F448763

General Info

Members Datasets Scaffolds Average Seq Length
461 164 922 198

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10034342|Ga0265342_100343422
Length 204
Sequence MIRDVARLLVFSDIHNDARALQKLMAVEADYYFAAGDLVSWGRGLDQMGDIMKPRARQVYVLPGNHESESDIAAFCKQFGFTNFHGATLDIAGVQVAGLGYSSPTPFDTPGEYTEEEMAQRLAKLGKPDVLICHAPPLDTPLDRVHEGLHAGSRAVRECLEKHQPQHFFCGHIHEAEGVVVQMGATRAMNVGKRGYLLTLQPQA

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 28.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10034342 3300031712 Bacteria 3112
2 Ga0070658_10120310 3300005327 Bacteria 2181
3 Ga0070683_100000012 3300005329 Bacteria 274646
4 Ga0070683_100004646 3300005329 Bacteria 11347
5 Ga0070683_100029080 3300005329 Bacteria 5000
6 Ga0070683_100043356 3300005329 Bacteria 4146
7 Ga0070683_100045377 3300005329 Bacteria 4055
8 Ga0070683_100289181 3300005329 Unclassified 1559
9 Ga0070690_100039698 3300005330 Unclassified 2975
10 Ga0070690_100469174 3300005330 Unclassified 936
11 Ga0068869_100429648 3300005334 Bacteria 1091
12 Ga0070666_10013732 3300005335 Bacteria 5142
13 Ga0070666_10170161 3300005335 Unclassified 1526
14 Ga0070680_100009820 3300005336 Bacteria 7368
15 Ga0070680_100196007 3300005336 Bacteria 1703
16 Ga0070680_100553822 3300005336 Bacteria 986
17 Ga0068868_100036650 3300005338 Bacteria 3798
18 Ga0068868_100041738 3300005338 Bacteria 3575
19 Ga0068868_100162581 3300005338 Bacteria 1844
20 Ga0068868_100464290 3300005338 Bacteria 1103
21 Ga0068868_100478248 3300005338 Bacteria 1088
22 Ga0068868_100771651 3300005338 Bacteria 865
23 Ga0070660_100013469 3300005339 Bacteria 5868
24 Ga0070660_100019051 3300005339 Bacteria 5024
25 Ga0070660_100114413 3300005339 Bacteria 2149
26 Ga0070660_100530603 3300005339 Unclassified 981
27 Ga0070689_100559496 3300005340 Unclassified 986
28 Ga0070691_10000422 3300005341 Bacteria 15522
29 Ga0070661_100089968 3300005344 Bacteria 2273
30 Ga0070661_101230353 3300005344 Unclassified 627
31 Ga0070671_100057486 3300005355 Bacteria 3237
32 Ga0070673_100091499 3300005364 Bacteria 2487
33 Ga0070667_100056371 3300005367 Bacteria 3320
34 Ga0070667_100199378 3300005367 Unclassified 1776
35 Ga0070714_100467227 3300005435 Bacteria 1200
36 Ga0070713_100569669 3300005436 Bacteria 1074
37 Ga0070701_10094947 3300005438 Bacteria 1641
38 Ga0070711_100307882 3300005439 Bacteria 1262
39 Ga0070711_100314410 3300005439 Unclassified 1249
40 Ga0070711_100337198 3300005439 Unclassified 1209
41 Ga0070708_100149987 3300005445 Bacteria 2168
42 Ga0070681_10001569 3300005458 Bacteria 20292
43 Ga0070681_10014607 3300005458 Bacteria 7815
44 Ga0070681_10280258 3300005458 Bacteria 1578
45 Ga0070681_10319291 3300005458 Bacteria 1463
46 Ga0070681_10361077 3300005458 Unclassified 1363
47 Ga0070681_10512769 3300005458 Bacteria 1112
48 Ga0068867_100104117 3300005459 Bacteria 2171
49 Ga0068867_100162163 3300005459 Unclassified 1764
50 Ga0070706_100178183 3300005467 Bacteria 1984
51 Ga0070679_100001176 3300005530 Bacteria 22920
52 Ga0070679_100096169 3300005530 Bacteria 2949
53 Ga0070679_100199446 3300005530 Bacteria 1968
54 Ga0070684_100000013 3300005535 Bacteria 167281
55 Ga0070684_100000438 3300005535 Bacteria 28577
56 Ga0070684_100017016 3300005535 Bacteria 5958
57 Ga0070684_100073299 3300005535 Unclassified 3017
58 Ga0070684_100076046 3300005535 Bacteria 2963
59 Ga0070684_100108070 3300005535 Bacteria 2492
60 Ga0068853_100004235 3300005539 Bacteria 11075
61 Ga0068853_100029168 3300005539 Bacteria 4649
