F449390

General Info

Members Datasets Scaffolds Average Seq Length
464 231 392 150

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0000015|Ga0500650_0000015_45006_45497
Length 163
Sequence VTIRIWVLRHGEAERNTGHDPDRALTERGVHHAQAAGAWLATVATSDLRAIASPYLRAQQTAQQVLRSVPNKTLTTVEWLAPDLNPRDVLAELKKIPDREILLVSHQPLVGALVGLLVAADYRAAPPMETAALAELSLSLIAPGMATLMSLRCAPDYNSPVIH

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
4 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
5 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
6 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
7 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
8 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
9 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
10 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
11 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
12 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
13 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
14 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
15 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
16 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
17 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
18 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
19 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
20 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
21 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
22 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
23 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
24 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
25 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
26 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
27 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
28 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
29 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
30 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
31 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
32 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
33 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
34 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
35 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
36 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
37 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
38 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
39 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
40 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
41 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
42 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
43 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
44 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
45 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
46 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
47 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
48 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
49 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
50 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
51 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
52 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
53 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
54 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
55 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
56 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
57 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
58 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
59 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
60 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
61 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
62 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
63 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
64 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
65 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
66 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
141 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
142 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
145 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
146 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
221 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
222 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
223 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
224 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
225 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
226 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
227 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
228 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
229 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
230 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
231 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.48
Metatranscriptomes 0
Isolates 15.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0.43
Rhizoplane 5.6
Rhizosphere 71.12
Stem 0
Stem Tuber 0
Unclassified 17.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6162877 2162886011 Bacteria 2896
2 JGI25155J39150_1003652 3300002704 Bacteria 765
3 Ga0055538_1000058 3300003751 Bacteria 112867
4 Ga0055539_1000087 3300003752 Bacteria 114745
5 Ga0055533_1000097 3300003756 Bacteria 112844
6 Ga0055532_1000156 3300003758 Bacteria 60124
7 Ga0055525_1000219 3300003759 Bacteria 62736
8 Ga0055536_1000686 3300003781 Bacteria 22760
9 Ga0055530_10000992 3300003791 Bacteria 22760
10 Ga0055540_1000708 3300003792 Bacteria 22900
11 Ga0055541_1000060 3300003841 Bacteria 112630
12 Ga0065714_10065444 3300005288 Bacteria 10034
13 Ga0065714_10295436 3300005288 Bacteria 702
14 Ga0065704_10364066 3300005289 Bacteria 793
15 Ga0065704_10456896 3300005289 Bacteria 700
16 Ga0065712_10000132 3300005290 Bacteria 73390
17 Ga0065712_10384886 3300005290 Bacteria 748
18 Ga0070670_100000781 3300005331 Bacteria 24767
19 Ga0070670_100011145 3300005331 Bacteria 7682
20 Ga0070661_100000029 3300005344 Bacteria 117682
21 Ga0070669_100005364 3300005353 Bacteria 9251
22 Ga0070662_100000641 3300005457 Bacteria 21105
23 Ga0068853_100002740 3300005539 Bacteria 13302
24 Ga0070664_100000134 3300005564 Bacteria 49391
25 Ga0068854_100633602 3300005578 Bacteria 916
26 Ga0068851_10000079 3300005834 Bacteria 54347
27 Ga0105251_10000018 3300009011 Bacteria 142493
28 Ga0105251_10001815 3300009011 Bacteria 17660
29 Ga0105251_10002362 3300009011 Bacteria 14924
30 Ga0105251_10002692 3300009011 Bacteria 13653
31 Ga0105251_10027251 3300009011 Bacteria 2900
