F448948

General Info

Members Datasets Scaffolds Average Seq Length
462 230 924 274

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0016460|Ga0373953_0016460_251_1258
Length 329
Sequence MLHFKVRHKEDGSDRPDVNWSGWISVRAAQEKTAERAXXXXKDVFLCAFFRSRYTHRMPDHAETLRALHRTPPMLVLPNAWDAASARLIAAEGFPAIATTSAGVAAALGYPDGGVVPANEMIEAIARIARSVKVPVTADIEHAYGATPDAVADVVLKVIAAGAVGINLEDCVPGATDLEPLALQLDKIKAIVKASTKAGVRVVINARTDGFLRGFGASETRLGVAIERGKAFLEAGADCVFVPGVRDAATIGALVKGIGGPLNVLAVEGSPSIPELEALGVARVSLGSGPMRATMALLRDIARELKGPGTYKAFTKHAMTFNEVNDLMK

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
172 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 13.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0016460 3300035117 Unclassified 2699
2 MBSR1b_contig_13653150 2162886012 Bacteria 1715
3 MBSR1b_contig_8385164 2162886012 Bacteria 1726
4 JGI24748J21848_1008811 3300002074 Unclassified 1187
5 Ga0065715_10023604 3300005293 Unclassified 1677
6 Ga0070683_100003503 3300005329 Bacteria 12763
7 Ga0070690_100072756 3300005330 Unclassified 2235
8 Ga0070690_100124947 3300005330 Bacteria 1731
9 Ga0070670_100033063 3300005331 Unclassified 4455
10 Ga0070670_100115149 3300005331 Bacteria 2318
11 Ga0068869_100152277 3300005334 Bacteria 1794
12 Ga0070666_10004740 3300005335 Bacteria 8312
13 Ga0070666_10231732 3300005335 Unclassified 1304
14 Ga0070680_100539719 3300005336 Bacteria 999
15 Ga0068868_100003051 3300005338 Bacteria 11658
16 Ga0068868_100556178 3300005338 Bacteria 1012
17 Ga0070660_100018415 3300005339 Bacteria 5103
18 Ga0070660_100021327 3300005339 Unclassified 4775
19 Ga0070689_100164702 3300005340 Bacteria 1794
20 Ga0070689_100237954 3300005340 Bacteria 1499
21 Ga0070687_100018434 3300005343 Bacteria 3229
22 Ga0070687_100145540 3300005343 Unclassified 1385
23 Ga0070668_100007490 3300005347 Bacteria 8102
24 Ga0070668_100224858 3300005347 Bacteria 1549
25 Ga0070669_100006472 3300005353 Bacteria 8432
26 Ga0070669_100053320 3300005353 Bacteria 2960
27 Ga0070669_100053636 3300005353 Bacteria 2951
28 Ga0070669_100089784 3300005353 Bacteria 2302
29 Ga0070669_100355170 3300005353 Unclassified 1191
30 Ga0070669_100601653 3300005353 Unclassified 921
31 Ga0070675_100045825 3300005354 Bacteria 3579
32 Ga0070675_100222950 3300005354 Bacteria 1642
33 Ga0070671_100052644 3300005355 Unclassified 3384
34 Ga0070671_100384328 3300005355 Bacteria 1200
35 Ga0070674_100017750 3300005356 Bacteria 4483
36 Ga0070673_100018558 3300005364 Bacteria 4972
37 Ga0070673_100144928 3300005364 Bacteria 2007
38 Ga0070688_100005943 3300005365 Bacteria 6467
39 Ga0070688_100012735 3300005365 Unclassified 4721
40 Ga0070688_100060805 3300005365 Unclassified 2386
41 Ga0070659_100076168 3300005366 Bacteria 2675
42 Ga0070659_100276210 3300005366 Bacteria 1397
43 Ga0070667_100023865 3300005367 Bacteria 5079
44 Ga0070713_100024085 3300005436 Viruses 4736
45 Ga0070713_100079012 3300005436 Unclassified 2801
46 Ga0070701_10170065 3300005438 Unclassified 1268
47 Ga0070711_100060560 3300005439 Bacteria 2632
48 Ga0070711_100097461 3300005439 Bacteria 2132
49 Ga0070705_100021567 3300005440 Unclassified 3428
50 Ga0070705_100044335 3300005440 Bacteria 2554
51 Ga0070705_100072048 3300005440 Bacteria 2092
52 Ga0070700_100027766 3300005441 Bacteria 3359
53 Ga0070694_100054715 3300005444 Bacteria 2704
54 Ga0070694_100232295 3300005444 Bacteria 1388
55 Ga0070708_100067872 3300005445 Bacteria 3204
56 Ga0070708_100119484 3300005445 Unclassified 2430
57 Ga0070708_100156021 3300005445 Unclassified 2125
58 Ga0070708_100183560 3300005445 Archaea 1956
59 Ga0070708_100187586 3300005445 Bacteria 1934
60 Ga0070708_100293024 3300005445 Bacteria 1532
61 Ga0070708_100423873 3300005445 Bacteria 1255
62 Ga0070708_100576355 3300005445 Bacteria 1061
63 Ga0070663_100026915 3300005455 Bacteria 3900
64 Ga0070662_100120373 3300005457 Bacteria 2011
65 Ga0070681_10082705 3300005458 Bacteria 3165
66 Ga0068867_100067186 3300005459 Bacteria 2672
67 Ga0068867_100286110 3300005459 Unclassified 1353
68 Ga0070685_10001575 3300005466 Bacteria 12030
69 Ga0070685_10071436 3300005466 Bacteria 2058
70 Ga0070706_100002753 3300005467 Bacteria 17590
71 Ga0070706_100017448 3300005467 Bacteria 6624
72 Ga0070706_100152420 3300005467 Bacteria 2158
73 Ga0070706_100605123 3300005467 Bacteria 1018
74 Ga0070706_100606393 3300005467 Bacteria 1017
75 Ga0070707_100000017 3300005468 Unclassified 141660
76 Ga0070707_100007175 3300005468 Bacteria 10334
77 Ga0070707_100022619 3300005468 Archaea 5944
