300049459 Bacteria 4056
411 Ga0501222_006490 3300049662 Bacteria 1572
412 Ga0501235_001889 3300049669 Bacteria 4477
413 Ga0501238_000718 3300049671 Bacteria 3708
414 Ga0501221_001701 3300049704 Bacteria 3659
415 Ga0501225_0018072 3300049705 Bacteria 1956
416 Ga0501267_000134 3300049764 Bacteria 4859
417 Ga0501269_000024 3300049766 Bacteria 52180
418 Ga0501279_002785 3300049775 Bacteria 2280
419 Ga0501035_0001643 3300049822 Bacteria 22586
420 Ga0501044_0043331 3300049823 Bacteria 4676
421 nmdc:mga07m45_27253_c1 3300050496 Bacteria 3146
422 nmdc:mga07m45_708_c1 3300050496 Bacteria 14157
423 Ga0500578_0000041 3300053086 Bacteria 129580
424 Ga0500643_026864 3300053087 Bacteria 1796
425 Ga0500646_0036293 3300053090 Unclassified 1373
426 Ga0500583_0000270 3300053092 Bacteria 18403
427 Ga0500583_0012059 3300053092 Bacteria 3282
428 Ga0500583_0059435 3300053092 Bacteria 1800
429 Ga0500556_0021373 3300053104 Bacteria 2086
430 Ga0500594_0000935 3300053118 Bacteria 6271
431 Ga0500618_000915 3300053125 Bacteria 15306
432 Ga0500658_0002720 3300053134 Bacteria 6796
433 Ga0500658_0010095 3300053134 Bacteria 3484
434 Ga0500658_0023869 3300053134 Bacteria 2339
435 Ga0500568_0024167 3300053139 Bacteria 2576
436 Ga0500586_000949 3300053145 Bacteria 5966
437 Ga0500604_0018449 3300053151 Bacteria 1944
438 Ga0500616_0000575 3300053153 Bacteria 44655
439 2586211140 2585427687 Bacteria 5544917
440 2643745032 2643221544 Bacteria 5886209
441 2643789499 2643221554 Bacteria 6603920
442 2643798758 2643221556 Bacteria 7251154
443 2643925504 2643221583 Bacteria 5218014
444 2644128360 2643221622 Bacteria 4212502
445 2644216043 2643221638 Bacteria 6579467
446 2644220784 2643221639 Bacteria 6649903
447 2644256492 2643221646 Bacteria 6433402
448 2644471146 2643221684 Bacteria 7145183
449 2738825472 2738541297 Bacteria 6549566
450 2738842809 2738541300 Bacteria 6675882
451 2739149269 2738541357 Bacteria 6549408
452 2739191188 2738543003 Bacteria 6549560
453 2739273556 2738543018 Bacteria 6718814
454 2739317665 2738543026 Bacteria 6549408
455 2739335906 2738543029 Bacteria 6549249
456 2739342600 2738543030 Bacteria 6719714
457 2739590027 2739367651 Bacteria 6359826
458 2809145703 2808606418 Bacteria 6724496
459 2821134068 2821131069 Bacteria 6108407
460 2842711881 2842711865 Bacteria 7155354
461 2857556531 2857553236 Bacteria 6166726
462 2857561158 2857558681 Bacteria 6617694
463 2857565882 2857564685 Bacteria 6290584
464 2904429120 2904424332 Bacteria 7633521
465 2919480713 2919476304 Bacteria 5888696
466 8047678325 8047673197 Bacteria 7395230
467 Ga0070666_10023469
468 JGI24735J21928_10005526
469 JGI25158J39367_1003788
470 JGI25152J39213_1000026
471 JGI25150J39212_1000702
472 JGI25150J39212_1001460
473 JGI25153J46596_10004743
474 JGI25153J46596_10011212
475 rootH1_10011933
476 rootL2_10017193
477 rootL2_10019745
478 rootL2_10075160
479 rootL2_10098821
480 rootL2_10125882
