F449526

General Info

Members Datasets Scaffolds Average Seq Length
465 239 930 190

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0136951|Ga0451577_0136951_1154_1699
Length 181
Sequence MSDTGKIGGTRVYHGRIISVDLDEVRFPDGSTGTLEMIRHPGASAVVPLLGDPEDDPEVLLIRQYRYAADQFLYEIPAGRLDPGETPADCARRELQEETGFTAERVEHVFTMYTTPGFTDEKIHLFVATGLVAGQAHREADEFMELVPTRLSRALSMVEQGEIQDAKTALALLYAAGFRLN

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 16.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0136951 3300042876 Bacteria 2199
2 MBSR1b_contig_9394580 2162886012 Bacteria 3302
3 Ga0065712_10090966 3300005290 Bacteria 2387
4 Ga0065715_10088915 3300005293 Bacteria 33623
5 Ga0070676_10036910 3300005328 Bacteria 2816
6 Ga0070676_10103247 3300005328 Bacteria 1764
7 Ga0070683_100000181 3300005329 Bacteria 41826
8 Ga0070683_100000227 3300005329 Bacteria 38287
9 Ga0070683_100000723 3300005329 Bacteria 24116
10 Ga0070683_100005528 3300005329 Bacteria 10561
11 Ga0070683_100065582 3300005329 Bacteria 3381
12 Ga0070683_100655108 3300005329 Unclassified 1005
13 Ga0070690_100011790 3300005330 Bacteria 5126
14 Ga0070690_100046937 3300005330 Bacteria 2747
15 Ga0070670_100394003 3300005331 Bacteria 1222
16 Ga0070677_10210345 3300005333 Unclassified 944
17 Ga0068869_100015033 3300005334 Bacteria 5180
18 Ga0068869_100099875 3300005334 Bacteria 2194
19 Ga0068869_100588934 3300005334 Bacteria 938
20 Ga0070666_10239855 3300005335 Bacteria 1282
21 Ga0070680_100002031 3300005336 Bacteria 14942
22 Ga0070680_100004011 3300005336 Bacteria 11015
23 Ga0070680_100013299 3300005336 Bacteria 6409
24 Ga0070680_100015639 3300005336 Bacteria 5953
25 Ga0070680_100045090 3300005336 Bacteria 3584
26 Ga0070680_100051547 3300005336 Bacteria 3358
27 Ga0070680_100057918 3300005336 Bacteria 3168
28 Ga0070680_100091705 3300005336 Unclassified 2515
29 Ga0070682_100000782 3300005337 Bacteria 18711
30 Ga0070682_100001912 3300005337 Bacteria 11621
31 Ga0070682_100002193 3300005337 Bacteria 10825
32 Ga0070682_100564978 3300005337 Bacteria 892
33 Ga0068868_100142350 3300005338 Unclassified 1970
34 Ga0070660_100014200 3300005339 Bacteria 5735
35 Ga0070691_10000043 3300005341 Bacteria 36106
36 Ga0070661_100001591 3300005344 Bacteria 15748
37 Ga0070661_100005117 3300005344 Bacteria 9039
38 Ga0070661_100620027 3300005344 Bacteria 876
39 Ga0070692_10003884 3300005345 Bacteria 6157
40 Ga0070668_100179788 3300005347 Bacteria 1727
41 Ga0070668_100443653 3300005347 Unclassified 1114
42 Ga0070675_100025470 3300005354 Bacteria 4742
43 Ga0070675_100131540 3300005354 Bacteria 2133
44 Ga0070671_100238342 3300005355 Unclassified 1544
45 Ga0070674_100021392 3300005356 Unclassified 4152
46 Ga0070674_100183464 3300005356 Bacteria 1605
47 Ga0070673_100049641 3300005364 Bacteria 3277
48 Ga0070673_100312916 3300005364 Bacteria 1385
49 Ga0070673_100378299 3300005364 Bacteria 1262
50 Ga0070688_100021571 3300005365 Bacteria 3763
51 Ga0070659_100005420 3300005366 Bacteria 9160
52 Ga0070659_100088750 3300005366 Bacteria 2476
53 Ga0070667_100074667 3300005367 Bacteria 2893
54 Ga0070703_10203377 3300005406 Unclassified 778
55 Ga0070709_10018593 3300005434 Bacteria 4004
56 Ga0070709_10543823 3300005434 Unclassified 888
57 Ga0070713_100000919 3300005436 Bacteria 18801
58 Ga0070713_100461954 3300005436 Bacteria 1194
59 Ga0070713_100903918 3300005436 Bacteria 849
60 Ga0070711_100066222 3300005439 Bacteria 2530
61 Ga0070700_100033599 3300005441 Bacteria 3090
62 Ga0070700_100297719 3300005441 Unclassified 1176
63 Ga0070694_100137593 3300005444 Bacteria 1771
64 Ga0070708_100000019 3300005445 Bacteria 118191
65 Ga0070708_100729295 3300005445 Unclassified 932
66 Ga0070678_100434997 3300005456 Unclassified 1146
67 Ga0070662_100566940 3300005457 Unclassified 953
68 Ga0070681_10001894 3300005458 Bacteria 18882
69 Ga0070681_10007231 3300005458 Bacteria 10833
70 Ga0070681_10027879 3300005458 Bacteria 5678
71 Ga0070681_10029721 3300005458 Bacteria 5486
72 Ga0070681_10032114 3300005458 Bacteria 5269
73 Ga0070681_10109103 3300005458 Bacteria 2708
74 Ga0068867_100111065 3300005459 Bacteria 2106
75 Ga0068867_100137173 3300005459 Bacteria 1908
76 Ga0070685_10009954 3300005466 Bacteria 4932
77 Ga0070706_100406633 3300005467 Unclassified 1267
78 Ga0070706_100597821 3300005467 Unclassified 1025
79 Ga0070707_100008838 3300005468 Bacteria 9342
80 Ga0070707_100041274 3300005468 Bacteria 4416