32 Ga0105244_10000313 3300009036 Bacteria 47052
33 Ga0105244_10001540 3300009036 Bacteria 18350
34 Ga0105244_10001580 3300009036 Bacteria 18096
35 Ga0105244_10004575 3300009036 Bacteria 9475
36 Ga0105244_10299909 3300009036 Bacteria 744
37 Ga0105244_10314930 3300009036 Bacteria 723
38 Ga0105250_10000589 3300009092 Bacteria 23827
39 Ga0105250_10001278 3300009092 Bacteria 13828
40 Ga0105250_10093058 3300009092 Bacteria 1227
41 Ga0105250_10204833 3300009092 Bacteria 833
42 Ga0105250_10414795 3300009092 Bacteria 599
43 Ga0105242_10015589 3300009176 Bacteria 5905
44 Ga0105248_10070057 3300009177 Bacteria 3938
45 Ga0105237_10001936 3300009545 Bacteria 26387
46 Ga0105246_10001200 3300011119 Bacteria 15131
47 Ga0105246_10031156 3300011119 Bacteria 3527
48 Ga0157373_10003186 3300013100 Bacteria 12405
49 Ga0157373_10005314 3300013100 Bacteria 9674
50 Ga0157373_10013659 3300013100 Bacteria 5954
51 Ga0157373_10015184 3300013100 Bacteria 5633
52 Ga0157373_10464525 3300013100 Bacteria 912
53 Ga0157373_11173070 3300013100 Bacteria 578
54 Ga0157371_10002311 3300013102 Bacteria 18345
55 Ga0157371_10409002 3300013102 Bacteria 993
56 Ga0157370_10066536 3300013104 Bacteria 3408
57 Ga0157370_10793339 3300013104 Bacteria 862
58 Ga0157369_10002145 3300013105 Bacteria 23796
59 Ga0157369_10075957 3300013105 Bacteria 3601
60 Ga0157369_10078860 3300013105 Bacteria 3528
61 Ga0163162_10992730 3300013306 Bacteria 949
62 Ga0163162_11295708 3300013306 Bacteria 828
63 Ga0157375_10004371 3300013308 Bacteria 12269
64 Ga0157375_10037680 3300013308 Bacteria 4635
65 Ga0157375_10430080 3300013308 Bacteria 1486
66 Ga0182008_10000788 3300014497 Bacteria 22203
67 Ga0182008_10008364 3300014497 Bacteria 5651
68 Ga0182008_10017991 3300014497 Bacteria 3661
69 Ga0182006_1001654 3300015261 Bacteria 13132
70 Ga0182007_10003352 3300015262 Bacteria 7574
71 Ga0182005_1014317 3300015265 Bacteria 2219
72 Ga0182005_1153663 3300015265 Bacteria 671
73 Ga0163161_10018854 3300017792 Bacteria 4836
74 Ga0163161_10166297 3300017792 Bacteria 1684
75 Ga0163161_10531537 3300017792 Bacteria 961
76 Ga0163161_10685444 3300017792 Bacteria 852
77 Ga0163161_10802161 3300017792 Bacteria 791
78 Ga0163161_11226856 3300017792 Bacteria 649
79 Ga0163161_11855330 3300017792 Bacteria 536
80 Ga0163161_12075191 3300017792 Bacteria 505
81 Ga0209435_107468 3300025206 Bacteria 1210
82 Ga0209784_100040 3300025224 Bacteria 231812
83 Ga0209566_100051 3300025225 Bacteria 231920
84 Ga0209674_100072 3300025226 Bacteria 231812
85 Ga0209147_100067 3300025229 Bacteria 231812
86 Ga0209563_100073 3300025230 Bacteria 231920
87 Ga0209437_101613 3300025233 Bacteria 5184
88 Ga0209258_100392 3300025242 Bacteria 55387
89 Ga0209646_1000216 3300025246 Bacteria 62818
90 Ga0209677_100063 3300025253 Bacteria 151440
91 Ga0209676_1000021 3300025292 Bacteria 609534
92 Ga0209050_1001092 3300025298 Bacteria 32939
93 Ga0209051_1001245 3300025303 Bacteria 22794
94 Ga0209257_1045876 3300025304 Bacteria 1266
95 Ga0207656_10000093 3300025321 Bacteria 33347
96 Ga0207696_1000472 3300025711 Bacteria 34389
97 Ga0207696_1000677 3300025711 Bacteria 23836
98 Ga0207696_1168341 3300025711 Bacteria 581
99 Ga0207655_1001267 3300025728 Bacteria 24116
100 Ga0207655_1002287 3300025728 Bacteria 15757
101 Ga0207655_1005637 3300025728 Bacteria 8466
102 Ga0207655_1106842 3300025728 Bacteria 953
103 Ga0207655_1107937 3300025728 Bacteria 945
104 Ga0207713_1000009 3300025735 Bacteria 551314
105 Ga0207713_1000519 3300025735 Bacteria 38934
106 Ga0207713_1005379 3300025735 Bacteria 8031
107 Ga0207713_1005652 3300025735 Bacteria 7774
108 Ga0207713_1009577 3300025735 Bacteria 5444
109 Ga0207671_10000287 3300025914 Bacteria 74587
110 Ga0207649_10000061 3300025920 Bacteria 98067
111 Ga0207681_10013245 3300025923 Bacteria 5099
112 Ga0207650_10000255 3300025925 Bacteria 57979
113 Ga0207650_10002380 3300025925 Bacteria 13086
114 Ga0207706_10001509 3300025933 Bacteria 23111
115 Ga0207686_10055305 3300025934 Bacteria 2489
116 Ga0207711_10075014 3300025941 Bacteria 2943
117 Ga0207679_10000018 3300025945 Bacteria 238375
118 Ga0207640_11069818 3300025981 Bacteria 712
119 Ga0207639_10002178 3300026041 Bacteria 13189
120 Ga0307509_10374873 3300031507 Bacteria 1138
121 Ga0307408_100002232 3300031548 Bacteria 13824
122 Ga0307405_10003499 3300031731 Bacteria 7226
123 Ga0307405_11063966 3300031731 Bacteria 693
124 Ga0307412_10248354 3300031911 Bacteria 1380
125 Ga0307510_10170671 3300033180 Bacteria 1754
126 Ga0439436_0000375 3300041404 Bacteria 11136
127 Ga0439438_009372 3300041405 Bacteria 3172
128 Ga0439447_002322 3300041407 Bacteria 6956
129 Ga0439447_020927 3300041407 Bacteria 1728
130 Ga0439447_043752 3300041407 Bacteria 1084
131 Ga0439466_0000225 3300041411 Bacteria 22343
132 Ga0439466_0002165 3300041411 Bacteria 7701
133 Ga0439466_0009627 3300041411 Bacteria 3612
134 Ga0451841_1003605 3300041498 Bacteria 689
135 Ga0439432_000267 3300042006 Bacteria 18729
136 Ga0439432_020502 3300042006 Bacteria 2196
137 Ga0439432_056726 3300042006 Bacteria 1213
138 Ga0439451_000418 3300042009 Bacteria 8312
139 Ga0439451_001409 3300042009 Bacteria 4757
140 Ga0439452_002725 3300042010 Bacteria 6408
141 Ga0439452_010164 3300042010 Bacteria 2748
142 Ga0439456_040221 3300042013 Bacteria 1012
143 Ga0439456_130169 3300042013 Bacteria 580
144 Ga0439463_000338 3300042016 Bacteria 13011
145 Ga0439463_001229 3300042016 Bacteria 6845
146 Ga0450911_035191 3300042115 Bacteria 649
147 Ga0450919_005495 3300042121 Bacteria 1520
148 Ga0450922_001189 3300042124 Bacteria 2570
149 Ga0450923_011972 3300042125 Bacteria 1571
150 Ga0450898_046913 3300042134 Bacteria 827
151 Ga0439434_0001227 3300042435 Bacteria 7378
152 Ga0439440_0000391 3300042993 Bacteria 7352
153 Ga0495617_158303 3300046452 Bacteria 718
154 Ga0495627_000058 3300046453 Bacteria 143802
155 Ga0495627_028683 3300046453 Bacteria 1776
156 Ga0495627_075376 3300046453 Bacteria 981
157 Ga0495591_000137 3300046458 Bacteria 79532
158 Ga0495591_000824 3300046458 Bacteria 21960
159 Ga0495591_001788 3300046458 Bacteria 12734
160 Ga0495591_001862 3300046458 Bacteria 12426
161 Ga0495591_002669 3300046458 Bacteria 9710
162 Ga0495591_003901 3300046458 Bacteria 7513
163 Ga0495591_006319 3300046458 Bacteria 5264
164 Ga0495638_0065732 3300046460 Bacteria 2231
165 Ga0495650_0002186 3300046471 Bacteria 16531
166 Ga0495650_0002860 3300046471 Bacteria 13193
167 Ga0495650_0003920 3300046471 Bacteria 10492
168 Ga0495650_0211766 3300046471 Bacteria 670
169 Ga0495650_0254994 3300046471 Bacteria 595
170 Ga0495605_0000026 3300046474 Bacteria 221832