78 Ga0070707_100117873 3300005468 Bacteria 2577
79 Ga0070707_100118232 3300005468 Bacteria 2573
80 Ga0070707_100290086 3300005468 Bacteria 1590
81 Ga0070707_100394975 3300005468 Bacteria 1343
82 Ga0070698_100121360 3300005471 Bacteria 2573
83 Ga0070699_100000615 3300005518 Bacteria 33628
84 Ga0070699_100005121 3300005518 Bacteria 11528
85 Ga0070699_100024526 3300005518 Bacteria 5197
86 Ga0070699_100024655 3300005518 Archaea 5185
87 Ga0070699_100036511 3300005518 Bacteria 4251
88 Ga0070684_100003336 3300005535 Bacteria 12016
89 Ga0070697_100000248 3300005536 Bacteria 43558
90 Ga0070697_100004972 3300005536 Archaea 10208
91 Ga0070697_100010483 3300005536 Unclassified 7234
92 Ga0070697_100048655 3300005536 Bacteria 3438
93 Ga0070697_100094324 3300005536 Archaea 2479
94 Ga0070697_100118833 3300005536 Archaea 2209
95 Ga0068853_100161625 3300005539 Bacteria 2021
96 Ga0068853_100509088 3300005539 Archaea 1137
97 Ga0070672_100077857 3300005543 Unclassified 2652
98 Ga0070686_100007525 3300005544 Bacteria 6080
99 Ga0070686_100043230 3300005544 Unclassified 2826
100 Ga0070686_100125293 3300005544 Bacteria 1769
101 Ga0070686_100140329 3300005544 Unclassified 1681
102 Ga0070686_100321824 3300005544 Bacteria 1153
103 Ga0070695_100005801 3300005545 Bacteria 7276
104 Ga0070695_100096631 3300005545 Bacteria 1982
105 Ga0070696_100047954 3300005546 Bacteria 2965
106 Ga0070693_100080261 3300005547 Bacteria 1943
107 Ga0070665_100008991 3300005548 Bacteria 10116
108 Ga0070704_100007922 3300005549 Bacteria 6342
109 Ga0070704_100053874 3300005549 Bacteria 2844
110 Ga0070704_100092183 3300005549 Unclassified 2261
111 Ga0068855_100025620 3300005563 Bacteria 7055
112 Ga0068855_100128354 3300005563 Bacteria 2897
113 Ga0070664_100020903 3300005564 Bacteria 5393
114 Ga0068857_100002334 3300005577 Bacteria 15434
115 Ga0068854_100002370 3300005578 Bacteria 11622
116 Ga0068854_100053488 3300005578 Bacteria 2900
117 Ga0068856_100017444 3300005614 Bacteria 6955
118 Ga0070702_100002485 3300005615 Bacteria 7976
119 Ga0068852_100080425 3300005616 Bacteria 2889
120 Ga0068852_100341650 3300005616 Bacteria 1459
121 Ga0068859_100194053 3300005617 Bacteria 2115
122 Ga0068864_100061374 3300005618 Bacteria 3256
123 Ga0068864_100069659 3300005618 Bacteria 3059
124 Ga0068866_10003387 3300005718 Bacteria 6541
125 Ga0068866_10154136 3300005718 Bacteria 1333
126 Ga0068861_100093439 3300005719 Bacteria 2378
127 Ga0068861_100282255 3300005719 Bacteria 1430
128 Ga0068861_100337396 3300005719 Bacteria 1318
129 Ga0068851_10001017 3300005834 Bacteria 12165
130 Ga0068870_10002460 3300005840 Bacteria 7716
131 Ga0068863_100070996 3300005841 Bacteria 3294
132 Ga0068863_100120953 3300005841 Bacteria 2496
133 Ga0068858_100009134 3300005842 Bacteria 9478
134 Ga0068858_100009368 3300005842 Bacteria 9344
135 Ga0068858_100070387 3300005842 Bacteria 3243
136 Ga0068860_100035926 3300005843 Bacteria 4751
137 Ga0068860_100319227 3300005843 Bacteria 1524
138 Ga0068862_100010420 3300005844 Bacteria 7674
139 Ga0068862_100077131 3300005844 Bacteria 2885
140 Ga0068862_100084220 3300005844 Bacteria 2762
141 Ga0068862_100203147 3300005844 Bacteria 1788
142 Ga0081539_10101259 3300005985 Bacteria 1468
143 Ga0070717_10010700 3300006028 Bacteria 6939
144 Ga0070716_100153217 3300006173 Bacteria 1485
145 Ga0070716_100182224 3300006173 Bacteria 1380
146 Ga0097621_100002630 3300006237 Bacteria 12297
147 Ga0097621_100101422 3300006237 Bacteria 2422
148 Ga0097621_100354282 3300006237 Bacteria 1306
149 Ga0068871_100109499 3300006358 Bacteria 2322
150 Ga0075428_100097977 3300006844 Bacteria 3196
151 Ga0075428_100101432 3300006844 Bacteria 3137
152 Ga0075428_100604859 3300006844 Bacteria 1171
153 Ga0075430_100115976 3300006846 Bacteria 2232
154 Ga0075433_10009607 3300006852 Bacteria 7739
155 Ga0075433_10047699 3300006852 Bacteria 3726
156 Ga0075433_10085864 3300006852 Bacteria 2779
157 Ga0075433_10397177 3300006852 Bacteria 1217
158 Ga0075434_100000719 3300006871 Bacteria 25910
159 Ga0075434_100018258 3300006871 Bacteria 6773
160 Ga0075434_100022845 3300006871 Bacteria 6089
161 Ga0075434_100027600 3300006871 Bacteria 5574
162 Ga0075434_100036522 3300006871 Bacteria 4860
163 Ga0075434_100138984 3300006871 Bacteria 2449
164 Ga0075434_100275857 3300006871 Bacteria 1701
165 Ga0075434_100347950 3300006871 Bacteria 1503
166 Ga0075434_100510445 3300006871 Bacteria 1223
167 Ga0075429_100395104 3300006880 Bacteria 1211