81 Ga0070698_100038747 3300005471 Bacteria 4911
82 Ga0070699_100158801 3300005518 Bacteria 2001
83 Ga0070679_100002307 3300005530 Bacteria 17261
84 Ga0070679_100006582 3300005530 Bacteria 10825
85 Ga0070679_100015328 3300005530 Bacteria 7364
86 Ga0070679_100052350 3300005530 Bacteria 4067
87 Ga0070684_100001356 3300005535 Bacteria 17552
88 Ga0070684_100005352 3300005535 Bacteria 9834
89 Ga0070684_100017762 3300005535 Bacteria 5847
90 Ga0070684_100039744 3300005535 Bacteria 4048
91 Ga0070684_100048597 3300005535 Bacteria 3680
92 Ga0070684_100273595 3300005535 Bacteria 1546
93 Ga0070684_100529857 3300005535 Bacteria 1092
94 Ga0070697_100317222 3300005536 Bacteria 1342
95 Ga0068853_100045049 3300005539 Bacteria 3778
96 Ga0068853_100368023 3300005539 Bacteria 1340
97 Ga0068853_100676447 3300005539 Unclassified 983
98 Ga0070672_100306927 3300005543 Unclassified 1346
99 Ga0070686_100041793 3300005544 Bacteria 2868
100 Ga0070695_100000337 3300005545 Bacteria 24136
101 Ga0070695_100056920 3300005545 Bacteria 2525
102 Ga0070696_100000415 3300005546 Bacteria 26640
103 Ga0070696_100110619 3300005546 Bacteria 1978
104 Ga0070693_100030367 3300005547 Bacteria 2954
105 Ga0070665_100436084 3300005548 Bacteria 1319
106 Ga0070704_100071904 3300005549 Bacteria 2515
107 Ga0070704_100132357 3300005549 Bacteria 1935
108 Ga0070704_100532181 3300005549 Unclassified 1024
109 Ga0068855_100000270 3300005563 Bacteria 64486
110 Ga0068855_100015718 3300005563 Bacteria 9105
111 Ga0068855_100115007 3300005563 Bacteria 3084
112 Ga0070664_100008072 3300005564 Bacteria 8507
113 Ga0070664_100010565 3300005564 Bacteria 7484
114 Ga0070664_100021482 3300005564 Bacteria 5320
115 Ga0070664_100022216 3300005564 Bacteria 5233
116 Ga0070664_100090592 3300005564 Bacteria 2647
117 Ga0070664_100348212 3300005564 Bacteria 1347
118 Ga0070664_100408416 3300005564 Bacteria 1242
119 Ga0068857_100002034 3300005577 Bacteria 16387
120 Ga0068857_100004177 3300005577 Bacteria 12159
121 Ga0068857_100042903 3300005577 Bacteria 4012
122 Ga0068854_100182026 3300005578 Unclassified 1642
123 Ga0070702_100183090 3300005615 Unclassified 1372
124 Ga0068852_100005928 3300005616 Bacteria 8787
125 Ga0068852_100758112 3300005616 Bacteria 983
126 Ga0068859_100021018 3300005617 Bacteria 6551
127 Ga0068859_100319474 3300005617 Bacteria 1647
128 Ga0068864_100126148 3300005618 Bacteria 2294
129 Ga0068861_100070899 3300005719 Bacteria 2700
130 Ga0068861_100118905 3300005719 Bacteria 2129
131 Ga0068851_10109218 3300005834 Bacteria 1475
132 Ga0068863_100081548 3300005841 Unclassified 3065
133 Ga0068863_100782761 3300005841 Unclassified 951
134 Ga0081455_10211508 3300005937 Bacteria 1444
135 Ga0070712_100617628 3300006175 Bacteria 919
136 Ga0097621_100484243 3300006237 Bacteria 1119
137 Ga0097621_100556134 3300006237 Unclassified 1045
138 Ga0068871_100023526 3300006358 Bacteria 4769
139 Ga0068871_100463991 3300006358 Unclassified 1137
140 Ga0075430_100082070 3300006846 Bacteria 2701
141 Ga0075431_100016527 3300006847 Bacteria 7490
142 Ga0075431_101198701 3300006847 Bacteria 722
143 Ga0075434_100028490 3300006871 Bacteria 5487
144 Ga0075429_100013774 3300006880 Bacteria 7012
145 Ga0075429_101054535 3300006880 Bacteria 710
146 Ga0068865_100453971 3300006881 Unclassified 1060
147 Ga0075436_100009987 3300006914 Bacteria 6494
148 Ga0075436_100222060 3300006914 Bacteria 1341
149 Ga0097620_100021018 3300006931 Bacteria 6551
150 Ga0097620_100319489 3300006931 Bacteria 1647
151 Ga0075435_100010133 3300007076 Bacteria 6883
152 Ga0075435_100465005 3300007076 Bacteria 1091
153 Ga0099795_10032043 3300007788 Unclassified 1815
154 Ga0105240_10029025 3300009093 Bacteria 7214
155 Ga0105240_10070119 3300009093 Bacteria 4337
156 Ga0105245_10037490 3300009098 Bacteria 4310
157 Ga0105245_10166211 3300009098 Bacteria 2097
158 Ga0105245_10480496 3300009098 Bacteria 1256
159 Ga0114129_10036687 3300009147 Bacteria 6921
160 Ga0105241_10479423 3300009174 Bacteria 1105
161 Ga0105241_11456456 3300009174 Unclassified 657
162 Ga0105248_10032399 3300009177 Bacteria 5841
163 Ga0105237_10197524 3300009545 Bacteria 2011
164 Ga0105237_10631849 3300009545 Bacteria 1078
165 Ga0105238_10039247 3300009551 Bacteria 4801
166 Ga0105238_10199593 3300009551 Bacteria 1976
167 Ga0099796_10020353 3300010159 Unclassified 2027
168 Ga0157373_10044303 3300013100 Unclassified 3177
169 Ga0157373_10048372 3300013100 Bacteria 3032