171 Ga0495605_0000414 3300046474 Bacteria 38982
172 Ga0495605_0000837 3300046474 Bacteria 21616
173 Ga0495605_0001441 3300046474 Bacteria 15592
174 Ga0495605_0004376 3300046474 Bacteria 8314
175 Ga0495605_0013346 3300046474 Bacteria 4530
176 Ga0495605_0045094 3300046474 Bacteria 2175
177 Ga0495584_0002445 3300046491 Bacteria 10532
178 Ga0495585_0069412 3300046492 Bacteria 1923
179 Ga0495594_0003875 3300046499 Bacteria 7692
180 Ga0495596_0042763 3300046500 Bacteria 1785
181 Ga0495607_0000206 3300046501 Bacteria 62802
182 Ga0495607_0000606 3300046501 Bacteria 34853
183 Ga0495607_0002972 3300046501 Bacteria 13288
184 Ga0495607_0006057 3300046501 Bacteria 8564
185 Ga0495607_0009779 3300046501 Bacteria 6473
186 Ga0495607_0016128 3300046501 Bacteria 4825
187 Ga0495607_0054831 3300046501 Bacteria 2296
188 Ga0495607_0118243 3300046501 Bacteria 1395
189 Ga0495607_0125590 3300046501 Bacteria 1341
190 Ga0495607_0282999 3300046501 Bacteria 786
191 Ga0495607_0291499 3300046501 Bacteria 771
192 Ga0495583_0000043 3300046506 Bacteria 230804
193 Ga0495583_0000312 3300046506 Bacteria 76605
194 Ga0495583_0002075 3300046506 Bacteria 18101
195 Ga0495583_0004458 3300046506 Bacteria 10016
196 Ga0495583_0004983 3300046506 Bacteria 9211
197 Ga0495583_0007466 3300046506 Bacteria 6856
198 Ga0495583_0008960 3300046506 Bacteria 6035
199 Ga0495606_0000274 3300046507 Bacteria 90529
200 Ga0495606_0000630 3300046507 Bacteria 55478
201 Ga0495606_0017022 3300046507 Bacteria 5512
202 Ga0495606_0037927 3300046507 Bacteria 3267
203 Ga0495606_0050247 3300046507 Bacteria 2729
204 Ga0495606_0160075 3300046507 Bacteria 1314
205 Ga0495610_0007077 3300046512 Bacteria 7572
206 Ga0495610_0017497 3300046512 Bacteria 4083
207 Ga0495610_0030601 3300046512 Bacteria 2818
208 Ga0495610_0051107 3300046512 Bacteria 2013
209 Ga0495610_0067387 3300046512 Bacteria 1682
210 Ga0495610_0132019 3300046512 Bacteria 1083
211 Ga0495610_0153178 3300046512 Bacteria 981
212 Ga0495616_0119572 3300046513 Bacteria 1217
213 Ga0495620_0000263 3300046515 Bacteria 38924
214 Ga0495620_0001658 3300046515 Bacteria 13167
215 Ga0495620_0002574 3300046515 Bacteria 10495
216 Ga0495620_0006084 3300046515 Bacteria 6671
217 Ga0495620_0014928 3300046515 Bacteria 3933
218 Ga0495620_0031687 3300046515 Bacteria 2419
219 Ga0495631_0003286 3300046518 Bacteria 8889
220 Ga0495631_0007638 3300046518 Bacteria 5493
221 Ga0495631_0082892 3300046518 Bacteria 1382
222 Ga0495631_0152820 3300046518 Bacteria 990
223 Ga0495632_0002422 3300046519 Bacteria 14202
224 Ga0495632_0003212 3300046519 Bacteria 11757
225 Ga0495632_0006843 3300046519 Bacteria 7271
226 Ga0495632_0019856 3300046519 Bacteria 3651
227 Ga0495632_0230891 3300046519 Bacteria 834
228 Ga0495632_0291321 3300046519 Bacteria 725
229 Ga0495637_0000174 3300046520 Bacteria 49455
230 Ga0495637_0000201 3300046520 Bacteria 46576
231 Ga0495637_0009932 3300046520 Bacteria 4630
232 Ga0495637_0046515 3300046520 Bacteria 1835
233 Ga0495637_0052822 3300046520 Bacteria 1694
234 Ga0495637_0150957 3300046520 Bacteria 876
235 Ga0495643_0004102 3300046522 Bacteria 10364
236 Ga0495643_0047106 3300046522 Bacteria 2335
237 Ga0495644_0007920 3300046523 Bacteria 4089
238 Ga0495644_0358670 3300046523 Bacteria 574
239 Ga0495648_0004792 3300046524 Bacteria 11436
240 Ga0495648_0005106 3300046524 Bacteria 11012
241 Ga0495648_0077400 3300046524 Bacteria 1906
242 Ga0495648_0283998 3300046524 Bacteria 783
243 Ga0495648_0320657 3300046524 Bacteria 718
244 Ga0495652_0167668 3300046529 Bacteria 1698
245 Ga0495654_0001405 3300046530 Bacteria 16691
246 Ga0495654_0001614 3300046530 Bacteria 15259
247 Ga0495654_0002565 3300046530 Bacteria 11620
248 Ga0495654_0002664 3300046530 Bacteria 11344
249 Ga0495654_0011061 3300046530 Bacteria 4900
250 Ga0495654_0057453 3300046530 Bacteria 1879
251 Ga0495654_0060739 3300046530 Bacteria 1816
252 Ga0495609_0000036 3300046538 Bacteria 186358
253 Ga0495609_0000125 3300046538 Bacteria 83190
254 Ga0495609_0000902 3300046538 Bacteria 21674
255 Ga0495609_0014816 3300046538 Bacteria 3658
256 Ga0495609_0094037 3300046538 Bacteria 1302
257 Ga0495597_0000057 3300046542 Bacteria 93902
258 Ga0495597_0007024 3300046542 Bacteria 5769
259 Ga0495597_0045978 3300046542 Bacteria 1935
260 Ga0495645_0061570 3300046543 Bacteria 2719
261 Ga0495622_0004438 3300046557 Bacteria 6513
262 Ga0495622_0026796 3300046557 Bacteria 2690
263 Ga0495633_0000143 3300046558 Bacteria 95292
264 Ga0495633_0516425 3300046558 Bacteria 538
265 Ga0495668_0013996 3300046616 Bacteria 4716
266 Ga0495668_0049866 3300046616 Bacteria 2321
267 Ga0495611_0001402 3300046648 Bacteria 12025
268 Ga0495611_0001570 3300046648 Bacteria 11197
269 Ga0495611_0008121 3300046648 Bacteria 4452
270 Ga0495611_0180168 3300046648 Bacteria 987
271 Ga0495625_0000070 3300046660 Bacteria 167336
272 Ga0495625_0127820 3300046660 Bacteria 1724
273 Ga0495661_0000042 3300046665 Bacteria 150599
274 Ga0495661_0000121 3300046665 Bacteria 93554
275 Ga0495661_0000278 3300046665 Bacteria 58843
276 Ga0495661_0001018 3300046665 Bacteria 25012
277 Ga0495661_0013072 3300046665 Bacteria 5585
278 Ga0495661_0014822 3300046665 Bacteria 5214
279 Ga0495661_0025384 3300046665 Bacteria 3828
280 Ga0495661_0423215 3300046665 Bacteria 644
281 Ga0495670_0021726 3300046691 Bacteria 3167
282 Ga0495670_0076976 3300046691 Bacteria 1695
283 Ga0495671_0025975 3300046692 Bacteria 3039
284 Ga0495671_0047001 3300046692 Bacteria 2157
285 Ga0495671_0175090 3300046692 Bacteria 1042
286 Ga0495649_0041430 3300046694 Bacteria 2519
287 Ga0495649_0210893 3300046694 Bacteria 1006
288 Ga0495589_0000889 3300046794 Bacteria 18556
289 Ga0495589_0167180 3300046794 Bacteria 1046
290 Ga0495660_0009689 3300046810 Bacteria 5611
291 Ga0495660_0021144 3300046810 Bacteria 3728
292 Ga0495660_0058578 3300046810 Bacteria 2074
293 Ga0495660_0122291 3300046810 Bacteria 1315
294 Ga0495660_0254671 3300046810 Bacteria 813
295 Ga0495672_0019482 3300047320 Bacteria 4472
296 Ga0495672_0029306 3300047320 Bacteria 3469
297 Ga0495672_0057714 3300047320 Bacteria 2253
298 Ga0495676_0000019 3300047321 Bacteria 167261
299 Ga0495683_0000003 3300047323 Bacteria 383992
300 Ga0495683_0026570 3300047323 Bacteria 2962
301 Ga0495679_000119 3300047446 Bacteria 69255
302 Ga0495679_000268 3300047446 Bacteria 43506
303 Ga0495679_003220 3300047446 Bacteria 7932
304 Ga0495679_004437 3300047446 Bacteria 6469
305 Ga0495679_078762 3300047446 Bacteria 939
306 Ga0495673_0002307 3300047469 Bacteria 13645
307 Ga0495673_0002954 3300047469 Bacteria 11466
308 Ga0495673_0004806 3300047469 Bacteria 8360
309 Ga0495673_0009015 3300047469 Bacteria 5546