168 Ga0068865_100021867 3300006881 Bacteria 4164
169 Ga0068865_100207647 3300006881 Bacteria 1524
170 Ga0075436_100000203 3300006914 Bacteria 36662
171 Ga0075436_100001685 3300006914 Bacteria 15101
172 Ga0075436_100055328 3300006914 Bacteria 2739
173 Ga0075436_100068966 3300006914 Bacteria 2443
174 Ga0075436_100089286 3300006914 Bacteria 2141
175 Ga0075436_100091521 3300006914 Bacteria 2114
176 Ga0075436_100128607 3300006914 Bacteria 1775
177 Ga0097620_100156147 3300006931 Bacteria 2359
178 Ga0097620_100194059 3300006931 Bacteria 2115
179 Ga0075435_100000012 3300007076 Bacteria 108852
180 Ga0075435_100012243 3300007076 Bacteria 6346
181 Ga0075435_100018030 3300007076 Bacteria 5355
182 Ga0075435_100037395 3300007076 Bacteria 3865
183 Ga0075435_100037412 3300007076 Bacteria 3864
184 Ga0075435_100053767 3300007076 Bacteria 3248
185 Ga0075435_100227851 3300007076 Bacteria 1583
186 Ga0099794_10011684 3300007265 Archaea 3767
187 Ga0099794_10022588 3300007265 Archaea 2869
188 Ga0099794_10065464 3300007265 Unclassified 1772
189 Ga0105240_10236685 3300009093 Bacteria 2119
190 Ga0105240_10617408 3300009093 Unclassified 1192
191 Ga0111539_10005299 3300009094 Bacteria 16694
192 Ga0111539_10045144 3300009094 Bacteria 5276
193 Ga0111539_10156138 3300009094 Bacteria 2670
194 Ga0105245_10167364 3300009098 Bacteria 2091
195 Ga0105247_10002830 3300009101 Bacteria 11583
196 Ga0105247_10007321 3300009101 Bacteria 6783
197 Ga0114129_10005751 3300009147 Bacteria 17567
198 Ga0114129_10010681 3300009147 Bacteria 13097
199 Ga0114129_10041180 3300009147 Bacteria 6510
200 Ga0114129_10075146 3300009147 Unclassified 4705
201 Ga0114129_10237066 3300009147 Bacteria 2454
202 Ga0114129_10426372 3300009147 Bacteria 1744
203 Ga0114129_10872807 3300009147 Unclassified 1142
204 Ga0105243_10158978 3300009148 Bacteria 1946
205 Ga0105241_10006633 3300009174 Bacteria 8531
206 Ga0105241_10009886 3300009174 Bacteria 7013
207 Ga0105241_10442950 3300009174 Bacteria 1148
208 Ga0105242_10001476 3300009176 Bacteria 18511
209 Ga0105242_10026239 3300009176 Bacteria 4617
210 Ga0105242_10102528 3300009176 Bacteria 2427
211 Ga0105248_10006829 3300009177 Bacteria 12508
212 Ga0105248_10035311 3300009177 Bacteria 5592
213 Ga0105248_10062130 3300009177 Bacteria 4195
214 Ga0105248_10578334 3300009177 Bacteria 1267
215 Ga0105248_10665893 3300009177 Bacteria 1174
216 Ga0105237_10051731 3300009545 Bacteria 4125
217 Ga0105237_10180090 3300009545 Bacteria 2114
218 Ga0105249_10131317 3300009553 Bacteria 2391
219 Ga0105249_10382275 3300009553 Unclassified 1434
220 Ga0105249_10716217 3300009553 Bacteria 1061
221 Ga0105239_10007305 3300010375 Bacteria 12684
222 Ga0105246_10085122 3300011119 Bacteria 2263
223 Ga0157373_10046596 3300013100 Bacteria 3094
224 Ga0157371_10016533 3300013102 Bacteria 5502
225 Ga0157369_10098348 3300013105 Unclassified 3121
226 Ga0157374_10005661 3300013296 Bacteria 10535
227 Ga0157374_10033595 3300013296 Unclassified 4681
228 Ga0157378_10513682 3300013297 Bacteria 1198
229 Ga0163162_10052040 3300013306 Bacteria 4111
230 Ga0157372_10006110 3300013307 Bacteria 12795
231 Ga0157375_10561649 3300013308 Bacteria 1302
232 Ga0157375_10579935 3300013308 Unclassified 1282
233 Ga0163163_10009894 3300014325 Bacteria 8547
234 Ga0163163_10017888 3300014325 Bacteria 6619
235 Ga0163163_10022475 3300014325 Bacteria 5974
236 Ga0157380_10061929 3300014326 Unclassified 2996
237 Ga0157380_10091058 3300014326 Bacteria 2517
238 Ga0157380_10183278 3300014326 Unclassified 1841
239 Ga0182008_10005138 3300014497 Bacteria 7510
240 Ga0157377_10001393 3300014745 Bacteria 10418
241 Ga0157379_10010247 3300014968 Bacteria 8162
242 Ga0157379_10041157 3300014968 Bacteria 4125
243 Ga0157379_10044629 3300014968 Bacteria 3957
244 Ga0157376_10059306 3300014969 Bacteria 3209
245 Ga0182006_1012687 3300015261 Bacteria 3682
246 Ga0182007_10006056 3300015262 Bacteria 5229
247 Ga0163161_10005357 3300017792 Bacteria 8917
248 Ga0163161_10100845 3300017792 Bacteria 2149
249 Ga0207697_10016900 3300025315 Bacteria 3002
250 Ga0207697_10043576 3300025315 Bacteria 1845
251 Ga0207656_10026595 3300025321 Bacteria 2361
252 Ga0207682_10006511 3300025893 Bacteria 4698
253 Ga0207642_10039881 3300025899 Bacteria 2045
254 Ga0207688_10036822 3300025901 Bacteria 2712
255 Ga0207680_10018814 3300025903 Bacteria 3681
256 Ga0207680_10276239 3300025903 Unclassified 1166
257 Ga0207647_10007784 3300025904 Bacteria 7712
258 Ga0207645_10000038 3300025907 Bacteria 88349