170 Ga0157373_10166712 3300013100 Bacteria 1550
171 Ga0157370_10000273 3300013104 Bacteria 65419
172 Ga0157370_10004034 3300013104 Bacteria 17061
173 Ga0157370_10030522 3300013104 Bacteria 5281
174 Ga0157369_10015816 3300013105 Bacteria 8499
175 Ga0157369_10031954 3300013105 Bacteria 5791
176 Ga0157374_10591987 3300013296 Bacteria 1119
177 Ga0157378_10024468 3300013297 Bacteria 5314
178 Ga0157378_10136196 3300013297 Bacteria 2277
179 Ga0157378_10491968 3300013297 Bacteria 1224
180 Ga0157378_10608761 3300013297 Bacteria 1104
181 Ga0157378_10679007 3300013297 Unclassified 1048
182 Ga0163162_10590617 3300013306 Unclassified 1237
183 Ga0157372_10000141 3300013307 Bacteria 79227
184 Ga0157372_10003112 3300013307 Bacteria 17887
185 Ga0157372_10008809 3300013307 Bacteria 10716
186 Ga0157372_10780682 3300013307 Bacteria 1110
187 Ga0157375_10004907 3300013308 Bacteria 11629
188 Ga0157375_10024051 3300013308 Bacteria 5632
189 Ga0163163_10676678 3300014325 Unclassified 1095
190 Ga0157376_10075896 3300014969 Bacteria 2870
191 Ga0157376_10272655 3300014969 Bacteria 1590
192 Ga0207656_10008585 3300025321 Bacteria 3765
193 Ga0207653_10160488 3300025885 Unclassified 832
194 Ga0207692_10564218 3300025898 Unclassified 729
195 Ga0207642_10081283 3300025899 Bacteria 1574
196 Ga0207699_10252825 3300025906 Unclassified 1215
197 Ga0207645_10045108 3300025907 Bacteria 2818
198 Ga0207645_10058470 3300025907 Bacteria 2461
199 Ga0207684_10053698 3300025910 Bacteria 3419
200 Ga0207684_10351985 3300025910 Unclassified 1268
201 Ga0207707_10000149 3300025912 Bacteria 72889
202 Ga0207707_10002009 3300025912 Bacteria 18470
203 Ga0207707_10005774 3300025912 Bacteria 10818
204 Ga0207707_10015654 3300025912 Bacteria 6606
205 Ga0207707_10030176 3300025912 Bacteria 4742
206 Ga0207707_10117691 3300025912 Bacteria 2323
207 Ga0207695_10001133 3300025913 Bacteria 46228
208 Ga0207695_10081969 3300025913 Bacteria 3263
209 Ga0207671_10368540 3300025914 Bacteria 1140
210 Ga0207663_10035859 3300025916 Unclassified 2980
211 Ga0207660_10000133 3300025917 Bacteria 43926
212 Ga0207660_10003369 3300025917 Bacteria 10422
213 Ga0207660_10023849 3300025917 Bacteria 4136
214 Ga0207660_10585782 3300025917 Bacteria 908
215 Ga0207662_10022744 3300025918 Bacteria 3597
216 Ga0207657_10059282 3300025919 Bacteria 3290
217 Ga0207649_10007407 3300025920 Bacteria 5972
218 Ga0207649_10080994 3300025920 Bacteria 2101
219 Ga0207652_10003581 3300025921 Bacteria 12813
220 Ga0207652_10008360 3300025921 Bacteria 8325
221 Ga0207652_10009323 3300025921 Bacteria 7892
222 Ga0207652_10269869 3300025921 Bacteria 1535
223 Ga0207652_10343511 3300025921 Bacteria 1347
224 Ga0207646_10000912 3300025922 Bacteria 38082
225 Ga0207646_10039267 3300025922 Bacteria 4260
226 Ga0207694_10022274 3300025924 Bacteria 4805
227 Ga0207694_10195859 3300025924 Bacteria 1643
228 Ga0207694_10567172 3300025924 Bacteria 954
229 Ga0207650_10198231 3300025925 Bacteria 1607
230 Ga0207650_10345310 3300025925 Unclassified 1223
231 Ga0207659_10165704 3300025926 Unclassified 1739
232 Ga0207687_10103745 3300025927 Bacteria 2097
233 Ga0207687_10113126 3300025927 Unclassified 2018
234 Ga0207687_10121123 3300025927 Bacteria 1957
235 Ga0207700_10004497 3300025928 Bacteria 8234
236 Ga0207690_10025828 3300025932 Bacteria 3693
237 Ga0207690_10062311 3300025932 Bacteria 2538
238 Ga0207706_10508091 3300025933 Bacteria 1040
239 Ga0207686_10016141 3300025934 Bacteria 4186
240 Ga0207686_10053100 3300025934 Bacteria 2532
241 Ga0207686_10276241 3300025934 Bacteria 1238
242 Ga0207670_10170258 3300025936 Bacteria 1632
243 Ga0207669_10062839 3300025937 Bacteria 2289
244 Ga0207704_10009708 3300025938 Bacteria 4658
245 Ga0207704_10201313 3300025938 Bacteria 1457
246 Ga0207691_10045387 3300025940 Bacteria 4040
247 Ga0207689_10021060 3300025942 Bacteria 5480
248 Ga0207689_10295126 3300025942 Bacteria 1343
249 Ga0207661_10000088 3300025944 Bacteria 63097
250 Ga0207661_10013146 3300025944 Bacteria 6042
251 Ga0207661_10017538 3300025944 Bacteria 5300
252 Ga0207661_10049050 3300025944 Bacteria 3359
253 Ga0207661_10075575 3300025944 Bacteria 2765
254 Ga0207661_10146542 3300025944 Bacteria 2037
255 Ga0207661_10185467 3300025944 Bacteria 1820
256 Ga0207661_10377062 3300025944 Bacteria 1283
257 Ga0207679_10001396 3300025945 Bacteria 15222
258 Ga0207679_10012642 3300025945 Bacteria 5511