481 rootH1_10053794
482 JGI25161J50226_1005860
483 Ga0055525_1000047
484 Ga0055529_1000076
485 Ga0055526_1000119
486 Ga0055526_1003278
487 Ga0055537_1002239
488 Ga0055524_1000335
489 Ga0055524_1001522
490 Ga0055534_1012976
491 Ga0055528_1007250
492 Ga0055528_1019235
493 Ga0055530_10000040
494 Ga0055530_10000058
495 Ga0055530_10008189
496 Ga0055531_10000009
497 Ga0055531_10002854
498 Ga0055531_10019342
499 Ga0055543_1013003
500 Ga0065165_1001320
501 Ga0065165_1002801
502 Ga0070658_10000542
503 Ga0070658_10002213
504 Ga0070658_10047605
505 Ga0070666_10107880
506 Ga0070660_100002228
507 Ga0070660_100037955
508 Ga0070660_100064769
509 Ga0070660_100067425
510 Ga0070687_100041977
511 Ga0070661_100042667
512 Ga0070671_100002504
513 Ga0070671_100084986
514 Ga0070671_100209784
515 Ga0070667_100006938
516 Ga0068853_100129008
517 Ga0068855_100048712
518 Ga0070664_100047317
519 Ga0068859_100017013
520 Ga0068863_100002917
521 Ga0068858_100000776
522 Ga0068860_100088371
523 Ga0075370_10002628
524 Ga0097620_100017013
525 Ga0099826_10000001
526 Ga0105244_10000678
527 Ga0105244_10007662
528 Ga0105250_10020683
529 Ga0105240_10003796
530 Ga0105240_10039831
531 Ga0105245_10032519
532 Ga0105247_10007059
533 Ga0105243_10178133
534 Ga0105248_10054859
535 Ga0105237_10076759
536 Ga0105238_10109132
537 Ga0105238_10119950
538 Ga0105238_10249333
539 Ga0105249_10334742
540 Ga0105239_10018191
541 Ga0157373_10094893
542 Ga0157370_10000337
543 Ga0157370_10057786
544 Ga0157369_10217397
545 Ga0157369_10276211
546 Ga0163162_10036816
547 Ga0163162_10321116
548 Ga0163163_10044415
549 Ga0182006_1000150
550 Ga0182005_1000052
551 Ga0209436_100211
552 Ga0209563_100003
553 Ga0207425_1000017
554 Ga0207425_1000085
555 Ga0207425_1000458
556 Ga0207425_1001670
557 Ga0207425_1002668
558 Ga0209129_1000162
559 Ga0209129_1009136
560 Ga0209565_1000030
561 Ga0209565_1000452
562 Ga0209455_1000073
563 Ga0209673_1000768
564 Ga0209673_1027933
565 Ga0209130_1001638
566 Ga0209675_1003386
567 Ga0209025_1006702
568 Ga0209564_1000038
569 Ga0209564_1014461
570 Ga0209758_1000250
571 Ga0209758_1001927
572 Ga0209758_1002585
573 Ga0209050_1000014
574 Ga0209050_1000612
575 Ga0209050_1001648
576 Ga0209050_1005502
577 Ga0209256_1000046
578 Ga0209256_1000285
579 Ga0209256_1000503
580 Ga0207426_1002708
581 Ga0207426_1006100
582 Ga0209257_1000019
583 Ga0209257_1000123
584 Ga0209257_1000533
585 Ga0209257_1002302
586 Ga0207655_1007633
587 Ga0207655_1011178
588 Ga0207710_10000118
589 Ga0207710_10003225
590 Ga0207680_10066273
591 Ga0207680_10077791
592 Ga0207705_10000044
593 Ga0207705_10000520
594 Ga0207705_10010729
595 Ga0207707_10173096
596 Ga0207695_10007280
597 Ga0207695_10010625
598 Ga0207671_10029296
599 Ga0207693_10110323
600 Ga0207657_10000253
601 Ga0207657_10001066
602 Ga0207657_10037726
603 Ga0207657_10039722
604 Ga0207657_10045461
605 Ga0207649_10093591
606 Ga0207652_10068875
607 Ga0207681_10066112
608 Ga0207650_10020247