259 Ga0207645_10136834 3300025907 Bacteria 1595
260 Ga0207643_10000356 3300025908 Bacteria 30695
261 Ga0207684_10015030 3300025910 Bacteria 6664
262 Ga0207684_10032574 3300025910 Unclassified 4431
263 Ga0207684_10138773 3300025910 Bacteria 2089
264 Ga0207654_10174097 3300025911 Bacteria 1400
265 Ga0207654_10179544 3300025911 Archaea 1380
266 Ga0207707_10145447 3300025912 Archaea 2072
267 Ga0207695_10128609 3300025913 Bacteria 2492
268 Ga0207695_10504137 3300025913 Unclassified 1092
269 Ga0207671_10196898 3300025914 Bacteria 1572
270 Ga0207660_10304936 3300025917 Bacteria 1269
271 Ga0207662_10004835 3300025918 Bacteria 7124
272 Ga0207662_10021788 3300025918 Bacteria 3667
273 Ga0207657_10000363 3300025919 Bacteria 47701
274 Ga0207657_10001679 3300025919 Bacteria 23885
275 Ga0207646_10000001 3300025922 Bacteria 1242027
276 Ga0207646_10017588 3300025922 Bacteria 6682
277 Ga0207646_10021133 3300025922 Bacteria 6020
278 Ga0207646_10056043 3300025922 Bacteria 3524
279 Ga0207646_10080512 3300025922 Unclassified 2912
280 Ga0207646_10097655 3300025922 Unclassified 2632
281 Ga0207646_10098021 3300025922 Bacteria 2627
282 Ga0207646_10174217 3300025922 Bacteria 1943
283 Ga0207646_10182815 3300025922 Bacteria 1894
284 Ga0207646_10342260 3300025922 Unclassified 1351
285 Ga0207646_10342583 3300025922 Bacteria 1351
286 Ga0207646_10535689 3300025922 Bacteria 1053
287 Ga0207681_10038320 3300025923 Bacteria 3175
288 Ga0207681_10079275 3300025923 Bacteria 2313
289 Ga0207681_10082727 3300025923 Bacteria 2270
290 Ga0207681_10313079 3300025923 Bacteria 1246
291 Ga0207681_10443167 3300025923 Unclassified 1055
292 Ga0207650_10000122 3300025925 Bacteria 99309
293 Ga0207659_10032897 3300025926 Bacteria 3563
294 Ga0207687_10053015 3300025927 Bacteria 2832
295 Ga0207687_10146081 3300025927 Bacteria 1799
296 Ga0207700_10052462 3300025928 Bacteria 3049
297 Ga0207644_10024793 3300025931 Bacteria 4120
298 Ga0207644_10094051 3300025931 Unclassified 2238
299 Ga0207644_10289610 3300025931 Bacteria 1317
300 Ga0207644_10311312 3300025931 Bacteria 1271
301 Ga0207706_10001660 3300025933 Bacteria 21985
302 Ga0207706_10422890 3300025933 Bacteria 1154
303 Ga0207686_10014167 3300025934 Bacteria 4432
304 Ga0207670_10022498 3300025936 Bacteria 3908
305 Ga0207670_10096955 3300025936 Unclassified 2098
306 Ga0207669_10172024 3300025937 Unclassified 1543
307 Ga0207704_10006054 3300025938 Bacteria 5607
308 Ga0207665_10084347 3300025939 Unclassified 2192
309 Ga0207665_10217629 3300025939 Bacteria 1398
310 Ga0207691_10000912 3300025940 Bacteria 29285
311 Ga0207691_10012545 3300025940 Bacteria 8124
312 Ga0207711_10086860 3300025941 Bacteria 2743
313 Ga0207711_10311966 3300025941 Bacteria 1452
314 Ga0207711_10493174 3300025941 Bacteria 1141
315 Ga0207689_10001175 3300025942 Bacteria 25227
316 Ga0207661_10000202 3300025944 Bacteria 38539
317 Ga0207679_10000070 3300025945 Bacteria 91501
318 Ga0207667_10052845 3300025949 Bacteria 4277
319 Ga0207667_10129000 3300025949 Bacteria 2604
320 Ga0207651_10035578 3300025960 Unclassified 3241
321 Ga0207651_10069814 3300025960 Unclassified 2482
322 Ga0207651_10192530 3300025960 Bacteria 1628
323 Ga0207712_10210261 3300025961 Unclassified 1549
324 Ga0207712_10293762 3300025961 Bacteria 1331
325 Ga0207712_10454670 3300025961 Bacteria 1087
326 Ga0207640_10004668 3300025981 Bacteria 7436
327 Ga0207658_10686797 3300025986 Bacteria 924
328 Ga0207677_10071985 3300026023 Bacteria 2442
329 Ga0207703_10007478 3300026035 Bacteria 8677
330 Ga0207703_10031657 3300026035 Unclassified 4184
331 Ga0207703_10083139 3300026035 Unclassified 2674
332 Ga0207639_10154730 3300026041 Bacteria 1925
333 Ga0207678_10021283 3300026067 Bacteria 5686
334 Ga0207708_10319606 3300026075 Bacteria 1266
335 Ga0207641_10000020 3300026088 Bacteria 286415
336 Ga0207641_10001307 3300026088 Bacteria 24663
337 Ga0207648_10000218 3300026089 Bacteria 61980
338 Ga0207648_10010564 3300026089 Bacteria 8738
339 Ga0207676_10000101 3300026095 Bacteria 77252
340 Ga0207674_10009598 3300026116 Bacteria 11039
341 Ga0207675_100004696 3300026118 Bacteria 13148
342 Ga0207675_100158293 3300026118 Bacteria 2159
343 Ga0207675_100397291 3300026118 Bacteria 1358
344 Ga0209588_1000089 3300027671 Unclassified 29121
345 Ga0207428_10102101 3300027907 Bacteria 2215
346 Ga0268266_10002004 3300028379 Bacteria 22766
347 Ga0268266_10085931 3300028379 Bacteria 2749
348 Ga0268266_10150748 3300028379 Bacteria 2095
349 Ga0268265_10009251 3300028380 Bacteria 6659