259 Ga0207679_10047636 3300025945 Bacteria 3115
260 Ga0207667_10002751 3300025949 Bacteria 21737
261 Ga0207667_10033502 3300025949 Bacteria 5522
262 Ga0207667_10050889 3300025949 Bacteria 4370
263 Ga0207667_10281814 3300025949 Bacteria 1698
264 Ga0207667_10728214 3300025949 Unclassified 993
265 Ga0207651_10133599 3300025960 Bacteria 1904
266 Ga0207651_10271392 3300025960 Bacteria 1397
267 Ga0207668_10024405 3300025972 Bacteria 3901
268 Ga0207658_10073346 3300025986 Bacteria 2598
269 Ga0207639_10032776 3300026041 Bacteria 3827
270 Ga0207639_10516070 3300026041 Bacteria 1094
271 Ga0207702_10008413 3300026078 Bacteria 8704
272 Ga0207641_10058489 3300026088 Bacteria 3281
273 Ga0207648_10069163 3300026089 Bacteria 3076
274 Ga0207676_10402747 3300026095 Bacteria 1279
275 Ga0207674_10011442 3300026116 Bacteria 9971
276 Ga0207683_10461752 3300026121 Bacteria 1171
277 Ga0207698_10035060 3300026142 Unclassified 3666
278 Ga0207698_10567999 3300026142 Bacteria 1114
279 Ga0209969_1007970 3300027360 Bacteria 1499
280 Ga0209967_1004196 3300027364 Bacteria 1908
281 Ga0209996_1010045 3300027395 Bacteria 1252
282 Ga0210000_1006038 3300027462 Bacteria 1764
283 Ga0209995_1015733 3300027471 Bacteria 1240
284 Ga0209968_1000389 3300027526 Bacteria 7167
285 Ga0209999_1002057 3300027543 Bacteria 3516
286 Ga0209983_1004174 3300027665 Bacteria 3046
287 Ga0209998_10058620 3300027717 Unclassified 903
288 Ga0268264_10400172 3300028381 Unclassified 1319
289 Ga0307413_10079479 3300031824 Bacteria 2096
290 Ga0307410_10002122 3300031852 Bacteria 9421
291 Ga0307406_10017911 3300031901 Bacteria 4132
292 Ga0307406_10926614 3300031901 Unclassified 743
293 Ga0307409_100440099 3300031995 Bacteria 1255
294 Ga0307416_100016746 3300032002 Bacteria 5106
295 Ga0307416_101327111 3300032002 Bacteria 825
296 Ga0307411_10030320 3300032005 Bacteria 3313
297 Ga0373934_0001077 3300035086 Bacteria 9874
298 Ga0373934_0020276 3300035086 Bacteria 2554
299 Ga0373923_0195837 3300035111 Bacteria 933
300 Ga0373936_0090875 3300035113 Unclassified 1280
301 Ga0373953_0091709 3300035117 Bacteria 1271
302 Ga0373953_0301352 3300035117 Bacteria 699
303 Ga0373954_0068631 3300035118 Bacteria 1682
304 Ga0373956_0024174 3300035119 Unclassified 2615
305 Ga0373957_0001161 3300035120 Bacteria 7002
306 Ga0373957_0075975 3300035120 Bacteria 1320
307 Ga0373943_0352587 3300035170 Unclassified 843
308 Ga0373943_0453371 3300035170 Bacteria 745
309 Ga0373946_0143715 3300035171 Bacteria 1108
310 Ga0373955_0001671 3300035172 Bacteria 9483
311 Ga0373955_0167137 3300035172 Bacteria 1300
312 Ga0373961_0027931 3300035241 Bacteria 1553
313 Ga0373924_0125343 3300035410 Unclassified 1116
314 Ga0373927_0029265 3300035695 Bacteria 3589
315 Ga0373927_0125409 3300035695 Bacteria 1676
316 Ga0373927_0418485 3300035695 Unclassified 884
317 Ga0373933_0003593 3300035724 Bacteria 8614
318 Ga0373933_0100610 3300035724 Bacteria 1793
319 Ga0373947_0081127 3300035725 Bacteria 2008
320 Ga0373937_0000100 3300036401 Bacteria 81162
321 Ga0373937_0006279 3300036401 Bacteria 10248
322 Ga0373937_0036999 3300036401 Bacteria 4448
323 Ga0373937_0049728 3300036401 Bacteria 3838
324 Ga0373937_0572933 3300036401 Bacteria 1072
325 Ga0373925_0055159 3300037068 Bacteria 2974
326 Ga0373925_0057915 3300037068 Bacteria 2904
327 Ga0453683_0748117 3300044673 Unclassified 642
328 Ga0466967_0015069 3300045976 Bacteria 6049
329 Ga0495592_0084720 3300046454 Bacteria 2286
330 Ga0495592_0155670 3300046454 Bacteria 1577
331 Ga0495603_0018267 3300046455 Bacteria 4242
332 Ga0495629_0114828 3300046459 Bacteria 1876
333 Ga0495651_0043768 3300046462 Bacteria 3472
334 Ga0495651_0055555 3300046462 Bacteria 3042
335 Ga0495651_0111667 3300046462 Bacteria 2020
336 Ga0495653_0013018 3300046463 Bacteria 6786
337 Ga0495653_0027217 3300046463 Bacteria 4577
338 Ga0495653_0186854 3300046463 Bacteria 1417
339 Ga0495580_0079399 3300046472 Unclassified 2288
340 Ga0495582_0069958 3300046473 Bacteria 1941
341 Ga0495582_0278226 3300046473 Unclassified 961
342 Ga0495639_0004821 3300046475 Bacteria 5794
343 Ga0495639_0059274 3300046475 Unclassified 1752
344 Ga0495662_0004851 3300046476 Bacteria 6737
345 Ga0495662_0026133 3300046476 Bacteria 2820
346 Ga0495664_0038300 3300046477 Bacteria 2831
347 Ga0495664_0280414 3300046477 Unclassified 1007
348 Ga0495664_0281490 3300046477 Bacteria 1005
349 Ga0495594_0018764 3300046499 Bacteria 3668