310 Ga0495673_0022553 3300047469 Bacteria 3081
311 Ga0495673_0023441 3300047469 Bacteria 3001
312 Ga0495673_0028358 3300047469 Bacteria 2652
313 Ga0495673_0224293 3300047469 Bacteria 694
314 Ga0495681_0004669 3300047470 Bacteria 9287
315 Ga0495681_0077709 3300047470 Bacteria 1489
316 Ga0495681_0127230 3300047470 Bacteria 1087
317 Ga0495681_0194286 3300047470 Bacteria 826
318 Ga0495686_0148028 3300047472 Bacteria 1380
319 Ga0495686_0250501 3300047472 Bacteria 995
320 Ga0495626_0000659 3300048091 Bacteria 33166
321 Ga0496101_0328781 3300048904 Bacteria 1200
322 Ga0496102_0110706 3300048905 Bacteria 2560
323 Ga0496102_0199289 3300048905 Bacteria 1887
324 Ga0496102_0891535 3300048905 Bacteria 811
325 Ga0496103_0187505 3300048906 Bacteria 1330
326 Ga0496110_0020792 3300048913 Bacteria 5543
327 Ga0496111_0107959 3300048914 Bacteria 2050
328 Ga0496112_0264259 3300048915 Bacteria 1670
329 Ga0496112_0308990 3300048915 Bacteria 1526
330 Ga0496113_0370663 3300048916 Bacteria 1149
331 Ga0496117_0011823 3300048920 Bacteria 7768
332 Ga0496117_0061286 3300048920 Bacteria 2587
333 Ga0496117_0134466 3300048920 Bacteria 1492
334 Ga0496117_0139106 3300048920 Bacteria 1457
335 Ga0496117_0196147 3300048920 Bacteria 1145
336 Ga0496117_0390473 3300048920 Bacteria 705
337 Ga0496117_0466963 3300048920 Bacteria 620
338 Ga0496118_0025263 3300048921 Bacteria 5100
339 Ga0496118_0168955 3300048921 Bacteria 1339
340 Ga0496118_0212917 3300048921 Bacteria 1132
341 Ga0496119_0049297 3300048922 Bacteria 2604
342 Ga0496119_0183522 3300048922 Bacteria 1095
343 Ga0496120_0014344 3300048923 Bacteria 5288
344 Ga0496120_0029734 3300048923 Bacteria 3331
345 Ga0496120_0208413 3300048923 Bacteria 941
346 Ga0496120_0217288 3300048923 Bacteria 915
347 Ga0496121_0001599 3300048924 Bacteria 37586
348 Ga0496121_0012436 3300048924 Bacteria 9279
349 Ga0496121_0293888 3300048924 Bacteria 1105
350 Ga0496121_0426355 3300048924 Bacteria 861
351 Ga0496122_0000843 3300048925 Bacteria 58014
352 Ga0496122_0014791 3300048925 Bacteria 7518
353 Ga0496122_0056840 3300048925 Bacteria 2912
354 Ga0496122_0076919 3300048925 Bacteria 2346
355 Ga0496122_0264855 3300048925 Bacteria 951
356 Ga0496123_0000765 3300048926 Bacteria 51914
357 Ga0496123_0108751 3300048926 Bacteria 1590
358 Ga0496123_0222299 3300048926 Bacteria 951
359 Ga0496123_0280458 3300048926 Bacteria 805
360 Ga0496124_0002812 3300048927 Bacteria 22045
361 Ga0496124_0006980 3300048927 Bacteria 12115
362 Ga0496124_0007288 3300048927 Bacteria 11798
363 Ga0496124_0024164 3300048927 Bacteria 5531
364 Ga0496124_0028483 3300048927 Bacteria 4996
365 Ga0496124_0234142 3300048927 Bacteria 1370
366 Ga0496124_0330015 3300048927 Bacteria 1088
367 Ga0496124_0492310 3300048927 Bacteria 824
368 Ga0496124_0527010 3300048927 Bacteria 785
369 Ga0496125_0010094 3300048928 Bacteria 9580
370 Ga0496125_0014149 3300048928 Bacteria 7785
371 Ga0496125_0035994 3300048928 Bacteria 4330
372 Ga0496125_0041978 3300048928 Bacteria 3903
373 Ga0496125_0071461 3300048928 Bacteria 2710
374 Ga0496125_0209136 3300048928 Bacteria 1268
375 Ga0496125_0299188 3300048928 Bacteria 986
376 Ga0496125_0455822 3300048928 Bacteria 731
377 Ga0496125_0526575 3300048928 Bacteria 660
378 Ga0496126_0006159 3300048929 Bacteria 13431
379 Ga0496126_0080042 3300048929 Bacteria 2891
380 Ga0496126_0384003 3300048929 Bacteria 1142
381 Ga0496126_0628906 3300048929 Bacteria 842
382 Ga0495678_000007 3300049459 Bacteria 448039
383 Ga0495678_004054 3300049459 Bacteria 8697
384 Ga0495678_008095 3300049459 Bacteria 5354
385 Ga0495678_028791 3300049459 Bacteria 2339
386 Ga0495678_172673 3300049459 Bacteria 683
387 Ga0495682_0000060 3300049460 Bacteria 102283
388 Ga0495682_0001608 3300049460 Bacteria 11653
389 Ga0500650_0000015 3300053098 Bacteria 71164
390 Ga0500618_020517 3300053125 Bacteria 1618
391 Ga0500573_0032270 3300053140 Bacteria 3022
392 Ga0500634_0007369 3300053161 Bacteria 5419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0196147 Ga0496117_0196147_499_876 124
2 iso_pu_bacteria 2511231006 2511268503 145
3 iso_pu_bacteria 2512047018 2512324823 145
4 iso_pu_bacteria 2582580891 2583790948 145
5 iso_pu_bacteria 2597489887 2597856907 145
6 iso_pu_bacteria 2597489888 2597863105 145
7 iso_pu_bacteria 2597489889 2597868897 145
8 iso_pu_bacteria 2599185167 2599401686 145
9 iso_pu_bacteria 2599185179 2599451771 145
10 iso_pu_bacteria 2599185185 2599483934 145
11 iso_pu_bacteria 2599185189 2599509546 145
12 iso_pu_bacteria 2599185190 2599514932 145
13 iso_pu_bacteria 2599185191 2599521029 145
14 iso_pu_bacteria 2599185257 2599801580 145
15 iso_pu_bacteria 2599185288 2599882277 145
16 iso_pu_bacteria 2599185290 2599894271 145
17 iso_pu_bacteria 2599185303 2599952357 145
18 iso_pu_bacteria 2600254931 2600365877 145
19 iso_pu_bacteria 2600255296 2601694184 145
20 iso_pu_bacteria 2619619299 2621300821 145
21 iso_pu_bacteria 2643221571 2643870639 145
22 iso_pu_bacteria 2643221713 2644623072 145
23 iso_pu_bacteria 2671180172 2671768529 145
24 iso_pu_bacteria 2675903420 2677898189 145
25 iso_pu_bacteria 2721755607 2723247924 145
26 iso_pu_bacteria 2738541265 2738670560 145
27 iso_pu_bacteria 2738541276 2738715187 145
28 iso_pu_bacteria 2738541282 2738748953 145
29 iso_pu_bacteria 2738541294 2738810930 145
30 iso_pu_bacteria 2738541303 2738857995 145
31 iso_pu_bacteria 2738541309 2738898290 145
32 iso_pu_bacteria 2740892503 2743736334 145
33 iso_pu_bacteria 2808606385 2808979356 145
34 iso_pu_bacteria 2808606388 2808995280 145
35 iso_pu_bacteria 2816332298 2817489879 145
36 iso_pu_bacteria 2834028612 2834029754 145
37 iso_pu_bacteria 2842826826 2842831025 145
38 iso_pu_bacteria 2842837860 2842841472 145
39 iso_pu_bacteria 2852612431 2852618363 145
40 iso_pu_bacteria 2852667396 2852673501 145
41 iso_pu_bacteria 2908446538 2908448691 145
42 iso_pu_bacteria 2923153595 2923155348 145
43 iso_pu_bacteria 2929189879 2929191721 145
44 iso_pu_bacteria 2931390751 2931392823 145
45 iso_pu_bacteria 2945928738 2945928848 145
46 iso_pu_bacteria 2945961074 2945965105 145
47 iso_pu_bacteria 2946006987 2946011049 145
48 iso_pu_bacteria 2946027586 2946030004 145
49 iso_pu_bacteria 2947233263 2947236578 145
50 iso_pu_bacteria 2984286254 2984290690 145
51 iso_pu_bacteria 3007395558 3007400888 145
52 iso_pu_bacteria 8015687852 8015689567 145
53 iso_pu_bacteria 8019769354 8019775781 145
54 iso_pu_bacteria 8054285046 8054287070 145
55 iso_pu_bacteria 8054347763 8054352180 145
56 iso_pu_bacteria 8054503363 8054505325 145
57 iso_pu_bacteria 8055770955 8055772704 145
58 iso_pu_bacteria 8055817908 8055819883 145