609 Ga0207644_10012849
610 Ga0207644_10014711
611 Ga0207709_10092215
612 Ga0207711_10204047
613 Ga0207667_10066480
614 Ga0207667_10220476
615 Ga0207658_10003686
616 Ga0207703_10000495
617 Ga0207703_10001175
618 Ga0207639_10100685
619 Ga0207639_10126520
620 Ga0207641_10000734
621 Ga0207674_10171100
622 Ga0207675_100002257
623 Ga0209282_1000001
624 Ga0268264_10000881
625 Ga0268264_10026730
626 Ga0268264_10069764
627 Ga0307408_100000010
628 Ga0307408_100000092
629 Ga0307408_100000467
630 Ga0307408_100001502
631 Ga0307408_100035528
632 Ga0307408_100041363
633 Ga0307508_10001321
634 Ga0307518_10049123
635 Ga0373951_0001493
636 Ga0373939_0000036
637 Ga0373960_0003377
638 Ga0395899_0000086
639 Ga0395899_0011019
640 Ga0395899_0044512
641 Ga0395899_0054147
642 Ga0395899_0073762
643 Ga0395900_0000171
644 Ga0395900_0003301
645 Ga0395900_0019637
646 Ga0395900_0044803
647 Ga0395900_0083898
648 Ga0395900_0106396
649 Ga0395900_0121261
650 Ga0395900_0186804
651 Ga0395900_0543369
652 Ga0395898_0009934
653 Ga0395898_0039441
654 Ga0395898_0083005
655 Ga0395898_0150211
656 Ga0395905_0000484
657 Ga0395905_0036827
658 Ga0395905_0089251
659 Ga0395905_0181801
660 Ga0395901_0000237
661 Ga0395901_0030865
662 Ga0395901_0076172
663 Ga0395901_0146093
664 Ga0395901_0155542
665 Ga0395901_0186134
666 Ga0395901_0194323
667 Ga0439461_0001044
668 Ga0439465_0000600
669 Ga0439465_0001622
670 Ga0439431_0000661
671 Ga0439431_0007632
672 Ga0439442_001798
673 Ga0439445_0002379
674 Ga0439445_0005222
675 Ga0439445_0008704
676 Ga0439448_0014312
677 Ga0439432_000736
678 Ga0439450_001598
679 Ga0439452_025127
680 Ga0439455_0000587
681 Ga0450892_001580
682 Ga0439446_0030119
683 Ga0439458_0000951
684 Ga0439458_0009551
685 Ga0439434_0001517
686 Ga0466969_0015856
687 Ga0466969_0057808
688 Ga0466972_0001019
689 Ga0466965_0001196
690 Ga0466965_0095046
691 Ga0466966_0002012
692 Ga0466966_0029034
693 Ga0466966_0030618
694 Ga0466966_0051423
695 Ga0466961_0006179
696 Ga0466961_0036947
697 Ga0466961_0079289
698 Ga0466964_0001890
699 Ga0466964_0009311
700 Ga0466968_0002339
701 Ga0466970_0033611
702 Ga0466957_0018069
703 Ga0466957_0038836
704 Ga0466959_0000499
705 Ga0466959_0018706
706 Ga0466959_0037060
707 Ga0466959_0098758
708 Ga0466958_0002020
709 Ga0466958_0037718
710 Ga0466967_0151414
711 Ga0495617_000007
712 Ga0495627_000006
713 Ga0495627_000464
714 Ga0495590_0006790
715 Ga0495638_0000528
716 Ga0495638_0007341
717 Ga0495638_0052732
718 Ga0495638_0068530
719 Ga0495653_0000042
720 Ga0495650_0000151
721 Ga0495650_0000579
722 Ga0495580_0143871
723 Ga0495582_0002554
724 Ga0495605_0000015
725 Ga0495605_0010560
726 Ga0495605_0073705
727 Ga0495584_0000107
728 Ga0495584_0001510
729 Ga0495585_0006849
730 Ga0495585_0033572
731 Ga0495585_0061999
732 Ga0495596_0016605
733 Ga0495607_0000964
734 Ga0495607_0002653
735 Ga0495607_0010550
736 Ga0495607_0014928
737 Ga0495607_0015141
738 Ga0495607_0032322