350 Ga0495594_0025389 3300046499 Bacteria 3185
351 Ga0495594_0068205 3300046499 Unclassified 1975
352 Ga0495594_0142593 3300046499 Unclassified 1359
353 Ga0495608_0020234 3300046511 Bacteria 4574
354 Ga0495608_0037698 3300046511 Bacteria 3250
355 Ga0495608_0041562 3300046511 Bacteria 3076
356 Ga0495618_0001991 3300046514 Bacteria 13397
357 Ga0495628_0004102 3300046516 Bacteria 12961
358 Ga0495628_0005641 3300046516 Bacteria 10955
359 Ga0495628_0062176 3300046516 Bacteria 2927
360 Ga0495630_0018823 3300046517 Bacteria 5075
361 Ga0495630_0041616 3300046517 Bacteria 3431
362 Ga0495630_0045826 3300046517 Bacteria 3268
363 Ga0495652_0013533 3300046529 Bacteria 7341
364 Ga0495652_0057913 3300046529 Bacteria 3284
365 Ga0495652_0073438 3300046529 Bacteria 2848
366 Ga0495652_0076462 3300046529 Bacteria 2777
367 Ga0495652_0082818 3300046529 Unclassified 2642
368 Ga0495665_0002604 3300046531 Bacteria 9729
369 Ga0495665_0031444 3300046531 Bacteria 2841
370 Ga0495665_0103010 3300046531 Bacteria 1498
371 Ga0495640_0066431 3300046533 Bacteria 2432
372 Ga0495640_0139167 3300046533 Bacteria 1565
373 Ga0495586_0005432 3300046535 Bacteria 6816
374 Ga0495586_0016267 3300046535 Unclassified 3957
375 Ga0495586_0016803 3300046535 Bacteria 3894
376 Ga0495586_0154193 3300046535 Bacteria 1293
377 Ga0495587_0010313 3300046536 Bacteria 5953
378 Ga0495587_0013984 3300046536 Bacteria 5039
379 Ga0495587_0044661 3300046536 Bacteria 2635
380 Ga0495587_0106922 3300046536 Bacteria 1609
381 Ga0495587_0210866 3300046536 Bacteria 1097
382 Ga0495645_0004300 3300046543 Bacteria 9733
383 Ga0495645_0011238 3300046543 Bacteria 6295
384 Ga0495645_0064215 3300046543 Bacteria 2657
385 Ga0495645_0065173 3300046543 Bacteria 2635
386 Ga0495645_0115285 3300046543 Unclassified 1898
387 Ga0495667_0007647 3300046559 Bacteria 7331
388 Ga0495667_0009891 3300046559 Bacteria 6458
389 Ga0495667_0054039 3300046559 Bacteria 2644
390 Ga0495667_0652540 3300046559 Unclassified 654
391 Ga0495634_0132882 3300046642 Bacteria 1585
392 Ga0495635_0001727 3300046663 Bacteria 14708
393 Ga0495635_0506734 3300046663 Bacteria 794
394 Ga0495657_0009376 3300046675 Bacteria 7425
395 Ga0495657_0137285 3300046675 Bacteria 1527
396 Ga0495657_0315413 3300046675 Unclassified 930
397 Ga0495599_0003327 3300046678 Bacteria 9383
398 Ga0495599_0009202 3300046678 Bacteria 6029
399 Ga0495599_0028058 3300046678 Bacteria 3527
400 Ga0495599_0052551 3300046678 Bacteria 2552
401 Ga0495599_0268563 3300046678 Bacteria 1035
402 Ga0495623_0023273 3300046679 Bacteria 3998
403 Ga0495623_0023725 3300046679 Bacteria 3957
404 Ga0495623_0241297 3300046679 Unclassified 1020
405 Ga0495646_0036364 3300046680 Unclassified 3051
406 Ga0495646_0050426 3300046680 Bacteria 2523
407 Ga0495646_0056860 3300046680 Bacteria 2344
408 Ga0495647_0013949 3300046681 Bacteria 2794
409 Ga0495658_0270535 3300046683 Unclassified 1071
410 Ga0495613_0072614 3300046689 Bacteria 2508
411 Ga0495613_0855832 3300046689 Unclassified 591
412 Ga0495624_0126488 3300046690 Unclassified 1568
413 Ga0495600_0011925 3300046809 Bacteria 5428
414 Ga0495600_0059461 3300046809 Bacteria 2497
415 Ga0495581_0021909 3300047315 Bacteria 3703
416 Ga0495581_0115343 3300047315 Bacteria 1562
417 Ga0495604_0016288 3300047317 Bacteria 5940
418 Ga0495604_0050238 3300047317 Bacteria 3238
419 Ga0495674_0001358 3300047319 Bacteria 23862
420 Ga0495674_0012140 3300047319 Bacteria 8118
421 Ga0495674_0297899 3300047319 Bacteria 1318
422 Ga0495680_0016397 3300047322 Bacteria 6366
423 Ga0495680_0019575 3300047322 Bacteria 5710
424 Ga0495675_0004685 3300047444 Bacteria 8310
425 Ga0495675_0018630 3300047444 Bacteria 4407
426 Ga0495675_0025027 3300047444 Bacteria 3807
427 Ga0495675_0026529 3300047444 Bacteria 3694
428 Ga0495675_0300461 3300047444 Bacteria 953
429 Ga0495684_0000933 3300047471 Bacteria 23728
430 Ga0495684_0035659 3300047471 Bacteria 3813
431 Ga0495684_0057172 3300047471 Bacteria 2973
432 Ga0495684_0065806 3300047471 Bacteria 2755
433 Ga0495684_0416346 3300047471 Unclassified 940
434 Ga0495593_0019264 3300047673 Bacteria 3826
435 Ga0495593_0161529 3300047673 Unclassified 1131
436 Ga0495602_0019077 3300048088 Bacteria 6821
437 Ga0495602_0224273 3300048088 Unclassified 1416
438 Ga0495602_0499843 3300048088 Unclassified 850
439 Ga0496100_0127467 3300048903 Bacteria 1788
440 Ga0496101_0260638 3300048904 Bacteria 1352
441 Ga0496104_0890137 3300048907 Unclassified 795