62 Ga0068853_100050405 3300005539 Bacteria 3582
63 Ga0068853_100377852 3300005539 Bacteria 1323
64 Ga0070695_100011385 3300005545 Bacteria 5321
65 Ga0070693_100080970 3300005547 Bacteria 1935
66 Ga0070665_100092050 3300005548 Bacteria 3037
67 Ga0068855_100001207 3300005563 Bacteria 32106
68 Ga0068855_100006707 3300005563 Bacteria 13971
69 Ga0068855_100016468 3300005563 Bacteria 8889
70 Ga0068855_100067573 3300005563 Bacteria 4163
71 Ga0068855_100251073 3300005563 Bacteria 1973
72 Ga0068855_100337090 3300005563 Bacteria 1663
73 Ga0070664_100101321 3300005564 Bacteria 2504
74 Ga0070664_100257228 3300005564 Unclassified 1570
75 Ga0070664_100360979 3300005564 Bacteria 1323
76 Ga0068857_100000835 3300005577 Bacteria 23082
77 Ga0068857_100001590 3300005577 Bacteria 18210
78 Ga0068857_100035966 3300005577 Bacteria 4387
79 Ga0068857_100037964 3300005577 Bacteria 4267
80 Ga0068854_100517026 3300005578 Bacteria 1008
81 Ga0068856_100001077 3300005614 Bacteria 28871
82 Ga0068856_100020201 3300005614 Bacteria 6469
83 Ga0068856_100034471 3300005614 Bacteria 4957
84 Ga0068856_100147016 3300005614 Bacteria 2364
85 Ga0068856_100287874 3300005614 Unclassified 1660
86 Ga0068856_100310339 3300005614 Bacteria 1595
87 Ga0068856_100366405 3300005614 Unclassified 1460
88 Ga0068852_100002181 3300005616 Bacteria 13423
89 Ga0068852_100009034 3300005616 Bacteria 7376
90 Ga0068852_100185983 3300005616 Unclassified 1956
91 Ga0068852_100902194 3300005616 Bacteria 901
92 Ga0068859_100031992 3300005617 Bacteria 5285
93 Ga0068859_100062031 3300005617 Bacteria 3768
94 Ga0068859_100291104 3300005617 Bacteria 1726
95 Ga0068859_100367401 3300005617 Bacteria 1534
96 Ga0068859_100765880 3300005617 Bacteria 1054
97 Ga0068859_100978861 3300005617 Unclassified 928
98 Ga0068864_100204904 3300005618 Unclassified 1814
99 Ga0068864_100276911 3300005618 Bacteria 1565
100 Ga0068864_100334942 3300005618 Bacteria 1425
101 Ga0068866_10154945 3300005718 Bacteria 1331
102 Ga0068866_10532106 3300005718 Unclassified 783
103 Ga0068863_100015331 3300005841 Bacteria 7365
104 Ga0068858_100032775 3300005842 Bacteria 4825
105 Ga0068858_100053735 3300005842 Bacteria 3725
106 Ga0068858_100085667 3300005842 Bacteria 2932
107 Ga0068858_100286696 3300005842 Bacteria 1569
108 Ga0068858_100617760 3300005842 Bacteria 1052
109 Ga0068860_100028289 3300005843 Bacteria 5395
110 Ga0068860_100145044 3300005843 Bacteria 2284
111 Ga0068860_100365759 3300005843 Bacteria 1422
112 Ga0068860_100618807 3300005843 Unclassified 1089
113 Ga0097621_100025224 3300006237 Unclassified 4649
114 Ga0097621_100055243 3300006237 Bacteria 3242
115 Ga0097621_100111064 3300006237 Unclassified 2316
116 Ga0097621_100126676 3300006237 Bacteria 2170
117 Ga0097621_100148968 3300006237 Bacteria 2006
118 Ga0097621_101371089 3300006237 Unclassified 669
119 Ga0068871_100027278 3300006358 Bacteria 4465
120 Ga0068871_100037616 3300006358 Unclassified 3860
121 Ga0068871_100077198 3300006358 Unclassified 2752
122 Ga0068871_100108205 3300006358 Bacteria 2336
123 Ga0068871_100234955 3300006358 Bacteria 1592
124 Ga0068871_100270686 3300006358 Bacteria 1484
125 Ga0068871_100420292 3300006358 Bacteria 1194
126 Ga0075434_100517816 3300006871 Bacteria 1213
127 Ga0075429_100098174 3300006880 Unclassified 2556
128 Ga0068865_100121001 3300006881 Bacteria 1946
129 Ga0068865_100224925 3300006881 Unclassified 1469
130 Ga0068865_100789324 3300006881 Unclassified 818
131 Ga0075436_100074936 3300006914 Bacteria 2343
132 Ga0097620_100031991 3300006931 Bacteria 5285