59 iso_pu_bacteria 8056131705 8056133648 145
60 iso_pu_bacteria 8056148874 8056150558 145
61 iso_pu_bacteria 8056161164 8056165072 145
62 iso_pu_bacteria 8057798959 8057799123 145
63 3300049459 Ga0495678_172673 Ga0495678_172673_17_457 146
64 iso_pu_bacteria 2860867994 2860869750 146
65 3300048924 Ga0496121_0426355 Ga0496121_0426355_217_660 147
66 iso_pu_bacteria 2599185155 2599326665 147
67 iso_pu_bacteria 2599185307 2599970465 147
68 iso_pu_bacteria 2600255283 2601624869 147
69 iso_pu_bacteria 2738541271 2738688537 147
70 iso_pu_bacteria 2738543016 2739264269 147
71 iso_pu_bacteria 2826581358 2826583030 147
72 iso_pu_bacteria 2842815866 2842817564 147
73 iso_pu_bacteria 2842849001 2842850716 147
74 iso_pu_bacteria 8055878733 8055880458 147
75 3300002704 JGI25155J39150_1003652 JGI25155J39150_10036522 149
76 3300003751 Ga0055538_1000058 Ga0055538_100005853 149
77 3300003752 Ga0055539_1000087 Ga0055539_100008756 149
78 3300003756 Ga0055533_1000097 Ga0055533_100009756 149
79 3300003758 Ga0055532_1000156 Ga0055532_10001562 149
80 3300003759 Ga0055525_1000219 Ga0055525_100021954 149
81 3300003781 Ga0055536_1000686 Ga0055536_10006866 149
82 3300003791 Ga0055530_10000992 Ga0055530_100009926 149
83 3300003792 Ga0055540_1000708 Ga0055540_100070817 149
84 3300003841 Ga0055541_1000060 Ga0055541_100006054 149
85 3300005288 Ga0065714_10065444 Ga0065714_100654449 149
86 3300005289 Ga0065704_10364066 Ga0065704_103640661 149
87 3300005289 Ga0065704_10456896 Ga0065704_104568962 149
88 3300005290 Ga0065712_10384886 Ga0065712_103848862 149
89 3300005331 Ga0070670_100000781 Ga0070670_10000078119 149
90 3300005331 Ga0070670_100011145 Ga0070670_1000111453 149
91 3300005344 Ga0070661_100000029 Ga0070661_10000002999 149
92 3300005353 Ga0070669_100005364 Ga0070669_1000053647 149
93 3300005457 Ga0070662_100000641 Ga0070662_10000064115 149
94 3300005539 Ga0068853_100002740 Ga0068853_10000274013 149
95 3300005564 Ga0070664_100000134 Ga0070664_10000013438 149
96 3300005578 Ga0068854_100633602 Ga0068854_1006336022 149
97 3300005834 Ga0068851_10000079 Ga0068851_1000007919 149
98 3300009011 Ga0105251_10001815 Ga0105251_1000181517 149
99 3300009011 Ga0105251_10002692 Ga0105251_100026928 149
100 3300009036 Ga0105244_10001540 Ga0105244_100015403 149
101 3300009036 Ga0105244_10001580 Ga0105244_100015803 149
102 3300009092 Ga0105250_10001278 Ga0105250_100012787 149
103 3300009092 Ga0105250_10093058 Ga0105250_100930582 149
104 3300009092 Ga0105250_10414795 Ga0105250_104147952 149
105 3300009176 Ga0105242_10015589 Ga0105242_100155893 149
106 3300009177 Ga0105248_10070057 Ga0105248_100700572 149
107 3300009545 Ga0105237_10001936 Ga0105237_1000193623 149
108 3300011119 Ga0105246_10001200 Ga0105246_100012007 149
109 3300011119 Ga0105246_10031156 Ga0105246_100311564 149
110 3300013100 Ga0157373_10003186 Ga0157373_100031864 149
111 3300013100 Ga0157373_10005314 Ga0157373_100053143 149
112 3300013100 Ga0157373_10015184 Ga0157373_100151846 149
113 3300013100 Ga0157373_10464525 Ga0157373_104645251 149
114 3300013102 Ga0157371_10409002 Ga0157371_104090022 149
115 3300013104 Ga0157370_10066536 Ga0157370_100665364 149
116 3300013105 Ga0157369_10002145 Ga0157369_1000214516 149
117 3300013105 Ga0157369_10075957 Ga0157369_100759574 149
118 3300013105 Ga0157369_10078860 Ga0157369_100788604 149
119 3300013306 Ga0163162_10992730 Ga0163162_109927302 149
120 3300013306 Ga0163162_11295708 Ga0163162_112957082 149
121 3300013308 Ga0157375_10004371 Ga0157375_100043719 149
122 3300013308 Ga0157375_10037680 Ga0157375_100376802 149
123 3300013308 Ga0157375_10430080 Ga0157375_104300802 149
124 3300014497 Ga0182008_10000788 Ga0182008_100007886 149
125 3300014497 Ga0182008_10008364 Ga0182008_100083646 149
126 3300015261 Ga0182006_1001654 Ga0182006_10016547 149
127 3300015262 Ga0182007_10003352 Ga0182007_100033527 149
128 3300017792 Ga0163161_10018854 Ga0163161_100188545 149
129 3300017792 Ga0163161_10166297 Ga0163161_101662973 149
130 3300017792 Ga0163161_10531537 Ga0163161_105315372 149
131 3300017792 Ga0163161_10802161 Ga0163161_108021611 149
132 3300017792 Ga0163161_11855330 Ga0163161_118553301 149
133 3300017792 Ga0163161_12075191 Ga0163161_120751911 149
134 3300025206 Ga0209435_107468 Ga0209435_1074681 149
135 3300025224 Ga0209784_100040 Ga0209784_10004097 149
136 3300025225 Ga0209566_100051 Ga0209566_10005197 149
137 3300025226 Ga0209674_100072 Ga0209674_10007297 149
138 3300025229 Ga0209147_100067 Ga0209147_10006797 149
139 3300025230 Ga0209563_100073 Ga0209563_10007397 149
140 3300025233 Ga0209437_101613 Ga0209437_1016135 149
141 3300025242 Ga0209258_100392 Ga0209258_10039214 149
142 3300025246 Ga0209646_1000216 Ga0209646_100021619 149
143 3300025253 Ga0209677_100063 Ga0209677_10006397 149
144 3300025292 Ga0209676_1000021 Ga0209676_1000021295 149
145 3300025298 Ga0209050_1001092 Ga0209050_100109216 149
146 3300025303 Ga0209051_1001245 Ga0209051_100124515 149
147 3300025304 Ga0209257_1045876 Ga0209257_10458762 149
148 3300025321 Ga0207656_10000093 Ga0207656_1000009318 149
149 3300025711 Ga0207696_1000472 Ga0207696_100047219 149
150 3300025711 Ga0207696_1168341 Ga0207696_11683411 149
151 3300025728 Ga0207655_1001267 Ga0207655_10012677 149
152 3300025728 Ga0207655_1107937 Ga0207655_11079372 149
153 3300025735 Ga0207713_1000519 Ga0207713_100051924 149
154 3300025735 Ga0207713_1005379 Ga0207713_10053791 149
155 3300025735 Ga0207713_1005652 Ga0207713_10056528 149
156 3300025914 Ga0207671_10000287 Ga0207671_100002873 149
157 3300025920 Ga0207649_10000061 Ga0207649_1000006113 149
158 3300025923 Ga0207681_10013245 Ga0207681_100132454 149
159 3300025925 Ga0207650_10000255 Ga0207650_1000025538 149
160 3300025925 Ga0207650_10002380 Ga0207650_100023807 149
161 3300025933 Ga0207706_10001509 Ga0207706_100015097 149
162 3300025934 Ga0207686_10055305 Ga0207686_100553051 149
163 3300025941 Ga0207711_10075014 Ga0207711_100750144 149
164 3300025945 Ga0207679_10000018 Ga0207679_10000018138 149
165 3300025981 Ga0207640_11069818 Ga0207640_110698182 149
166 3300026041 Ga0207639_10002178 Ga0207639_1000217813 149
167 3300031507 Ga0307509_10374873 Ga0307509_103748733 149
168 3300031548 Ga0307408_100002232 Ga0307408_10000223214 149
169 3300031731 Ga0307405_10003499 Ga0307405_100034998 149
170 3300031911 Ga0307412_10248354 Ga0307412_102483542 149
171 3300041407 Ga0439447_020927 Ga0439447_020927_869_1318 149
172 3300041407 Ga0439447_043752 Ga0439447_043752_183_632 149
173 3300041411 Ga0439466_0000225 Ga0439466_0000225_15139_15588 149
174 3300041411 Ga0439466_0002165 Ga0439466_0002165_390_839 149