442 Ga0496112_0162663 3300048915 Bacteria 2198
443 Ga0496115_0098168 3300048918 Bacteria 2398
444 Ga0501031_0330673 3300049568 Unclassified 987
445 Ga0501031_0424711 3300049568 Bacteria 859
446 Ga0501034_1191168 3300049571 Bacteria 641
447 Ga0501036_0055297 3300049572 Bacteria 3362
448 Ga0501040_0019904 3300049576 Bacteria 4467
449 Ga0501046_0123665 3300049580 Bacteria 1967
450 Ga0501047_0038783 3300049581 Bacteria 4609
451 Ga0501048_0151233 3300049582 Bacteria 1642
452 Ga0501070_0089082 3300049586 Unclassified 2554
453 Ga0501072_0105829 3300049588 Bacteria 2237
454 Ga0501073_0114837 3300049589 Unclassified 1866
455 Ga0501075_0007115 3300049591 Bacteria 7740
456 Ga0501079_0002609 3300049741 Bacteria 13100
457 Ga0501080_0046447 3300049742 Bacteria 4043
458 Ga0501045_0031491 3300049824 Bacteria 3841
459 nmdc:mga0rr50_105927_c1 3300050513 Bacteria 2218
460 Ga0495601_0684060 3300053077 Unclassified 655
461 Ga0495612_0052487 3300053078 Bacteria 1677
462 Ga0495619_0117139 3300053085 Bacteria 1824
463 Ga0495619_0187921 3300053085 Unclassified 1430
464 Ga0495619_0282881 3300053085 Bacteria 1149
465 Ga0501084_0022075 3300054114 Bacteria 5309
466 Ga0451577_0136951
467 MBSR1b_contig_9394580
468 Ga0065712_10090966
469 Ga0065715_10088915
470 Ga0070676_10036910
471 Ga0070676_10103247
472 Ga0070683_100000181
473 Ga0070683_100000227
474 Ga0070683_100000723
475 Ga0070683_100005528
476 Ga0070683_100065582
477 Ga0070683_100655108
478 Ga0070690_100011790
479 Ga0070690_100046937
480 Ga0070670_100394003
481 Ga0070677_10210345
482 Ga0068869_100015033
483 Ga0068869_100099875
484 Ga0068869_100588934
485 Ga0070666_10239855
486 Ga0070680_100002031
487 Ga0070680_100004011
488 Ga0070680_100013299
489 Ga0070680_100015639
490 Ga0070680_100045090
491 Ga0070680_100051547
492 Ga0070680_100057918
493 Ga0070680_100091705
494 Ga0070682_100000782
495 Ga0070682_100001912
496 Ga0070682_100002193
497 Ga0070682_100564978
498 Ga0068868_100142350
499 Ga0070660_100014200
500 Ga0070691_10000043
501 Ga0070661_100001591
502 Ga0070661_100005117
503 Ga0070661_100620027
504 Ga0070692_10003884
505 Ga0070668_100179788
506 Ga0070668_100443653
507 Ga0070675_100025470
508 Ga0070675_100131540
509 Ga0070671_100238342
510 Ga0070674_100021392
511 Ga0070674_100183464
512 Ga0070673_100049641
513 Ga0070673_100312916
514 Ga0070673_100378299
515 Ga0070688_100021571
516 Ga0070659_100005420
517 Ga0070659_100088750
518 Ga0070667_100074667
519 Ga0070703_10203377
520 Ga0070709_10018593
521 Ga0070709_10543823
522 Ga0070713_100000919
523 Ga0070713_100461954
524 Ga0070713_100903918
525 Ga0070711_100066222
526 Ga0070700_100033599
527 Ga0070700_100297719
528 Ga0070694_100137593
529 Ga0070708_100000019
530 Ga0070708_100729295
531 Ga0070678_100434997
532 Ga0070662_100566940
533 Ga0070681_10001894
534 Ga0070681_10007231
535 Ga0070681_10027879
536 Ga0070681_10029721
537 Ga0070681_10032114
538 Ga0070681_10109103
539 Ga0068867_100111065
540 Ga0068867_100137173
541 Ga0070685_10009954
542 Ga0070706_100406633
543 Ga0070706_100597821
544 Ga0070707_100008838
545 Ga0070707_100041274
546 Ga0070698_100038747
547 Ga0070699_100158801
548 Ga0070679_100002307
549 Ga0070679_100006582
550 Ga0070679_100015328
551 Ga0070679_100052350
552 Ga0070684_100001356
553 Ga0070684_100005352
554 Ga0070684_100017762
555 Ga0070684_100039744
556 Ga0070684_100048597
557 Ga0070684_100273595
558 Ga0070684_100529857
559 Ga0070697_100317222
560 Ga0068853_100045049
561 Ga0068853_100368023
562 Ga0068853_100676447
563 Ga0070672_100306927
564 Ga0070686_100041793
565 Ga0070695_100000337
566 Ga0070695_100056920
567 Ga0070696_100000415
568 Ga0070696_100110619
569 Ga0070693_100030367
570 Ga0070665_100436084
571 Ga0070704_100071904
572 Ga0070704_100132357
573 Ga0070704_100532181
574 Ga0068855_100000270
575 Ga0068855_100015718
576 Ga0068855_100115007
577 Ga0070664_100008072
578 Ga0070664_100010565
579 Ga0070664_100021482
580 Ga0070664_100022216
581 Ga0070664_100090592
582 Ga0070664_100348212
583 Ga0070664_100408416
584 Ga0068857_100002034
585 Ga0068857_100004177
586 Ga0068857_100042903
587 Ga0068854_100182026
588 Ga0070702_100183090
589 Ga0068852_100005928
590 Ga0068852_100758112
591 Ga0068859_100021018
592 Ga0068859_100319474
593 Ga0068864_100126148
594 Ga0068861_100070899
595 Ga0068861_100118905
596 Ga0068851_10109218
597 Ga0068863_100081548
598 Ga0068863_100782761
599 Ga0081455_10211508