133 Ga0097620_100062031 3300006931 Bacteria 3768
134 Ga0097620_100291112 3300006931 Bacteria 1726
135 Ga0097620_100367383 3300006931 Bacteria 1534
136 Ga0097620_100765896 3300006931 Bacteria 1054
137 Ga0097620_100978883 3300006931 Unclassified 928
138 Ga0105240_10000894 3300009093 Bacteria 53314
139 Ga0105240_10004650 3300009093 Bacteria 20782
140 Ga0105240_10007794 3300009093 Bacteria 15472
141 Ga0105240_10065930 3300009093 Bacteria 4494
142 Ga0105240_10157879 3300009093 Bacteria 2696
143 Ga0105240_10184496 3300009093 Unclassified 2459
144 Ga0105240_10438824 3300009093 Unclassified 1463
145 Ga0105240_10643124 3300009093 Unclassified 1163
146 Ga0105240_10654290 3300009093 Unclassified 1151
147 Ga0105240_10722069 3300009093 Bacteria 1086
148 Ga0105240_11464296 3300009093 Unclassified 717
149 Ga0105245_10002252 3300009098 Bacteria 17473
150 Ga0105245_10006811 3300009098 Bacteria 10024
151 Ga0105245_10026477 3300009098 Bacteria 5104
152 Ga0105245_10041608 3300009098 Bacteria 4096
153 Ga0105245_10057943 3300009098 Bacteria 3486
154 Ga0105245_10064130 3300009098 Bacteria 3320
155 Ga0105245_10176481 3300009098 Unclassified 2038
156 Ga0105245_10274377 3300009098 Unclassified 1646
157 Ga0105245_10304194 3300009098 Bacteria 1565
158 Ga0105247_10124223 3300009101 Bacteria 1675
159 Ga0105247_10172279 3300009101 Unclassified 1440
160 Ga0114129_10268650 3300009147 Unclassified 2282
161 Ga0114129_10276247 3300009147 Unclassified 2246
162 Ga0105243_10126037 3300009148 Bacteria 2166
163 Ga0105243_10265822 3300009148 Unclassified 1538
164 Ga0105243_10322854 3300009148 Unclassified 1407
165 Ga0105241_10020067 3300009174 Bacteria 4936
166 Ga0105241_10066173 3300009174 Bacteria 2794
167 Ga0105241_10123100 3300009174 Bacteria 2091
168 Ga0105241_10153201 3300009174 Unclassified 1888
169 Ga0105241_10192292 3300009174 Unclassified 1699
170 Ga0105241_10480801 3300009174 Unclassified 1104
171 Ga0105241_10549592 3300009174 Unclassified 1037
172 Ga0105241_10647036 3300009174 Unclassified 960
173 Ga0105241_11205132 3300009174 Unclassified 717
174 Ga0105242_10008715 3300009176 Bacteria 7782
175 Ga0105242_10048196 3300009176 Bacteria 3463
176 Ga0105242_10060282 3300009176 Bacteria 3117
177 Ga0105242_10098729 3300009176 Bacteria 2470
178 Ga0105242_10121982 3300009176 Unclassified 2238
179 Ga0105242_10139303 3300009176 Unclassified 2103
180 Ga0105242_10191953 3300009176 Bacteria 1809
181 Ga0105242_10350323 3300009176 Unclassified 1364
182 Ga0105248_10038596 3300009177 Bacteria 5346
183 Ga0105248_10055813 3300009177 Bacteria 4431
184 Ga0105248_10074186 3300009177 Bacteria 3824
185 Ga0105248_10194215 3300009177 Unclassified 2287
186 Ga0105248_10452197 3300009177 Bacteria 1447
187 Ga0105248_11407136 3300009177 Unclassified 789
188 Ga0105237_10005245 3300009545 Bacteria 14664
189 Ga0105237_10016969 3300009545 Bacteria 7553
190 Ga0105237_10122270 3300009545 Unclassified 2597
191 Ga0105237_10539994 3300009545 Unclassified 1173
192 Ga0105238_10003059 3300009551 Bacteria 16677
193 Ga0105238_10016499 3300009551 Bacteria 7476
194 Ga0105238_10037688 3300009551 Bacteria 4914
195 Ga0105238_10066776 3300009551 Bacteria 3598
196 Ga0105238_10137343 3300009551 Unclassified 2422
197 Ga0105238_10206441 3300009551 Bacteria 1941
198 Ga0105238_10219903 3300009551 Bacteria 1875
199 Ga0105238_10264696 3300009551 Unclassified 1699
200 Ga0105249_10022293 3300009553 Bacteria 5673
201 Ga0105249_10197219 3300009553 Bacteria 1968
202 Ga0105239_10001226 3300010375 Bacteria 34944