175 3300041498 Ga0451841_1003605 Ga0451841_1003605_213_662 149
176 3300042006 Ga0439432_000267 Ga0439432_000267_1604_2053 149
177 3300042006 Ga0439432_056726 Ga0439432_056726_514_963 149
178 3300042009 Ga0439451_000418 Ga0439451_000418_4267_4716 149
179 3300042009 Ga0439451_001409 Ga0439451_001409_560_1009 149
180 3300042010 Ga0439452_002725 Ga0439452_002725_5050_5499 149
181 3300042013 Ga0439456_040221 Ga0439456_040221_462_911 149
182 3300042013 Ga0439456_130169 Ga0439456_130169_75_524 149
183 3300042016 Ga0439463_001229 Ga0439463_001229_6329_6778 149
184 3300042115 Ga0450911_035191 Ga0450911_035191_124_573 149
185 3300042124 Ga0450922_001189 Ga0450922_001189_896_1345 149
186 3300042134 Ga0450898_046913 Ga0450898_046913_198_647 149
187 3300042993 Ga0439440_0000391 Ga0439440_0000391_813_1262 149
188 3300046453 Ga0495627_075376 Ga0495627_075376_520_969 149
189 3300046458 Ga0495591_003901 Ga0495591_003901_6835_7284 149
190 3300046506 Ga0495583_0008960 Ga0495583_0008960_850_1299 149
191 3300046507 Ga0495606_0017022 Ga0495606_0017022_312_761 149
192 3300046507 Ga0495606_0037927 Ga0495606_0037927_2274_2723 149
193 3300046512 Ga0495610_0007077 Ga0495610_0007077_1378_1827 149
194 3300046512 Ga0495610_0132019 Ga0495610_0132019_317_766 149
195 3300046512 Ga0495610_0153178 Ga0495610_0153178_403_852 149
196 3300046515 Ga0495620_0006084 Ga0495620_0006084_543_992 149
197 3300046518 Ga0495631_0082892 Ga0495631_0082892_740_1189 149
198 3300046519 Ga0495632_0019856 Ga0495632_0019856_230_679 149
199 3300046520 Ga0495637_0150957 Ga0495637_0150957_74_523 149
200 3300046524 Ga0495648_0320657 Ga0495648_0320657_137_586 149
201 3300046530 Ga0495654_0001614 Ga0495654_0001614_6657_7106 149
202 3300046530 Ga0495654_0060739 Ga0495654_0060739_380_829 149
203 3300046557 Ga0495622_0026796 Ga0495622_0026796_219_668 149
204 3300046558 Ga0495633_0516425 Ga0495633_0516425_77_526 149
205 3300046648 Ga0495611_0180168 Ga0495611_0180168_248_697 149
206 3300046665 Ga0495661_0001018 Ga0495661_0001018_6874_7323 149
207 3300046665 Ga0495661_0013072 Ga0495661_0013072_556_1005 149
208 3300046794 Ga0495589_0167180 Ga0495589_0167180_165_614 149
209 3300046810 Ga0495660_0021144 Ga0495660_0021144_502_951 149
210 3300047446 Ga0495679_003220 Ga0495679_003220_5965_6414 149
211 3300047446 Ga0495679_004437 Ga0495679_004437_4756_5205 149
212 3300047446 Ga0495679_078762 Ga0495679_078762_217_666 149
213 3300047469 Ga0495673_0224293 Ga0495673_0224293_134_583 149
214 3300047470 Ga0495681_0127230 Ga0495681_0127230_154_603 149
215 3300048920 Ga0496117_0011823 Ga0496117_0011823_6860_7309 149
216 3300048920 Ga0496117_0134466 Ga0496117_0134466_993_1442 149
217 3300048920 Ga0496117_0390473 Ga0496117_0390473_116_565 149
218 3300048920 Ga0496117_0466963 Ga0496117_0466963_80_529 149
219 3300048921 Ga0496118_0212917 Ga0496118_0212917_118_567 149
220 3300048922 Ga0496119_0049297 Ga0496119_0049297_154_603 149
221 3300048922 Ga0496119_0183522 Ga0496119_0183522_382_831 149
222 3300048923 Ga0496120_0014344 Ga0496120_0014344_131_580 149
223 3300048923 Ga0496120_0029734 Ga0496120_0029734_557_1006 149
224 3300048923 Ga0496120_0208413 Ga0496120_0208413_255_704 149
225 3300048923 Ga0496120_0217288 Ga0496120_0217288_420_869 149
226 3300048924 Ga0496121_0293888 Ga0496121_0293888_516_965 149
227 3300048925 Ga0496122_0056840 Ga0496122_0056840_347_796 149
228 3300048925 Ga0496122_0076919 Ga0496122_0076919_34_483 149
229 3300048925 Ga0496122_0264855 Ga0496122_0264855_388_837 149
230 3300048926 Ga0496123_0222299 Ga0496123_0222299_350_799 149
231 3300048926 Ga0496123_0280458 Ga0496123_0280458_30_479 149
232 3300048927 Ga0496124_0024164 Ga0496124_0024164_4834_5283 149
233 3300048927 Ga0496124_0234142 Ga0496124_0234142_599_1048 149
234 3300048927 Ga0496124_0330015 Ga0496124_0330015_382_831 149
235 3300048927 Ga0496124_0492310 Ga0496124_0492310_211_660 149
236 3300048927 Ga0496124_0527010 Ga0496124_0527010_144_593 149
237 3300048928 Ga0496125_0010094 Ga0496125_0010094_8275_8724 149
238 3300048928 Ga0496125_0014149 Ga0496125_0014149_6872_7321 149
239 3300048928 Ga0496125_0035994 Ga0496125_0035994_3868_4317 149
240 3300048928 Ga0496125_0041978 Ga0496125_0041978_335_784 149
241 3300048928 Ga0496125_0071461 Ga0496125_0071461_306_755 149
242 3300048928 Ga0496125_0209136 Ga0496125_0209136_486_935 149
243 3300048928 Ga0496125_0299188 Ga0496125_0299188_199_648 149
244 3300048928 Ga0496125_0455822 Ga0496125_0455822_135_584 149
245 3300048929 Ga0496126_0006159 Ga0496126_0006159_6516_6965 149
246 3300048929 Ga0496126_0080042 Ga0496126_0080042_182_631 149
247 3300048929 Ga0496126_0384003 Ga0496126_0384003_250_699 149
248 3300048929 Ga0496126_0628906 Ga0496126_0628906_94_543 149
249 3300053161 Ga0500634_0007369 Ga0500634_0007369_4523_4972 149
250 3300053098 Ga0500650_0000015 Ga0500650_0000015_45006_45497 150
251 2162886011 MRS1b_contig_6162877 MRS1b_0051.00000320 151
252 3300005288 Ga0065714_10295436 Ga0065714_102954361 151
253 3300005290 Ga0065712_10000132 Ga0065712_1000013243 151
254 3300009011 Ga0105251_10000018 Ga0105251_1000001810 151
255 3300009011 Ga0105251_10002362 Ga0105251_1000236212 151
256 3300009011 Ga0105251_10027251 Ga0105251_100272513 151
257 3300009036 Ga0105244_10000313 Ga0105244_100003137 151
258 3300009036 Ga0105244_10004575 Ga0105244_100045756 151
259 3300009036 Ga0105244_10299909 Ga0105244_102999092 151
260 3300009036 Ga0105244_10314930 Ga0105244_103149302 151
261 3300009092 Ga0105250_10000589 Ga0105250_100005896 151
262 3300009092 Ga0105250_10204833 Ga0105250_102048331 151
263 3300013100 Ga0157373_10013659 Ga0157373_100136591 151
264 3300013100 Ga0157373_11173070 Ga0157373_111730701 151
265 3300013102 Ga0157371_10002311 Ga0157371_100023117 151
266 3300013104 Ga0157370_10793339 Ga0157370_107933392 151
267 3300014497 Ga0182008_10017991 Ga0182008_100179913 151
268 3300015265 Ga0182005_1014317 Ga0182005_10143172 151
269 3300015265 Ga0182005_1153663 Ga0182005_11536631 151
270 3300017792 Ga0163161_10685444 Ga0163161_106854442 151
271 3300017792 Ga0163161_11226856 Ga0163161_112268561 151
272 3300025711 Ga0207696_1000677 Ga0207696_10006776 151
273 3300025728 Ga0207655_1002287 Ga0207655_10022877 151
274 3300025728 Ga0207655_1005637 Ga0207655_10056376 151
275 3300025728 Ga0207655_1106842 Ga0207655_11068422 151
276 3300025735 Ga0207713_1000009 Ga0207713_1000009386 151
277 3300025735 Ga0207713_1009577 Ga0207713_10095771 151
278 3300031731 Ga0307405_11063966 Ga0307405_110639662 151
279 3300033180 Ga0307510_10170671 Ga0307510_101706713 151
280 3300041404 Ga0439436_0000375 Ga0439436_0000375_2395_2859 151