350 Ga0268265_10041907 3300028380 Bacteria 3392
351 Ga0268264_10225423 3300028381 Bacteria 1728
352 Ga0268264_10519216 3300028381 Bacteria 1164
353 Ga0265338_10015603 3300028800 Bacteria 8325
354 Ga0265338_10043917 3300028800 Bacteria 4136
355 Ga0265316_10065670 3300031344 Bacteria 2810
356 Ga0307508_10024997 3300031616 Bacteria 5418
357 Ga0265342_10038193 3300031712 Bacteria 2926
358 Ga0373930_0000623 3300034816 Bacteria 4920
359 Ga0373948_0016596 3300034817 Bacteria 1363
360 Ga0373950_0001287 3300034818 Bacteria 3248
361 Ga0373959_0006490 3300034820 Bacteria 1943
362 Ga0373928_0000435 3300035084 Bacteria 8318
363 Ga0373940_0014909 3300035088 Bacteria 1903
364 Ga0373949_0003950 3300035090 Bacteria 3443
365 Ga0373951_0002153 3300035091 Bacteria 5023
366 Ga0373952_0000683 3300035092 Bacteria 6022
367 Ga0373932_0000376 3300035112 Bacteria 13709
368 Ga0373932_0096025 3300035112 Bacteria 958
369 Ga0373939_0007173 3300035114 Bacteria 2703
370 Ga0373941_0006861 3300035115 Unclassified 2762
371 Ga0373941_0016751 3300035115 Bacteria 1997
372 Ga0373945_0010267 3300035116 Bacteria 3081
373 Ga0373943_0024096 3300035170 Unclassified 2836
374 Ga0373961_0026197 3300035241 Bacteria 1591
375 Ga0373962_0081600 3300035242 Bacteria 982
376 Ga0373924_0043184 3300035410 Unclassified 1851
377 Ga0373931_0030416 3300035691 Bacteria 2779
378 Ga0373931_0187277 3300035691 Unclassified 1229
379 Ga0373927_0153245 3300035695 Bacteria 1509
380 Ga0373947_0383619 3300035725 Bacteria 946
381 Ga0373937_0019398 3300036401 Bacteria 6087
382 Ga0373925_0167988 3300037068 Bacteria 1731
383 Ga0436365_0146413 3300039437 Bacteria 6608
384 Ga0451577_0164514 3300042876 Bacteria 1999
385 Ga0466966_0036375 3300044684 Bacteria 3179
386 Ga0466963_0024788 3300044694 Bacteria 3820
387 Ga0451576_0010483 3300045051 Bacteria 10625
388 Ga0451576_0081667 3300045051 Bacteria 3362
389 Ga0451576_0198299 3300045051 Bacteria 2097
390 Ga0451576_0669671 3300045051 Unclassified 1090
391 Ga0466967_0177907 3300045976 Bacteria 2005
392 Ga0495580_0000542 3300046472 Bacteria 31897
393 Ga0495580_0052723 3300046472 Bacteria 2872
394 Ga0495582_0201364 3300046473 Unclassified 1137
395 Ga0495662_0032759 3300046476 Bacteria 2511
396 Ga0495645_0001057 3300046543 Bacteria 18749
397 Ga0495667_0064783 3300046559 Bacteria 2390
398 Ga0495656_0268803 3300046615 Unclassified 866
399 Ga0495635_0239410 3300046663 Bacteria 1225
400 Ga0495635_0287291 3300046663 Archaea 1104
401 Ga0495659_0116217 3300046664 Bacteria 1049
402 Ga0495647_0006638 3300046681 Unclassified 3842
403 Ga0495658_0004944 3300046683 Bacteria 6537
404 Ga0495604_0146390 3300047317 Unclassified 1683
405 Ga0495676_0276905 3300047321 Bacteria 1137
406 Ga0496102_0141284 3300048905 Bacteria 2258
407 Ga0496104_0009301 3300048907 Bacteria 8740
408 Ga0496108_0000948 3300048911 Bacteria 22529
409 Ga0496108_0006011 3300048911 Bacteria 9830
410 Ga0496109_0000018 3300048912 Bacteria 191977
411 Ga0496109_0137686 3300048912 Unclassified 2282
412 Ga0496110_0000049 3300048913 Bacteria 59257
413 Ga0496111_0007938 3300048914 Bacteria 6998
414 Ga0496112_0000058 3300048915 Bacteria 76327
415 Ga0496112_0004837 3300048915 Bacteria 11498
416 Ga0496112_0269839 3300048915 Bacteria 1650
417 Ga0496112_0649867 3300048915 Bacteria 984
418 Ga0496113_0000103 3300048916 Bacteria 36181
419 Ga0496114_0075502 3300048917 Bacteria 2839
420 Ga0496114_0124975 3300048917 Bacteria 2216
421 Ga0496114_0295906 3300048917 Bacteria 1429
422 Ga0501067_0122054 3300049583 Bacteria 1450
423 nmdc:mga05p37_10168_c1 3300050507 Bacteria 11168
424 nmdc:mga05p37_146097_c1 3300050507 Bacteria 2896
425 nmdc:mga05p37_17149_c1 3300050507 Bacteria 8737
426 nmdc:mga05p37_17707_c1 3300050507 Bacteria 8597
427 nmdc:mga05p37_285030_c1 3300050507 Bacteria 1968
428 nmdc:mga05p37_36561_c1 3300050507 Bacteria 6023
429 nmdc:mga05p37_42761_c1 3300050507 Bacteria 5569
430 nmdc:mga05p37_66838_c1 3300050507 Bacteria 4422
431 nmdc:mga09592_344316_c1 3300050508 Bacteria 1290
432 nmdc:mga0qj67_116762_c1 3300050509 Bacteria 2156
433 nmdc:mga08y16_372001_c1 3300050511 Bacteria 1466
434 nmdc:mga08y16_91478_c1 3300050511 Bacteria 3171
435 nmdc:mga0n895_144995_c1 3300050512 Bacteria 2404
436 nmdc:mga0n895_149007_c1 3300050512 Bacteria 2369
437 nmdc:mga0n895_21580_c1 3300050512 Bacteria 6026
438 nmdc:mga0n895_39220_c1 3300050512 Bacteria 4594
439 nmdc:mga0n895_531_c1 3300050512 Bacteria 25976
440 nmdc:mga0n895_54153_c1 3300050512 Bacteria 3945