203 Ga0105239_10013249 3300010375 Bacteria 9165
204 Ga0105239_10015246 3300010375 Bacteria 8516
205 Ga0105239_10018430 3300010375 Bacteria 7711
206 Ga0105239_10022290 3300010375 Bacteria 6982
207 Ga0105239_10107415 3300010375 Bacteria 3092
208 Ga0105246_10009977 3300011119 Bacteria 5859
209 Ga0105246_10026930 3300011119 Bacteria 3762
210 Ga0105246_11128122 3300011119 Unclassified 718
211 Ga0157373_10694620 3300013100 Bacteria 745
212 Ga0157370_10005388 3300013104 Bacteria 14354
213 Ga0157370_10005697 3300013104 Bacteria 13927
214 Ga0157370_10065660 3300013104 Bacteria 3433
215 Ga0157370_10093921 3300013104 Bacteria 2815
216 Ga0157369_10012537 3300013105 Bacteria 9616
217 Ga0157369_10016609 3300013105 Bacteria 8276
218 Ga0157369_10025527 3300013105 Bacteria 6559
219 Ga0157369_10027764 3300013105 Bacteria 6269
220 Ga0157369_10090152 3300013105 Bacteria 3274
221 Ga0157374_10002548 3300013296 Bacteria 15366
222 Ga0157374_10093573 3300013296 Bacteria 2870
223 Ga0157374_10152625 3300013296 Unclassified 2246
224 Ga0157374_10273318 3300013296 Bacteria 1666
225 Ga0157378_10029111 3300013297 Bacteria 4875
226 Ga0157378_10094482 3300013297 Bacteria 2722
227 Ga0157378_10245104 3300013297 Unclassified 1713
228 Ga0157378_10370766 3300013297 Unclassified 1403
229 Ga0157378_10463047 3300013297 Unclassified 1260
230 Ga0157378_10995342 3300013297 Unclassified 872
231 Ga0163162_10005058 3300013306 Bacteria 12703
232 Ga0163162_10023874 3300013306 Bacteria 6034
233 Ga0163162_10591441 3300013306 Bacteria 1236
234 Ga0163162_10980747 3300013306 Bacteria 955
235 Ga0163162_11611106 3300013306 Unclassified 741
236 Ga0157372_10006289 3300013307 Bacteria 12628
237 Ga0157372_10007430 3300013307 Bacteria 11654
238 Ga0157372_10310741 3300013307 Bacteria 1835
239 Ga0157372_10457522 3300013307 Unclassified 1487
240 Ga0157372_10589937 3300013307 Unclassified 1295
241 Ga0157375_10025562 3300013308 Bacteria 5489
242 Ga0157375_10131034 3300013308 Bacteria 2627
243 Ga0157375_10234262 3300013308 Unclassified 1995
244 Ga0157375_10688566 3300013308 Unclassified 1176
245 Ga0163163_10001395 3300014325 Bacteria 20392
246 Ga0163163_10028597 3300014325 Bacteria 5355
247 Ga0163163_10086337 3300014325 Bacteria 3147
248 Ga0163163_10205774 3300014325 Unclassified 2016
249 Ga0163163_10456654 3300014325 Bacteria 1338
250 Ga0163163_10619412 3300014325 Unclassified 1146
251 Ga0157379_10021657 3300014968 Bacteria 5692
252 Ga0157379_10108838 3300014968 Bacteria 2489
253 Ga0157379_10525365 3300014968 Bacteria 1099
254 Ga0157376_10014188 3300014969 Bacteria 5970
255 Ga0157376_10033113 3300014969 Bacteria 4156
256 Ga0157376_10596661 3300014969 Unclassified 1099
257 Ga0157376_10964784 3300014969 Unclassified 873
258 Ga0157376_11025723 3300014969 Unclassified 848
259 Ga0228598_1030994 3300024227 Unclassified 1052
260 Ga0207642_10033679 3300025899 Unclassified 2170
261 Ga0207680_10002365 3300025903 Bacteria 8780
262 Ga0207705_10044428 3300025909 Bacteria 3193
263 Ga0207684_10683359 3300025910 Unclassified 873
264 Ga0207654_10039608 3300025911 Bacteria 2651
265 Ga0207654_10125240 3300025911 Bacteria 1619
266 Ga0207654_10254804 3300025911 Unclassified 1178
267 Ga0207654_10274549 3300025911 Unclassified 1138
268 Ga0207707_10003367 3300025912 Bacteria 14187
269 Ga0207707_10012611 3300025912 Bacteria 7345
270 Ga0207707_10013097 3300025912 Bacteria 7225
271 Ga0207707_10070753 3300025912 Bacteria 3040
272 Ga0207707_10109581 3300025912 Unclassified 2414