281 3300041405 Ga0439438_009372 Ga0439438_009372_2263_2727 151
282 3300041407 Ga0439447_002322 Ga0439447_002322_2445_2909 151
283 3300041411 Ga0439466_0009627 Ga0439466_0009627_2594_3058 151
284 3300042006 Ga0439432_020502 Ga0439432_020502_1077_1541 151
285 3300042010 Ga0439452_010164 Ga0439452_010164_846_1310 151
286 3300042016 Ga0439463_000338 Ga0439463_000338_2279_2737 151
287 3300042121 Ga0450919_005495 Ga0450919_005495_332_796 151
288 3300042125 Ga0450923_011972 Ga0450923_011972_889_1353 151
289 3300042435 Ga0439434_0001227 Ga0439434_0001227_3993_4457 151
290 3300046452 Ga0495617_158303 Ga0495617_158303_38_496 151
291 3300046453 Ga0495627_000058 Ga0495627_000058_138158_138613 151
292 3300046453 Ga0495627_028683 Ga0495627_028683_671_1129 151
293 3300046458 Ga0495591_000137 Ga0495591_000137_13551_14006 151
294 3300046458 Ga0495591_000824 Ga0495591_000824_17044_17502 151
295 3300046458 Ga0495591_001788 Ga0495591_001788_3985_4443 151
296 3300046458 Ga0495591_001862 Ga0495591_001862_8111_8569 151
297 3300046458 Ga0495591_002669 Ga0495591_002669_5674_6132 151
298 3300046458 Ga0495591_006319 Ga0495591_006319_2727_3185 151
299 3300046460 Ga0495638_0065732 Ga0495638_0065732_1286_1744 151
300 3300046471 Ga0495650_0002186 Ga0495650_0002186_11546_12004 151
301 3300046471 Ga0495650_0002860 Ga0495650_0002860_1936_2394 151
302 3300046471 Ga0495650_0003920 Ga0495650_0003920_5213_5671 151
303 3300046471 Ga0495650_0211766 Ga0495650_0211766_57_515 151
304 3300046471 Ga0495650_0254994 Ga0495650_0254994_50_508 151
305 3300046474 Ga0495605_0000026 Ga0495605_0000026_206360_206818 151
306 3300046474 Ga0495605_0000414 Ga0495605_0000414_12067_12525 151
307 3300046474 Ga0495605_0000837 Ga0495605_0000837_17339_17797 151
308 3300046474 Ga0495605_0001441 Ga0495605_0001441_4732_5187 151
309 3300046474 Ga0495605_0004376 Ga0495605_0004376_3652_4110 151
310 3300046474 Ga0495605_0013346 Ga0495605_0013346_1138_1596 151
311 3300046474 Ga0495605_0045094 Ga0495605_0045094_1590_2048 151
312 3300046491 Ga0495584_0002445 Ga0495584_0002445_3950_4408 151
313 3300046492 Ga0495585_0069412 Ga0495585_0069412_1169_1627 151
314 3300046499 Ga0495594_0003875 Ga0495594_0003875_6015_6473 151
315 3300046500 Ga0495596_0042763 Ga0495596_0042763_163_621 151
316 3300046501 Ga0495607_0000206 Ga0495607_0000206_57157_57612 151
317 3300046501 Ga0495607_0000606 Ga0495607_0000606_30009_30467 151
318 3300046501 Ga0495607_0002972 Ga0495607_0002972_8857_9315 151
319 3300046501 Ga0495607_0006057 Ga0495607_0006057_3749_4207 151
320 3300046501 Ga0495607_0009779 Ga0495607_0009779_2072_2530 151
321 3300046501 Ga0495607_0016128 Ga0495607_0016128_4317_4775 151
322 3300046501 Ga0495607_0054831 Ga0495607_0054831_551_1009 151
323 3300046501 Ga0495607_0118243 Ga0495607_0118243_875_1342 151
324 3300046501 Ga0495607_0125590 Ga0495607_0125590_308_766 151
325 3300046501 Ga0495607_0282999 Ga0495607_0282999_278_736 151
326 3300046501 Ga0495607_0291499 Ga0495607_0291499_137_592 151
327 3300046506 Ga0495583_0000043 Ga0495583_0000043_14913_15371 151
328 3300046506 Ga0495583_0000312 Ga0495583_0000312_3945_4403 151
329 3300046506 Ga0495583_0002075 Ga0495583_0002075_4288_4746 151
330 3300046506 Ga0495583_0004458 Ga0495583_0004458_5089_5547 151
331 3300046506 Ga0495583_0004983 Ga0495583_0004983_7996_8454 151
332 3300046506 Ga0495583_0007466 Ga0495583_0007466_3944_4402 151
333 3300046507 Ga0495606_0000274 Ga0495606_0000274_85578_86036 151
334 3300046507 Ga0495606_0000630 Ga0495606_0000630_50524_50982 151
335 3300046507 Ga0495606_0050247 Ga0495606_0050247_1514_1972 151
336 3300046507 Ga0495606_0160075 Ga0495606_0160075_548_1006 151
337 3300046512 Ga0495610_0017497 Ga0495610_0017497_2388_2846 151
338 3300046512 Ga0495610_0030601 Ga0495610_0030601_2216_2674 151
339 3300046512 Ga0495610_0051107 Ga0495610_0051107_874_1332 151
340 3300046512 Ga0495610_0067387 Ga0495610_0067387_996_1451 151
341 3300046513 Ga0495616_0119572 Ga0495616_0119572_430_888 151
342 3300046515 Ga0495620_0000263 Ga0495620_0000263_10831_11289 151
343 3300046515 Ga0495620_0001658 Ga0495620_0001658_8802_9260 151
344 3300046515 Ga0495620_0002574 Ga0495620_0002574_5551_6009 151
345 3300046515 Ga0495620_0014928 Ga0495620_0014928_1621_2079 151
346 3300046515 Ga0495620_0031687 Ga0495620_0031687_717_1175 151
347 3300046518 Ga0495631_0003286 Ga0495631_0003286_4519_4977 151
348 3300046518 Ga0495631_0007638 Ga0495631_0007638_1171_1629 151
349 3300046518 Ga0495631_0152820 Ga0495631_0152820_10_468 151
350 3300046519 Ga0495632_0002422 Ga0495632_0002422_9013_9471 151
351 3300046519 Ga0495632_0003212 Ga0495632_0003212_7356_7814 151
352 3300046519 Ga0495632_0006843 Ga0495632_0006843_2796_3254 151
353 3300046519 Ga0495632_0230891 Ga0495632_0230891_49_507 151
354 3300046519 Ga0495632_0291321 Ga0495632_0291321_213_680 151
355 3300046520 Ga0495637_0000174 Ga0495637_0000174_34333_34791 151
356 3300046520 Ga0495637_0000201 Ga0495637_0000201_4041_4499 151
357 3300046520 Ga0495637_0009932 Ga0495637_0009932_360_815 151
358 3300046520 Ga0495637_0046515 Ga0495637_0046515_844_1302 151
359 3300046520 Ga0495637_0052822 Ga0495637_0052822_171_629 151
360 3300046522 Ga0495643_0004102 Ga0495643_0004102_5964_6422 151
361 3300046522 Ga0495643_0047106 Ga0495643_0047106_1202_1660 151
362 3300046523 Ga0495644_0007920 Ga0495644_0007920_2901_3359 151
363 3300046523 Ga0495644_0358670 Ga0495644_0358670_41_496 151
364 3300046524 Ga0495648_0004792 Ga0495648_0004792_5977_6435 151
365 3300046524 Ga0495648_0005106 Ga0495648_0005106_3753_4211 151
366 3300046524 Ga0495648_0077400 Ga0495648_0077400_1203_1661 151
367 3300046524 Ga0495648_0283998 Ga0495648_0283998_62_520 151
368 3300046529 Ga0495652_0167668 Ga0495652_0167668_912_1367 151
369 3300046530 Ga0495654_0001405 Ga0495654_0001405_6920_7378 151
370 3300046530 Ga0495654_0002565 Ga0495654_0002565_3694_4152 151
371 3300046530 Ga0495654_0002664 Ga0495654_0002664_6672_7130 151
372 3300046530 Ga0495654_0011061 Ga0495654_0011061_43_498 151
373 3300046530 Ga0495654_0057453 Ga0495654_0057453_778_1236 151
374 3300046538 Ga0495609_0000036 Ga0495609_0000036_14978_15436 151
375 3300046538 Ga0495609_0000125 Ga0495609_0000125_13512_13970 151
376 3300046538 Ga0495609_0000902 Ga0495609_0000902_16541_16999 151
377 3300046538 Ga0495609_0014816 Ga0495609_0014816_1157_1615 151
378 3300046538 Ga0495609_0094037 Ga0495609_0094037_627_1085 151
379 3300046542 Ga0495597_0000057 Ga0495597_0000057_5692_6147 151
380 3300046542 Ga0495597_0007024 Ga0495597_0007024_4997_5455 151
381 3300046542 Ga0495597_0045978 Ga0495597_0045978_708_1166 151
382 3300046543 Ga0495645_0061570 Ga0495645_0061570_1927_2385 151