739 Ga0495583_0000074
740 Ga0495606_0000290
741 Ga0495606_0000331
742 Ga0495606_0002968
743 Ga0495606_0006957
744 Ga0495606_0007099
745 Ga0495610_0000004
746 Ga0495610_0000040
747 Ga0495610_0001223
748 Ga0495610_0007648
749 Ga0495610_0008899
750 Ga0495610_0040737
751 Ga0495616_0000959
752 Ga0495616_0003486
753 Ga0495630_0018182
754 Ga0495631_0002492
755 Ga0495632_0000348
756 Ga0495632_0002932
757 Ga0495637_0000338
758 Ga0495643_0000233
759 Ga0495643_0000493
760 Ga0495643_0099420
761 Ga0495644_0002664
762 Ga0495644_0015160
763 Ga0495644_0016694
764 Ga0495648_0001623
765 Ga0495648_0012841
766 Ga0495648_0091236
767 Ga0495642_0000730
768 Ga0495642_0004462
769 Ga0495642_0008723
770 Ga0495642_0018273
771 Ga0495642_0020216
772 Ga0495652_0041113
773 Ga0495654_0000004
774 Ga0495654_0018339
775 Ga0495640_0131169
776 Ga0495609_0000001
777 Ga0495609_0000900
778 Ga0495609_0003241
779 Ga0495609_0015061
780 Ga0495597_0001578
781 Ga0495597_0025123
782 Ga0495597_0056296
783 Ga0495633_0000148
784 Ga0495633_0000692
785 Ga0495633_0015861
786 Ga0495633_0019585
787 Ga0495633_0071420
788 Ga0495668_0000109
789 Ga0495668_0000177
790 Ga0495668_0001394
791 Ga0495668_0002312
792 Ga0495668_0010768
793 Ga0495634_0099489
794 Ga0495611_0009910
795 Ga0495625_0000085
796 Ga0495625_0000099
797 Ga0495625_0000828
798 Ga0495625_0003295
799 Ga0495625_0008157
800 Ga0495625_0013340
801 Ga0495625_0013997
802 Ga0495659_0000040
803 Ga0495661_0000053
804 Ga0495661_0002288
805 Ga0495661_0009308
806 Ga0495661_0029162
807 Ga0495661_0034926
808 Ga0495588_0000291
809 Ga0495669_0026309
810 Ga0495669_0094034
811 Ga0495670_0000010
812 Ga0495671_0000177
813 Ga0495671_0001867
814 Ga0495671_0034354
815 Ga0495649_0004457
816 Ga0495649_0004898
817 Ga0495649_0022198
818 Ga0495589_0000147
819 Ga0495589_0014737
820 Ga0495589_0054999
821 Ga0495589_0060814
822 Ga0495660_0000079
823 Ga0495660_0000383
824 Ga0495660_0000852
825 Ga0495660_0002426
826 Ga0495660_0002811
827 Ga0495660_0004034
828 Ga0495660_0019218
829 Ga0495604_0075420
830 Ga0495672_0000136
831 Ga0495672_0000206
832 Ga0495672_0008907
833 Ga0495672_0079036
834 Ga0495683_0011668
835 Ga0495683_0034052
836 Ga0495687_000019
837 Ga0495687_000036
838 Ga0495687_000534
839 Ga0495677_0000009
840 Ga0495677_0001324
841 Ga0495677_0002387
842 Ga0495673_0000017
843 Ga0495673_0000027
844 Ga0495681_0000909
845 Ga0495681_0021973
846 Ga0495681_0036720
847 Ga0495681_0041762
848 Ga0495686_0056658
849 Ga0495626_0000628
850 Ga0495626_0006280
851 Ga0495626_0015571
852 Ga0496102_0008995
853 Ga0496106_0040168
854 Ga0496107_0027830
855 Ga0496108_0151290
856 Ga0496112_0099091
857 Ga0496113_0040498
858 Ga0496116_0032202
859 Ga0496121_0003496
860 Ga0496122_0012788
861 Ga0496122_0041161
862 Ga0496122_0055785
863 Ga0496123_0001553
864 Ga0496123_0005867
865 Ga0496124_0030659
866 Ga0496124_0061618
867 Ga0496124_0129581
868 Ga0496125_0000509
869 Ga0496125_0005615
870 Ga0496125_0174539