273 Ga0207707_10227341 3300025912 Bacteria 1624
274 Ga0207695_10001639 3300025913 Bacteria 36154
275 Ga0207695_10005363 3300025913 Bacteria 17050
276 Ga0207695_10055021 3300025913 Bacteria 4150
277 Ga0207695_10193019 3300025913 Unclassified 1953
278 Ga0207695_10385848 3300025913 Unclassified 1286
279 Ga0207695_10426950 3300025913 Bacteria 1209
280 Ga0207671_10012157 3300025914 Bacteria 6945
281 Ga0207671_10026825 3300025914 Unclassified 4310
282 Ga0207671_10196670 3300025914 Unclassified 1573
283 Ga0207663_10044393 3300025916 Unclassified 2728
284 Ga0207663_10251547 3300025916 Unclassified 1301
285 Ga0207663_10269827 3300025916 Unclassified 1260
286 Ga0207663_10405916 3300025916 Unclassified 1043
287 Ga0207660_10126523 3300025917 Bacteria 1941
288 Ga0207660_10173188 3300025917 Bacteria 1672
289 Ga0207660_10456205 3300025917 Unclassified 1034
290 Ga0207660_10826579 3300025917 Unclassified 756
291 Ga0207657_10000386 3300025919 Bacteria 46458
292 Ga0207657_10020314 3300025919 Bacteria 6279
293 Ga0207657_10474539 3300025919 Unclassified 981
294 Ga0207649_10054066 3300025920 Bacteria 2498
295 Ga0207649_10139677 3300025920 Bacteria 1656
296 Ga0207652_10002321 3300025921 Bacteria 16123
297 Ga0207652_10067781 3300025921 Bacteria 3095
298 Ga0207652_10237581 3300025921 Bacteria 1642
299 Ga0207652_10552130 3300025921 Bacteria 1035
300 Ga0207694_10001085 3300025924 Bacteria 23569
301 Ga0207694_10004314 3300025924 Bacteria 11107
302 Ga0207694_10046413 3300025924 Bacteria 3358
303 Ga0207694_10181410 3300025924 Unclassified 1707
304 Ga0207694_10430255 3300025924 Bacteria 1100
305 Ga0207659_10888980 3300025926 Unclassified 766
306 Ga0207687_10002120 3300025927 Bacteria 13552
307 Ga0207687_10005383 3300025927 Bacteria 8468
308 Ga0207687_10008907 3300025927 Bacteria 6560
309 Ga0207687_10017442 3300025927 Bacteria 4728
310 Ga0207687_10091421 3300025927 Unclassified 2220
311 Ga0207700_10381746 3300025928 Unclassified 1232
312 Ga0207700_10523654 3300025928 Bacteria 1051
313 Ga0207664_10270364 3300025929 Bacteria 1489
314 Ga0207644_10088195 3300025931 Unclassified 2307
315 Ga0207644_10352588 3300025931 Unclassified 1195
316 Ga0207690_10123633 3300025932 Unclassified 1883
317 Ga0207690_10195005 3300025932 Bacteria 1534
318 Ga0207686_10050688 3300025934 Bacteria 2582
319 Ga0207686_10078979 3300025934 Bacteria 2141
320 Ga0207686_10086653 3300025934 Bacteria 2057
321 Ga0207686_10090653 3300025934 Unclassified 2017
322 Ga0207686_10093995 3300025934 Bacteria 1987
323 Ga0207686_10199338 3300025934 Bacteria 1432
324 Ga0207686_10201693 3300025934 Bacteria 1425
325 Ga0207686_10488171 3300025934 Bacteria 954
326 Ga0207686_10695081 3300025934 Bacteria 808
327 Ga0207709_10283016 3300025935 Bacteria 1225
328 Ga0207670_10155104 3300025936 Bacteria 1703
329 Ga0207670_10288829 3300025936 Unclassified 1281
330 Ga0207670_10475842 3300025936 Unclassified 1011
331 Ga0207665_10219759 3300025939 Unclassified 1392
332 Ga0207711_10013901 3300025941 Bacteria 6686
333 Ga0207711_10033103 3300025941 Bacteria 4372
334 Ga0207711_10043128 3300025941 Bacteria 3846
335 Ga0207711_10825023 3300025941 Unclassified 863
336 Ga0207661_10000034 3300025944 Bacteria 154138
337 Ga0207661_10004572 3300025944 Bacteria 9697
338 Ga0207661_10024831 3300025944 Bacteria 4548
339 Ga0207661_10157988 3300025944 Unclassified 1965
340 Ga0207661_10458554 3300025944 Bacteria 1161
341 Ga0207679_10470438 3300025945 Unclassified 1117
342 Ga0207679_11119879 3300025945 Unclassified 722