441 nmdc:mga0n895_678701_c1 3300050512 Bacteria 1027
442 nmdc:mga0n895_88288_c1 3300050512 Bacteria 3100
443 nmdc:mga0rr50_12252_c1 3300050513 Bacteria 5531
444 nmdc:mga0rr50_166692_c1 3300050513 Bacteria 1792
445 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
446 nmdc:mga0rr50_36163_c1 3300050513 Bacteria 3554
447 nmdc:mga0rr50_36170_c1 3300050513 Bacteria 3553
448 nmdc:mga0rr50_38288_c1 3300050513 Bacteria 3469
449 nmdc:mga08x19_105473_c1 3300050514 Bacteria 1874
450 nmdc:mga08x19_311_c1 3300050514 Bacteria 35355
451 nmdc:mga08x19_43196_c1 3300050514 Bacteria 2876
452 nmdc:mga08x19_49064_c1 3300050514 Bacteria 2706
453 nmdc:mga08x19_84947_c1 3300050514 Bacteria 2083
454 nmdc:mga08x19_9146_c1 3300050514 Bacteria 5915
455 nmdc:mga0a205_129295_c1 3300050515 Bacteria 2426
456 nmdc:mga0a205_252554_c1 3300050515 Bacteria 1642
457 nmdc:mga0a205_29479_c1 3300050515 Bacteria 5252
458 nmdc:mga0a205_41070_c1 3300050515 Bacteria 4454
459 nmdc:mga0a205_57054_c1 3300050515 Bacteria 3770
460 nmdc:mga0a205_8724_c1 3300050515 Bacteria 9233
461 Ga0495595_0014096 3300053084 Bacteria 3386
462 Ga0495619_0042151 3300053085 Bacteria 2988
463 Ga0373953_0016460
464 MBSR1b_contig_13653150
465 MBSR1b_contig_8385164
466 JGI24748J21848_1008811
467 Ga0065715_10023604
468 Ga0070683_100003503
469 Ga0070690_100072756
470 Ga0070690_100124947
471 Ga0070670_100033063
472 Ga0070670_100115149
473 Ga0068869_100152277
474 Ga0070666_10004740
475 Ga0070666_10231732
476 Ga0070680_100539719
477 Ga0068868_100003051
478 Ga0068868_100556178
479 Ga0070660_100018415
480 Ga0070660_100021327
481 Ga0070689_100164702
482 Ga0070689_100237954
483 Ga0070687_100018434
484 Ga0070687_100145540
485 Ga0070668_100007490
486 Ga0070668_100224858
487 Ga0070669_100006472
488 Ga0070669_100053320
489 Ga0070669_100053636
490 Ga0070669_100089784
491 Ga0070669_100355170
492 Ga0070669_100601653
493 Ga0070675_100045825
494 Ga0070675_100222950
495 Ga0070671_100052644
496 Ga0070671_100384328
497 Ga0070674_100017750
498 Ga0070673_100018558
499 Ga0070673_100144928
500 Ga0070688_100005943
501 Ga0070688_100012735
502 Ga0070688_100060805
503 Ga0070659_100076168
504 Ga0070659_100276210
505 Ga0070667_100023865
506 Ga0070713_100024085
507 Ga0070713_100079012
508 Ga0070701_10170065
509 Ga0070711_100060560
510 Ga0070711_100097461
511 Ga0070705_100021567
512 Ga0070705_100044335
513 Ga0070705_100072048
514 Ga0070700_100027766
515 Ga0070694_100054715
516 Ga0070694_100232295
517 Ga0070708_100067872
518 Ga0070708_100119484
519 Ga0070708_100156021
520 Ga0070708_100183560
521 Ga0070708_100187586
522 Ga0070708_100293024
523 Ga0070708_100423873
524 Ga0070708_100576355
525 Ga0070663_100026915
526 Ga0070662_100120373
527 Ga0070681_10082705
528 Ga0068867_100067186
529 Ga0068867_100286110
530 Ga0070685_10001575
531 Ga0070685_10071436
532 Ga0070706_100002753
533 Ga0070706_100017448
534 Ga0070706_100152420
535 Ga0070706_100605123
536 Ga0070706_100606393
537 Ga0070707_100000017
538 Ga0070707_100007175
539 Ga0070707_100022619
540 Ga0070707_100117873
541 Ga0070707_100118232
542 Ga0070707_100290086
543 Ga0070707_100394975
544 Ga0070698_100121360
545 Ga0070699_100000615
546 Ga0070699_100005121
547 Ga0070699_100024526
548 Ga0070699_100024655
549 Ga0070699_100036511
550 Ga0070684_100003336
551 Ga0070697_100000248
552 Ga0070697_100004972
553 Ga0070697_100010483
554 Ga0070697_100048655
555 Ga0070697_100094324
556 Ga0070697_100118833
557 Ga0068853_100161625
558 Ga0068853_100509088
559 Ga0070672_100077857
560 Ga0070686_100007525
561 Ga0070686_100043230
562 Ga0070686_100125293
563 Ga0070686_100140329
564 Ga0070686_100321824
565 Ga0070695_100005801
566 Ga0070695_100096631
567 Ga0070696_100047954
568 Ga0070693_100080261
569 Ga0070665_100008991
570 Ga0070704_100007922
571 Ga0070704_100053874
572 Ga0070704_100092183
573 Ga0068855_100025620
574 Ga0068855_100128354
575 Ga0070664_100020903
576 Ga0068857_100002334
577 Ga0068854_100002370
578 Ga0068854_100053488
579 Ga0068856_100017444
580 Ga0070702_100002485
581 Ga0068852_100080425
582 Ga0068852_100341650
583 Ga0068859_100194053
584 Ga0068864_100061374
585 Ga0068864_100069659
586 Ga0068866_10003387
587 Ga0068866_10154136
588 Ga0068861_100093439
589 Ga0068861_100282255
590 Ga0068861_100337396
591 Ga0068851_10001017
592 Ga0068870_10002460
593 Ga0068863_100070996
594 Ga0068863_100120953
595 Ga0068858_100009134
596 Ga0068858_100009368
597 Ga0068858_100070387
598 Ga0068860_100035926
599 Ga0068860_100319227
600 Ga0068862_100010420