871 Ga0496126_0022644
872 Ga0496126_0025008
873 Ga0495678_000013
874 Ga0495678_000339
875 Ga0495678_002168
876 Ga0495678_012327
877 Ga0501222_006490
878 Ga0501235_001889
879 Ga0501238_000718
880 Ga0501221_001701
881 Ga0501225_0018072
882 Ga0501267_000134
883 Ga0501269_000024
884 Ga0501279_002785
885 Ga0501035_0001643
886 Ga0501044_0043331
887 nmdc:mga07m45_27253_c1
888 nmdc:mga07m45_708_c1
889 Ga0500578_0000041
890 Ga0500643_026864
891 Ga0500646_0036293
892 Ga0500583_0000270
893 Ga0500583_0012059
894 Ga0500583_0059435
895 Ga0500556_0021373
896 Ga0500594_0000935
897 Ga0500618_000915
898 Ga0500658_0002720
899 Ga0500658_0010095
900 Ga0500658_0023869
901 Ga0500568_0024167
902 Ga0500586_000949
903 Ga0500604_0018449
904 Ga0500616_0000575
905 2586211140
906 2643745032
907 2643789499
908 2643798758
909 2643925504
910 2644128360
911 2644216043
912 2644220784
913 2644256492
914 2644471146
915 2738825472
916 2738842809
917 2739149269
918 2739191188
919 2739273556
920 2739317665
921 2739335906
922 2739342600
923 2739590027
924 2809145703
925 2821134068
926 2842711881
927 2857556531
928 2857561158
929 2857565882
930 2904429120
931 2919480713
932 8047678325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10022

DUF2264

Uncharacterized protein conserved in bacteria (DUF2264)

55

419

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4epz-assembly1.cif.gz_A crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution 0.6259 63 239
4epz-assembly1.cif.gz_A crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution 0.5814 63 239
7qbg-assembly1.cif.gz_A tc:cd320 in complex with nanobody tc-nb4 0.5278 19 381
7qbf-assembly1.cif.gz_A tc:cd320 in complex with nanobody tc-nb34 0.5252 19 381
2v3p-assembly1.cif.gz_A crystallographic analysis of beta-axial ligand substitutions in cobalamin bound to transcobalamin 0.5195 20 381
ID Description Score Start End Superfamily
af_Q10JA2_55_173_1.50.10.130 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Terpene synthase, N-terminal domain 0.598 122 254 1.50.10.130
af_A0A1D6K5Q3_21_180_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.5943 146 266 1.10.600.10
af_Q10JA2_55_173_1.50.10.130 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Terpene synthase, N-terminal domain 0.5401 122 254 1.50.10.130
af_Q9C8E3_83_283_1.50.10.130 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Terpene synthase, N-terminal domain 0.5165 116 332 1.50.10.130
af_Q9R0D6_26_324_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5085 20 381 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A258BDQ0-F1-model_v4 DUF2264 domain-containing protein 0.9928 16 162
AF-A0A6N9LXZ4-F1-model_v4 deleted 0.9692 17 107
AF-A0A2V8G2G5-F1-model_v4 DUF2264 domain-containing protein 0.967 16 156
AF-F4QI99-F1-model_v4 DUF2264 domain-containing protein 0.9598 17 400
AF-A0A520I9B2-F1-model_v4 DUF2264 domain-containing protein 0.9584 33 400

Map