343 Ga0207667_10000483 3300025949 Bacteria 52728
344 Ga0207667_10005354 3300025949 Bacteria 15641
345 Ga0207667_10018556 3300025949 Bacteria 7797
346 Ga0207667_10051536 3300025949 Bacteria 4339
347 Ga0207667_10057175 3300025949 Bacteria 4095
348 Ga0207651_10150814 3300025960 Bacteria 1809
349 Ga0207712_10014175 3300025961 Bacteria 5119
350 Ga0207658_10269456 3300025986 Bacteria 1455
351 Ga0207658_10547517 3300025986 Bacteria 1035
352 Ga0207658_11055495 3300025986 Bacteria 742
353 Ga0207677_10013594 3300026023 Bacteria 4723
354 Ga0207677_10018391 3300026023 Bacteria 4192
355 Ga0207703_10020649 3300026035 Bacteria 5152
356 Ga0207703_10036336 3300026035 Bacteria 3921
357 Ga0207703_10074911 3300026035 Bacteria 2804
358 Ga0207703_10142707 3300026035 Unclassified 2080
359 Ga0207703_10240936 3300026035 Bacteria 1626
360 Ga0207639_10013659 3300026041 Bacteria 5691
361 Ga0207639_10026292 3300026041 Bacteria 4229
362 Ga0207639_10059308 3300026041 Bacteria 2948
363 Ga0207639_10064257 3300026041 Bacteria 2845
364 Ga0207639_10098810 3300026041 Bacteria 2353
365 Ga0207639_10541270 3300026041 Unclassified 1068
366 Ga0207702_10003479 3300026078 Bacteria 14352
367 Ga0207702_10082481 3300026078 Bacteria 2796
368 Ga0207702_10101241 3300026078 Bacteria 2543
369 Ga0207702_10167970 3300026078 Unclassified 2009
370 Ga0207702_10232516 3300026078 Unclassified 1723
371 Ga0207702_10254782 3300026078 Unclassified 1650
372 Ga0207702_10399494 3300026078 Unclassified 1325
373 Ga0207641_10225363 3300026088 Unclassified 1740
374 Ga0207641_10414279 3300026088 Bacteria 1296
375 Ga0207648_10010649 3300026089 Bacteria 8692
376 Ga0207648_10018879 3300026089 Bacteria 6229
377 Ga0207676_10028265 3300026095 Bacteria 4187
378 Ga0207676_11081175 3300026095 Bacteria 792
379 Ga0207674_10000097 3300026116 Bacteria 98549
380 Ga0207674_10001062 3300026116 Bacteria 35740
381 Ga0207674_10016287 3300026116 Bacteria 8142
382 Ga0207674_10047625 3300026116 Bacteria 4392
383 Ga0207674_10422938 3300026116 Unclassified 1287
384 Ga0207675_100280930 3300026118 Unclassified 1618
385 Ga0207698_10017034 3300026142 Bacteria 4919
386 Ga0207698_10423758 3300026142 Bacteria 1278
387 Ga0207698_10495409 3300026142 Unclassified 1188
388 Ga0268266_10150586 3300028379 Unclassified 2096
389 Ga0268264_10016010 3300028381 Bacteria 6144
390 Ga0268264_10431595 3300028381 Bacteria 1273
391 Ga0265338_10129193 3300028800 Bacteria 1999
392 Ga0265313_10015102 3300031595 Bacteria 4521
393 Ga0265314_10000538 3300031711 Bacteria 48732
394 Ga0265314_10005421 3300031711 Bacteria 11525
395 Ga0265342_10163809 3300031712 Bacteria 1227
396 Ga0373926_0031064 3300035083 Unclassified 1883
397 Ga0373934_0001598 3300035086 Bacteria 8321
398 Ga0373934_0109501 3300035086 Bacteria 1119
399 Ga0373945_0147435 3300035116 Bacteria 952
400 Ga0373954_0041287 3300035118 Bacteria 2150
401 Ga0373954_0052492 3300035118 Bacteria 1915
402 Ga0373954_0201086 3300035118 Bacteria 979
403 Ga0373955_0066533 3300035172 Bacteria 2003
404 Ga0373955_0167791 3300035172 Unclassified 1298
405 Ga0373935_0127901 3300035692 Bacteria 1704
406 Ga0373935_0229110 3300035692 Bacteria 1293
407 Ga0373933_0021082 3300035724 Bacteria 3698
408 Ga0373933_0049859 3300035724 Bacteria 2497
409 Ga0373933_0062094 3300035724 Bacteria 2256
410 Ga0373947_0136992 3300035725 Unclassified 1567
411 Ga0373937_0036257 3300036401 Bacteria 4493
412 Ga0373937_0085857 3300036401 Bacteria 2912
413 Ga0373937_0096120 3300036401 Bacteria 2747
414 Ga0373925_0067782 3300037068 Unclassified 2692