601 Ga0068862_100077131
602 Ga0068862_100084220
603 Ga0068862_100203147
604 Ga0081539_10101259
605 Ga0070717_10010700
606 Ga0070716_100153217
607 Ga0070716_100182224
608 Ga0097621_100002630
609 Ga0097621_100101422
610 Ga0097621_100354282
611 Ga0068871_100109499
612 Ga0075428_100097977
613 Ga0075428_100101432
614 Ga0075428_100604859
615 Ga0075430_100115976
616 Ga0075433_10009607
617 Ga0075433_10047699
618 Ga0075433_10085864
619 Ga0075433_10397177
620 Ga0075434_100000719
621 Ga0075434_100018258
622 Ga0075434_100022845
623 Ga0075434_100027600
624 Ga0075434_100036522
625 Ga0075434_100138984
626 Ga0075434_100275857
627 Ga0075434_100347950
628 Ga0075434_100510445
629 Ga0075429_100395104
630 Ga0068865_100021867
631 Ga0068865_100207647
632 Ga0075436_100000203
633 Ga0075436_100001685
634 Ga0075436_100055328
635 Ga0075436_100068966
636 Ga0075436_100089286
637 Ga0075436_100091521
638 Ga0075436_100128607
639 Ga0097620_100156147
640 Ga0097620_100194059
641 Ga0075435_100000012
642 Ga0075435_100012243
643 Ga0075435_100018030
644 Ga0075435_100037395
645 Ga0075435_100037412
646 Ga0075435_100053767
647 Ga0075435_100227851
648 Ga0099794_10011684
649 Ga0099794_10022588
650 Ga0099794_10065464
651 Ga0105240_10236685
652 Ga0105240_10617408
653 Ga0111539_10005299
654 Ga0111539_10045144
655 Ga0111539_10156138
656 Ga0105245_10167364
657 Ga0105247_10002830
658 Ga0105247_10007321
659 Ga0114129_10005751
660 Ga0114129_10010681
661 Ga0114129_10041180
662 Ga0114129_10075146
663 Ga0114129_10237066
664 Ga0114129_10426372
665 Ga0114129_10872807
666 Ga0105243_10158978
667 Ga0105241_10006633
668 Ga0105241_10009886
669 Ga0105241_10442950
670 Ga0105242_10001476
671 Ga0105242_10026239
672 Ga0105242_10102528
673 Ga0105248_10006829
674 Ga0105248_10035311
675 Ga0105248_10062130
676 Ga0105248_10578334
677 Ga0105248_10665893
678 Ga0105237_10051731
679 Ga0105237_10180090
680 Ga0105249_10131317
681 Ga0105249_10382275
682 Ga0105249_10716217
683 Ga0105239_10007305
684 Ga0105246_10085122
685 Ga0157373_10046596
686 Ga0157371_10016533
687 Ga0157369_10098348
688 Ga0157374_10005661
689 Ga0157374_10033595
690 Ga0157378_10513682
691 Ga0163162_10052040
692 Ga0157372_10006110
693 Ga0157375_10561649
694 Ga0157375_10579935
695 Ga0163163_10009894
696 Ga0163163_10017888
697 Ga0163163_10022475
698 Ga0157380_10061929
699 Ga0157380_10091058
700 Ga0157380_10183278
701 Ga0182008_10005138
702 Ga0157377_10001393
703 Ga0157379_10010247
704 Ga0157379_10041157
705 Ga0157379_10044629
706 Ga0157376_10059306
707 Ga0182006_1012687
708 Ga0182007_10006056
709 Ga0163161_10005357
710 Ga0163161_10100845
711 Ga0207697_10016900
712 Ga0207697_10043576
713 Ga0207656_10026595
714 Ga0207682_10006511
715 Ga0207642_10039881
716 Ga0207688_10036822
717 Ga0207680_10018814
718 Ga0207680_10276239
719 Ga0207647_10007784
720 Ga0207645_10000038
721 Ga0207645_10136834
722 Ga0207643_10000356
723 Ga0207684_10015030
724 Ga0207684_10032574
725 Ga0207684_10138773
726 Ga0207654_10174097
727 Ga0207654_10179544
728 Ga0207707_10145447
729 Ga0207695_10128609
730 Ga0207695_10504137
731 Ga0207671_10196898
732 Ga0207660_10304936
733 Ga0207662_10004835
734 Ga0207662_10021788
735 Ga0207657_10000363
736 Ga0207657_10001679
737 Ga0207646_10000001
738 Ga0207646_10017588
739 Ga0207646_10021133
740 Ga0207646_10056043
741 Ga0207646_10080512
742 Ga0207646_10097655
743 Ga0207646_10098021
744 Ga0207646_10174217
745 Ga0207646_10182815
746 Ga0207646_10342260
747 Ga0207646_10342583
748 Ga0207646_10535689
749 Ga0207681_10038320
750 Ga0207681_10079275
751 Ga0207681_10082727
752 Ga0207681_10313079
753 Ga0207681_10443167
754 Ga0207650_10000122
755 Ga0207659_10032897
756 Ga0207687_10053015
757 Ga0207687_10146081
758 Ga0207700_10052462
759 Ga0207644_10024793
760 Ga0207644_10094051
761 Ga0207644_10289610
762 Ga0207644_10311312
763 Ga0207706_10001660
764 Ga0207706_10422890
765 Ga0207686_10014167
766 Ga0207670_10022498
767 Ga0207670_10096955
768 Ga0207669_10172024
769 Ga0207704_10006054
770 Ga0207665_10084347
771 Ga0207665_10217629
772 Ga0207691_10000912
773 Ga0207691_10012545
774 Ga0207711_10086860
775 Ga0207711_10311966
776 Ga0207711_10493174
777 Ga0207689_10001175
778 Ga0207661_10000202
779 Ga0207679_10000070
780 Ga0207667_10052845
781 Ga0207667_10129000
782 Ga0207651_10035578
783 Ga0207651_10069814
784 Ga0207651_10192530
785 Ga0207712_10210261
786 Ga0207712_10293762
787 Ga0207712_10454670
788 Ga0207640_10004668
789 Ga0207658_10686797
790 Ga0207677_10071985
791 Ga0207703_10007478