600 Ga0070712_100617628
601 Ga0097621_100484243
602 Ga0097621_100556134
603 Ga0068871_100023526
604 Ga0068871_100463991
605 Ga0075430_100082070
606 Ga0075431_100016527
607 Ga0075431_101198701
608 Ga0075434_100028490
609 Ga0075429_100013774
610 Ga0075429_101054535
611 Ga0068865_100453971
612 Ga0075436_100009987
613 Ga0075436_100222060
614 Ga0097620_100021018
615 Ga0097620_100319489
616 Ga0075435_100010133
617 Ga0075435_100465005
618 Ga0099795_10032043
619 Ga0105240_10029025
620 Ga0105240_10070119
621 Ga0105245_10037490
622 Ga0105245_10166211
623 Ga0105245_10480496
624 Ga0114129_10036687
625 Ga0105241_10479423
626 Ga0105241_11456456
627 Ga0105248_10032399
628 Ga0105237_10197524
629 Ga0105237_10631849
630 Ga0105238_10039247
631 Ga0105238_10199593
632 Ga0099796_10020353
633 Ga0157373_10044303
634 Ga0157373_10048372
635 Ga0157373_10166712
636 Ga0157370_10000273
637 Ga0157370_10004034
638 Ga0157370_10030522
639 Ga0157369_10015816
640 Ga0157369_10031954
641 Ga0157374_10591987
642 Ga0157378_10024468
643 Ga0157378_10136196
644 Ga0157378_10491968
645 Ga0157378_10608761
646 Ga0157378_10679007
647 Ga0163162_10590617
648 Ga0157372_10000141
649 Ga0157372_10003112
650 Ga0157372_10008809
651 Ga0157372_10780682
652 Ga0157375_10004907
653 Ga0157375_10024051
654 Ga0163163_10676678
655 Ga0157376_10075896
656 Ga0157376_10272655
657 Ga0207656_10008585
658 Ga0207653_10160488
659 Ga0207692_10564218
660 Ga0207642_10081283
661 Ga0207699_10252825
662 Ga0207645_10045108
663 Ga0207645_10058470
664 Ga0207684_10053698
665 Ga0207684_10351985
666 Ga0207707_10000149
667 Ga0207707_10002009
668 Ga0207707_10005774
669 Ga0207707_10015654
670 Ga0207707_10030176
671 Ga0207707_10117691
672 Ga0207695_10001133
673 Ga0207695_10081969
674 Ga0207671_10368540
675 Ga0207663_10035859
676 Ga0207660_10000133
677 Ga0207660_10003369
678 Ga0207660_10023849
679 Ga0207660_10585782
680 Ga0207662_10022744
681 Ga0207657_10059282
682 Ga0207649_10007407
683 Ga0207649_10080994
684 Ga0207652_10003581
685 Ga0207652_10008360
686 Ga0207652_10009323
687 Ga0207652_10269869
688 Ga0207652_10343511
689 Ga0207646_10000912
690 Ga0207646_10039267
691 Ga0207694_10022274
692 Ga0207694_10195859
693 Ga0207694_10567172
694 Ga0207650_10198231
695 Ga0207650_10345310
696 Ga0207659_10165704
697 Ga0207687_10103745
698 Ga0207687_10113126
699 Ga0207687_10121123
700 Ga0207700_10004497
701 Ga0207690_10025828
702 Ga0207690_10062311
703 Ga0207706_10508091
704 Ga0207686_10016141
705 Ga0207686_10053100
706 Ga0207686_10276241
707 Ga0207670_10170258
708 Ga0207669_10062839
709 Ga0207704_10009708
710 Ga0207704_10201313
711 Ga0207691_10045387
712 Ga0207689_10021060
713 Ga0207689_10295126
714 Ga0207661_10000088
715 Ga0207661_10013146
716 Ga0207661_10017538
717 Ga0207661_10049050
718 Ga0207661_10075575
719 Ga0207661_10146542
720 Ga0207661_10185467
721 Ga0207661_10377062
722 Ga0207679_10001396
723 Ga0207679_10012642
724 Ga0207679_10047636
725 Ga0207667_10002751
726 Ga0207667_10033502
727 Ga0207667_10050889
728 Ga0207667_10281814
729 Ga0207667_10728214
730 Ga0207651_10133599
731 Ga0207651_10271392
732 Ga0207668_10024405
733 Ga0207658_10073346
734 Ga0207639_10032776
735 Ga0207639_10516070
736 Ga0207702_10008413
737 Ga0207641_10058489
738 Ga0207648_10069163
739 Ga0207676_10402747
740 Ga0207674_10011442
741 Ga0207683_10461752
742 Ga0207698_10035060
743 Ga0207698_10567999
744 Ga0209969_1007970
745 Ga0209967_1004196
746 Ga0209996_1010045
747 Ga0210000_1006038
748 Ga0209995_1015733
749 Ga0209968_1000389
750 Ga0209999_1002057
751 Ga0209983_1004174
752 Ga0209998_10058620
753 Ga0268264_10400172
754 Ga0307413_10079479
755 Ga0307410_10002122
756 Ga0307406_10017911
757 Ga0307406_10926614
758 Ga0307409_100440099
759 Ga0307416_100016746
760 Ga0307416_101327111
761 Ga0307411_10030320
762 Ga0373934_0001077
763 Ga0373934_0020276
764 Ga0373923_0195837
765 Ga0373936_0090875
766 Ga0373953_0091709
767 Ga0373953_0301352
768 Ga0373954_0068631
769 Ga0373956_0024174
770 Ga0373957_0001161
771 Ga0373957_0075975
772 Ga0373943_0352587
773 Ga0373943_0453371
774 Ga0373946_0143715
775 Ga0373955_0001671
776 Ga0373955_0167137
777 Ga0373961_0027931
778 Ga0373924_0125343
779 Ga0373927_0029265
780 Ga0373927_0125409
781 Ga0373927_0418485
782 Ga0373933_0003593
783 Ga0373933_0100610
784 Ga0373947_0081127
785 Ga0373937_0000100
786 Ga0373937_0006279
787 Ga0373937_0036999
788 Ga0373937_0049728
789 Ga0373937_0572933