415 Ga0436365_1743358 3300039437 Bacteria 1010
416 Ga0495629_0244875 3300046459 Bacteria 1234
417 Ga0495653_0345404 3300046463 Unclassified 958
418 Ga0495580_0054511 3300046472 Unclassified 2820
419 Ga0495580_0157950 3300046472 Bacteria 1570
420 Ga0495580_0539619 3300046472 Unclassified 775
421 Ga0495582_0077446 3300046473 Bacteria 1844
422 Ga0495582_0129580 3300046473 Bacteria 1425
423 Ga0495639_0016386 3300046475 Bacteria 3218
424 Ga0495594_0030113 3300046499 Bacteria 2935
425 Ga0495628_0863386 3300046516 Bacteria 630
426 Ga0495652_0020656 3300046529 Bacteria 5854
427 Ga0495652_0062751 3300046529 Bacteria 3132
428 Ga0495652_0308852 3300046529 Unclassified 1147
429 Ga0495665_0024905 3300046531 Bacteria 3215
430 Ga0495586_0075900 3300046535 Bacteria 1841
431 Ga0495586_0097642 3300046535 Unclassified 1628
432 Ga0495587_0026826 3300046536 Bacteria 3509
433 Ga0495587_0051833 3300046536 Bacteria 2424
434 Ga0495634_0040948 3300046642 Bacteria 3148
435 Ga0495599_0008990 3300046678 Bacteria 6085
436 Ga0495623_0051476 3300046679 Bacteria 2605
437 Ga0495658_0357760 3300046683 Unclassified 928
438 Ga0495613_0661929 3300046689 Unclassified 690
439 Ga0495674_0082811 3300047319 Bacteria 2751
440 Ga0495674_0169942 3300047319 Bacteria 1820
441 Ga0495674_0266330 3300047319 Unclassified 1407
442 Ga0495680_0108415 3300047322 Bacteria 2061
443 Ga0495684_0027163 3300047471 Bacteria 4394
444 Ga0495684_0208078 3300047471 Bacteria 1440
445 Ga0495684_0643768 3300047471 Unclassified 710
446 Ga0495602_0012797 3300048088 Bacteria 8602
447 Ga0495602_0390199 3300048088 Unclassified 995
448 Ga0495614_0397360 3300048089 Unclassified 647
449 Ga0496102_0182899 3300048905 Bacteria 1975
450 Ga0496115_0067234 3300048918 Bacteria 2898
451 Ga0501033_0023883 3300049570 Bacteria 4612
452 Ga0501034_0005261 3300049571 Bacteria 14204
453 Ga0501038_0253993 3300049574 Bacteria 1392
454 Ga0501047_0041385 3300049581 Bacteria 4452
455 Ga0501073_0175858 3300049589 Bacteria 1481
456 Ga0501035_0020129 3300049822 Bacteria 6128
457 Ga0501044_0039695 3300049823 Bacteria 4909
458 nmdc:mga09592_123446_c1 3300050508 Bacteria 2225
459 nmdc:mga0qj67_15070_c1 3300050509 Bacteria 5849
460 nmdc:mga0n895_223303_c1 3300050512 Bacteria 1912
461 Ga0495619_0776599 3300053085 Unclassified 649
462 Ga0265342_10034342
463 Ga0070658_10120310
464 Ga0070683_100000012
465 Ga0070683_100004646
466 Ga0070683_100029080
467 Ga0070683_100043356
468 Ga0070683_100045377
469 Ga0070683_100289181
470 Ga0070690_100039698
471 Ga0070690_100469174
472 Ga0068869_100429648
473 Ga0070666_10013732
474 Ga0070666_10170161
475 Ga0070680_100009820
476 Ga0070680_100196007
477 Ga0070680_100553822
478 Ga0068868_100036650
479 Ga0068868_100041738
480 Ga0068868_100162581
481 Ga0068868_100464290
482 Ga0068868_100478248
483 Ga0068868_100771651
484 Ga0070660_100013469
485 Ga0070660_100019051
486 Ga0070660_100114413
487 Ga0070660_100530603
488 Ga0070689_100559496
489 Ga0070691_10000422
490 Ga0070661_100089968
491 Ga0070661_101230353
492 Ga0070671_100057486
493 Ga0070673_100091499
494 Ga0070667_100056371
495 Ga0070667_100199378
496 Ga0070714_100467227
497 Ga0070713_100569669
498 Ga0070701_10094947
499 Ga0070711_100307882
500 Ga0070711_100314410
501 Ga0070711_100337198
502 Ga0070708_100149987
503 Ga0070681_10001569
504 Ga0070681_10014607
505 Ga0070681_10280258
506 Ga0070681_10319291
507 Ga0070681_10361077
508 Ga0070681_10512769
509 Ga0068867_100104117
510 Ga0068867_100162163
511 Ga0070706_100178183
512 Ga0070679_100001176