792 Ga0207703_10031657
793 Ga0207703_10083139
794 Ga0207639_10154730
795 Ga0207678_10021283
796 Ga0207708_10319606
797 Ga0207641_10000020
798 Ga0207641_10001307
799 Ga0207648_10000218
800 Ga0207648_10010564
801 Ga0207676_10000101
802 Ga0207674_10009598
803 Ga0207675_100004696
804 Ga0207675_100158293
805 Ga0207675_100397291
806 Ga0209588_1000089
807 Ga0207428_10102101
808 Ga0268266_10002004
809 Ga0268266_10085931
810 Ga0268266_10150748
811 Ga0268265_10009251
812 Ga0268265_10041907
813 Ga0268264_10225423
814 Ga0268264_10519216
815 Ga0265338_10015603
816 Ga0265338_10043917
817 Ga0265316_10065670
818 Ga0307508_10024997
819 Ga0265342_10038193
820 Ga0373930_0000623
821 Ga0373948_0016596
822 Ga0373950_0001287
823 Ga0373959_0006490
824 Ga0373928_0000435
825 Ga0373940_0014909
826 Ga0373949_0003950
827 Ga0373951_0002153
828 Ga0373952_0000683
829 Ga0373932_0000376
830 Ga0373932_0096025
831 Ga0373939_0007173
832 Ga0373941_0006861
833 Ga0373941_0016751
834 Ga0373945_0010267
835 Ga0373943_0024096
836 Ga0373961_0026197
837 Ga0373962_0081600
838 Ga0373924_0043184
839 Ga0373931_0030416
840 Ga0373931_0187277
841 Ga0373927_0153245
842 Ga0373947_0383619
843 Ga0373937_0019398
844 Ga0373925_0167988
845 Ga0436365_0146413
846 Ga0451577_0164514
847 Ga0466966_0036375
848 Ga0466963_0024788
849 Ga0451576_0010483
850 Ga0451576_0081667
851 Ga0451576_0198299
852 Ga0451576_0669671
853 Ga0466967_0177907
854 Ga0495580_0000542
855 Ga0495580_0052723
856 Ga0495582_0201364
857 Ga0495662_0032759
858 Ga0495645_0001057
859 Ga0495667_0064783
860 Ga0495656_0268803
861 Ga0495635_0239410
862 Ga0495635_0287291
863 Ga0495659_0116217
864 Ga0495647_0006638
865 Ga0495658_0004944
866 Ga0495604_0146390
867 Ga0495676_0276905
868 Ga0496102_0141284
869 Ga0496104_0009301
870 Ga0496108_0000948
871 Ga0496108_0006011
872 Ga0496109_0000018
873 Ga0496109_0137686
874 Ga0496110_0000049
875 Ga0496111_0007938
876 Ga0496112_0000058
877 Ga0496112_0004837
878 Ga0496112_0269839
879 Ga0496112_0649867
880 Ga0496113_0000103
881 Ga0496114_0075502
882 Ga0496114_0124975
883 Ga0496114_0295906
884 Ga0501067_0122054
885 nmdc:mga05p37_10168_c1
886 nmdc:mga05p37_146097_c1
887 nmdc:mga05p37_17149_c1
888 nmdc:mga05p37_17707_c1
889 nmdc:mga05p37_285030_c1
890 nmdc:mga05p37_36561_c1
891 nmdc:mga05p37_42761_c1
892 nmdc:mga05p37_66838_c1
893 nmdc:mga09592_344316_c1
894 nmdc:mga0qj67_116762_c1
895 nmdc:mga08y16_372001_c1
896 nmdc:mga08y16_91478_c1
897 nmdc:mga0n895_144995_c1
898 nmdc:mga0n895_149007_c1
899 nmdc:mga0n895_21580_c1
900 nmdc:mga0n895_39220_c1
901 nmdc:mga0n895_531_c1
902 nmdc:mga0n895_54153_c1
903 nmdc:mga0n895_678701_c1
904 nmdc:mga0n895_88288_c1
905 nmdc:mga0rr50_12252_c1
906 nmdc:mga0rr50_166692_c1
907 nmdc:mga0rr50_1_c1
908 nmdc:mga0rr50_36163_c1
909 nmdc:mga0rr50_36170_c1
910 nmdc:mga0rr50_38288_c1
911 nmdc:mga08x19_105473_c1
912 nmdc:mga08x19_311_c1
913 nmdc:mga08x19_43196_c1
914 nmdc:mga08x19_49064_c1
915 nmdc:mga08x19_84947_c1
916 nmdc:mga08x19_9146_c1
917 nmdc:mga0a205_129295_c1
918 nmdc:mga0a205_252554_c1
919 nmdc:mga0a205_29479_c1
920 nmdc:mga0a205_41070_c1
921 nmdc:mga0a205_57054_c1
922 nmdc:mga0a205_8724_c1
923 Ga0495595_0014096
924 Ga0495619_0042151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

65

306

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9364 7 271
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9333 5 271
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9198 6 271
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9167 5 271
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9131 7 271
ID Description Score Start End Superfamily
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.939 6 229 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.93 5 229 3.20.20.60
4lsbB02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9066 231 271 6.10.250.2750
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9065 5 229 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9038 6 229 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2V9VID8-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.9898 3 269 GO:0008168
GO:0032259
AF-A0A1M5JQ00-F1-model_v4 2-Methylisocitrate lyase, PEP mutase family 0.9774 3 270 GO:0016829
AF-A0A1M4XR86-F1-model_v4 2-Methylisocitrate lyase, PEP mutase family 0.9764 7 271 GO:0016829
AF-A0A2V9VBQ8-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.976 5 234 GO:0003824
AF-A0A2V9GME5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9756 1 269 GO:0003824

Map