790 Ga0373925_0055159
791 Ga0373925_0057915
792 Ga0453683_0748117
793 Ga0466967_0015069
794 Ga0495592_0084720
795 Ga0495592_0155670
796 Ga0495603_0018267
797 Ga0495629_0114828
798 Ga0495651_0043768
799 Ga0495651_0055555
800 Ga0495651_0111667
801 Ga0495653_0013018
802 Ga0495653_0027217
803 Ga0495653_0186854
804 Ga0495580_0079399
805 Ga0495582_0069958
806 Ga0495582_0278226
807 Ga0495639_0004821
808 Ga0495639_0059274
809 Ga0495662_0004851
810 Ga0495662_0026133
811 Ga0495664_0038300
812 Ga0495664_0280414
813 Ga0495664_0281490
814 Ga0495594_0018764
815 Ga0495594_0025389
816 Ga0495594_0068205
817 Ga0495594_0142593
818 Ga0495608_0020234
819 Ga0495608_0037698
820 Ga0495608_0041562
821 Ga0495618_0001991
822 Ga0495628_0004102
823 Ga0495628_0005641
824 Ga0495628_0062176
825 Ga0495630_0018823
826 Ga0495630_0041616
827 Ga0495630_0045826
828 Ga0495652_0013533
829 Ga0495652_0057913
830 Ga0495652_0073438
831 Ga0495652_0076462
832 Ga0495652_0082818
833 Ga0495665_0002604
834 Ga0495665_0031444
835 Ga0495665_0103010
836 Ga0495640_0066431
837 Ga0495640_0139167
838 Ga0495586_0005432
839 Ga0495586_0016267
840 Ga0495586_0016803
841 Ga0495586_0154193
842 Ga0495587_0010313
843 Ga0495587_0013984
844 Ga0495587_0044661
845 Ga0495587_0106922
846 Ga0495587_0210866
847 Ga0495645_0004300
848 Ga0495645_0011238
849 Ga0495645_0064215
850 Ga0495645_0065173
851 Ga0495645_0115285
852 Ga0495667_0007647
853 Ga0495667_0009891
854 Ga0495667_0054039
855 Ga0495667_0652540
856 Ga0495634_0132882
857 Ga0495635_0001727
858 Ga0495635_0506734
859 Ga0495657_0009376
860 Ga0495657_0137285
861 Ga0495657_0315413
862 Ga0495599_0003327
863 Ga0495599_0009202
864 Ga0495599_0028058
865 Ga0495599_0052551
866 Ga0495599_0268563
867 Ga0495623_0023273
868 Ga0495623_0023725
869 Ga0495623_0241297
870 Ga0495646_0036364
871 Ga0495646_0050426
872 Ga0495646_0056860
873 Ga0495647_0013949
874 Ga0495658_0270535
875 Ga0495613_0072614
876 Ga0495613_0855832
877 Ga0495624_0126488
878 Ga0495600_0011925
879 Ga0495600_0059461
880 Ga0495581_0021909
881 Ga0495581_0115343
882 Ga0495604_0016288
883 Ga0495604_0050238
884 Ga0495674_0001358
885 Ga0495674_0012140
886 Ga0495674_0297899
887 Ga0495680_0016397
888 Ga0495680_0019575
889 Ga0495675_0004685
890 Ga0495675_0018630
891 Ga0495675_0025027
892 Ga0495675_0026529
893 Ga0495675_0300461
894 Ga0495684_0000933
895 Ga0495684_0035659
896 Ga0495684_0057172
897 Ga0495684_0065806
898 Ga0495684_0416346
899 Ga0495593_0019264
900 Ga0495593_0161529
901 Ga0495602_0019077
902 Ga0495602_0224273
903 Ga0495602_0499843
904 Ga0496100_0127467
905 Ga0496101_0260638
906 Ga0496104_0890137
907 Ga0496112_0162663
908 Ga0496115_0098168
909 Ga0501031_0330673
910 Ga0501031_0424711
911 Ga0501034_1191168
912 Ga0501036_0055297
913 Ga0501040_0019904
914 Ga0501046_0123665
915 Ga0501047_0038783
916 Ga0501048_0151233
917 Ga0501070_0089082
918 Ga0501072_0105829
919 Ga0501073_0114837
920 Ga0501075_0007115
921 Ga0501079_0002609
922 Ga0501080_0046447
923 Ga0501045_0031491
924 nmdc:mga0rr50_105927_c1
925 Ga0495601_0684060
926 Ga0495612_0052487
927 Ga0495619_0117139
928 Ga0495619_0187921
929 Ga0495619_0282881
930 Ga0501084_0022075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

39

169

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9187 9 188
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9169 8 188
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9088 47 185
5i8u-assembly4.cif.gz_F crystal structure of the rv1700 (mt adprase) e142q mutant 0.9033 11 188
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8977 8 188
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9168 8 188 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9088 47 185 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8976 8 188 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8933 9 180 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8687 11 188 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7V9QBL9-F1-model_v4 NUDIX hydrolase 0.9653 9 186 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A7Y4RYF4-F1-model_v4 NUDIX hydrolase 0.9577 43 182 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A847F5V5-F1-model_v4 NUDIX hydrolase 0.9541 14 187 GO:0006753
GO:0016462
GO:0019693
AF-A0A7C3K0D6-F1-model_v4 NUDIX hydrolase 0.9506 14 189 GO:0006753
GO:0016787
GO:0019693
AF-A0A7J2UZN8-F1-model_v4 NUDIX hydrolase 0.9489 68 185 GO:0006753
GO:0016462
GO:0019693

Map