383 3300046557 Ga0495622_0004438 Ga0495622_0004438_4236_4694 151
384 3300046558 Ga0495633_0000143 Ga0495633_0000143_79927_80385 151
385 3300046616 Ga0495668_0013996 Ga0495668_0013996_518_976 151
386 3300046616 Ga0495668_0049866 Ga0495668_0049866_1293_1751 151
387 3300046648 Ga0495611_0001402 Ga0495611_0001402_6498_6956 151
388 3300046648 Ga0495611_0001570 Ga0495611_0001570_6289_6747 151
389 3300046648 Ga0495611_0008121 Ga0495611_0008121_469_927 151
390 3300046660 Ga0495625_0000070 Ga0495625_0000070_162007_162465 151
391 3300046660 Ga0495625_0127820 Ga0495625_0127820_434_889 151
392 3300046665 Ga0495661_0000042 Ga0495661_0000042_4828_5286 151
393 3300046665 Ga0495661_0000121 Ga0495661_0000121_15034_15492 151
394 3300046665 Ga0495661_0000278 Ga0495661_0000278_4395_4853 151
395 3300046665 Ga0495661_0014822 Ga0495661_0014822_3917_4375 151
396 3300046665 Ga0495661_0025384 Ga0495661_0025384_3120_3578 151
397 3300046665 Ga0495661_0423215 Ga0495661_0423215_150_608 151
398 3300046691 Ga0495670_0021726 Ga0495670_0021726_2693_3151 151
399 3300046691 Ga0495670_0076976 Ga0495670_0076976_364_822 151
400 3300046692 Ga0495671_0025975 Ga0495671_0025975_1947_2405 151
401 3300046692 Ga0495671_0047001 Ga0495671_0047001_1537_1995 151
402 3300046692 Ga0495671_0175090 Ga0495671_0175090_422_880 151
403 3300046694 Ga0495649_0041430 Ga0495649_0041430_1512_1967 151
404 3300046694 Ga0495649_0210893 Ga0495649_0210893_164_622 151
405 3300046794 Ga0495589_0000889 Ga0495589_0000889_12727_13185 151
406 3300046810 Ga0495660_0009689 Ga0495660_0009689_5070_5528 151
407 3300046810 Ga0495660_0058578 Ga0495660_0058578_1229_1687 151
408 3300046810 Ga0495660_0122291 Ga0495660_0122291_207_662 151
409 3300046810 Ga0495660_0254671 Ga0495660_0254671_189_647 151
410 3300047320 Ga0495672_0019482 Ga0495672_0019482_281_739 151
411 3300047320 Ga0495672_0029306 Ga0495672_0029306_1818_2273 151
412 3300047320 Ga0495672_0057714 Ga0495672_0057714_1513_1968 151
413 3300047321 Ga0495676_0000019 Ga0495676_0000019_152392_152850 151
414 3300047323 Ga0495683_0000003 Ga0495683_0000003_368619_369077 151
415 3300047323 Ga0495683_0026570 Ga0495683_0026570_1857_2315 151
416 3300047446 Ga0495679_000119 Ga0495679_000119_7463_7921 151
417 3300047446 Ga0495679_000268 Ga0495679_000268_38048_38506 151
418 3300047469 Ga0495673_0002307 Ga0495673_0002307_3739_4197 151
419 3300047469 Ga0495673_0002954 Ga0495673_0002954_3589_4047 151
420 3300047469 Ga0495673_0004806 Ga0495673_0004806_3695_4153 151
421 3300047469 Ga0495673_0009015 Ga0495673_0009015_1369_1827 151
422 3300047469 Ga0495673_0022553 Ga0495673_0022553_1936_2394 151
423 3300047469 Ga0495673_0023441 Ga0495673_0023441_163_621 151
424 3300047469 Ga0495673_0028358 Ga0495673_0028358_759_1217 151
425 3300047470 Ga0495681_0004669 Ga0495681_0004669_4070_4528 151
426 3300047470 Ga0495681_0077709 Ga0495681_0077709_662_1120 151
427 3300047470 Ga0495681_0194286 Ga0495681_0194286_216_674 151
428 3300047472 Ga0495686_0148028 Ga0495686_0148028_549_1007 151
429 3300047472 Ga0495686_0250501 Ga0495686_0250501_251_709 151
430 3300048091 Ga0495626_0000659 Ga0495626_0000659_14424_14882 151
431 3300048904 Ga0496101_0328781 Ga0496101_0328781_197_664 151
432 3300048905 Ga0496102_0110706 Ga0496102_0110706_776_1234 151
433 3300048905 Ga0496102_0199289 Ga0496102_0199289_546_1004 151
434 3300048905 Ga0496102_0891535 Ga0496102_0891535_302_769 151
435 3300048906 Ga0496103_0187505 Ga0496103_0187505_180_638 151
436 3300048913 Ga0496110_0020792 Ga0496110_0020792_404_862 151
437 3300048914 Ga0496111_0107959 Ga0496111_0107959_1502_1960 151
438 3300048915 Ga0496112_0264259 Ga0496112_0264259_493_951 151
439 3300048915 Ga0496112_0308990 Ga0496112_0308990_129_596 151
440 3300048916 Ga0496113_0370663 Ga0496113_0370663_572_1039 151
441 3300048920 Ga0496117_0061286 Ga0496117_0061286_394_852 151
442 3300048920 Ga0496117_0139106 Ga0496117_0139106_438_896 151
443 3300048921 Ga0496118_0025263 Ga0496118_0025263_3937_4404 151
444 3300048921 Ga0496118_0168955 Ga0496118_0168955_848_1306 151
445 3300048924 Ga0496121_0001599 Ga0496121_0001599_32700_33158 151
446 3300048924 Ga0496121_0012436 Ga0496121_0012436_6594_7061 151
447 3300048925 Ga0496122_0000843 Ga0496122_0000843_4775_5242 151
448 3300048925 Ga0496122_0014791 Ga0496122_0014791_1699_2157 151
449 3300048926 Ga0496123_0000765 Ga0496123_0000765_47304_47771 151
450 3300048926 Ga0496123_0108751 Ga0496123_0108751_856_1314 151
451 3300048927 Ga0496124_0002812 Ga0496124_0002812_9398_9856 151
452 3300048927 Ga0496124_0006980 Ga0496124_0006980_4902_5360 151
453 3300048927 Ga0496124_0007288 Ga0496124_0007288_7077_7532 151
454 3300048927 Ga0496124_0028483 Ga0496124_0028483_884_1342 151
455 3300048928 Ga0496125_0526575 Ga0496125_0526575_171_626 151
456 3300049459 Ga0495678_000007 Ga0495678_000007_437580_438038 151
457 3300049459 Ga0495678_004054 Ga0495678_004054_7943_8401 151
458 3300049459 Ga0495678_008095 Ga0495678_008095_4214_4672 151
459 3300049459 Ga0495678_028791 Ga0495678_028791_513_971 151
460 3300049460 Ga0495682_0000060 Ga0495682_0000060_11213_11668 151
461 3300049460 Ga0495682_0001608 Ga0495682_0001608_7102_7560 151
462 3300053125 Ga0500618_020517 Ga0500618_020517_923_1381 151
463 3300053140 Ga0500573_0032270 Ga0500573_0032270_351_806 151
464 iso_pu_bacteria 2808606379 2808943167 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

5

81

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.9126 1 148
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8895 1 148
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8654 1 148
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8443 1 148
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8304 2 151
ID Description Score Start End Superfamily
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8979 1 149 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8812 1 149 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.846 7 149 3.40.50.1240
af_A0A1D6QHM8_37_228_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8411 1 136 3.40.50.1240
af_A0A1D6HET3_64_207_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8377 8 75 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A326SIA3-F1-model_v4 deleted 1 1 131
AF-A0A7V8KBK1-F1-model_v4 deleted 0.9987 1 149
AF-A0A0Q0CV58-F1-model_v4 Phosphohistidine phosphatase SixA 0.9957 15 151 GO:0005737
GO:0036211
GO:0101006
AF-A0A258BXT3-F1-model_v4 Phosphohistidine phosphatase 0.9948 47 151
AF-A0A3E1UHV5-F1-model_v4 deleted 0.9939 26 149

Feature Viewer

pLDDT pTM Quality
96.67 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map