513 Ga0070679_100096169
514 Ga0070679_100199446
515 Ga0070684_100000013
516 Ga0070684_100000438
517 Ga0070684_100017016
518 Ga0070684_100073299
519 Ga0070684_100076046
520 Ga0070684_100108070
521 Ga0068853_100004235
522 Ga0068853_100029168
523 Ga0068853_100050405
524 Ga0068853_100377852
525 Ga0070695_100011385
526 Ga0070693_100080970
527 Ga0070665_100092050
528 Ga0068855_100001207
529 Ga0068855_100006707
530 Ga0068855_100016468
531 Ga0068855_100067573
532 Ga0068855_100251073
533 Ga0068855_100337090
534 Ga0070664_100101321
535 Ga0070664_100257228
536 Ga0070664_100360979
537 Ga0068857_100000835
538 Ga0068857_100001590
539 Ga0068857_100035966
540 Ga0068857_100037964
541 Ga0068854_100517026
542 Ga0068856_100001077
543 Ga0068856_100020201
544 Ga0068856_100034471
545 Ga0068856_100147016
546 Ga0068856_100287874
547 Ga0068856_100310339
548 Ga0068856_100366405
549 Ga0068852_100002181
550 Ga0068852_100009034
551 Ga0068852_100185983
552 Ga0068852_100902194
553 Ga0068859_100031992
554 Ga0068859_100062031
555 Ga0068859_100291104
556 Ga0068859_100367401
557 Ga0068859_100765880
558 Ga0068859_100978861
559 Ga0068864_100204904
560 Ga0068864_100276911
561 Ga0068864_100334942
562 Ga0068866_10154945
563 Ga0068866_10532106
564 Ga0068863_100015331
565 Ga0068858_100032775
566 Ga0068858_100053735
567 Ga0068858_100085667
568 Ga0068858_100286696
569 Ga0068858_100617760
570 Ga0068860_100028289
571 Ga0068860_100145044
572 Ga0068860_100365759
573 Ga0068860_100618807
574 Ga0097621_100025224
575 Ga0097621_100055243
576 Ga0097621_100111064
577 Ga0097621_100126676
578 Ga0097621_100148968
579 Ga0097621_101371089
580 Ga0068871_100027278
581 Ga0068871_100037616
582 Ga0068871_100077198
583 Ga0068871_100108205
584 Ga0068871_100234955
585 Ga0068871_100270686
586 Ga0068871_100420292
587 Ga0075434_100517816
588 Ga0075429_100098174
589 Ga0068865_100121001
590 Ga0068865_100224925
591 Ga0068865_100789324
592 Ga0075436_100074936
593 Ga0097620_100031991
594 Ga0097620_100062031
595 Ga0097620_100291112
596 Ga0097620_100367383
597 Ga0097620_100765896
598 Ga0097620_100978883
599 Ga0105240_10000894
600 Ga0105240_10004650
601 Ga0105240_10007794
602 Ga0105240_10065930
603 Ga0105240_10157879
604 Ga0105240_10184496
605 Ga0105240_10438824
606 Ga0105240_10643124
607 Ga0105240_10654290
608 Ga0105240_10722069
609 Ga0105240_11464296
610 Ga0105245_10002252
611 Ga0105245_10006811
612 Ga0105245_10026477
613 Ga0105245_10041608
614 Ga0105245_10057943
615 Ga0105245_10064130
616 Ga0105245_10176481
617 Ga0105245_10274377
618 Ga0105245_10304194
619 Ga0105247_10124223
620 Ga0105247_10172279
621 Ga0114129_10268650
622 Ga0114129_10276247
623 Ga0105243_10126037
624 Ga0105243_10265822
625 Ga0105243_10322854
626 Ga0105241_10020067
627 Ga0105241_10066173
628 Ga0105241_10123100
629 Ga0105241_10153201
630 Ga0105241_10192292
631 Ga0105241_10480801
632 Ga0105241_10549592
633 Ga0105241_10647036
634 Ga0105241_11205132
635 Ga0105242_10008715
636 Ga0105242_10048196
637 Ga0105242_10060282
638 Ga0105242_10098729
639 Ga0105242_10121982
640 Ga0105242_10139303
641 Ga0105242_10191953
642 Ga0105242_10350323
643 Ga0105248_10038596
644 Ga0105248_10055813
645 Ga0105248_10074186
646 Ga0105248_10194215
647 Ga0105248_10452197
648 Ga0105248_11407136
649 Ga0105237_10005245
650 Ga0105237_10016969
651 Ga0105237_10122270
652 Ga0105237_10539994
653 Ga0105238_10003059
654 Ga0105238_10016499
655 Ga0105238_10037688
656 Ga0105238_10066776
657 Ga0105238_10137343
658 Ga0105238_10206441
659 Ga0105238_10219903
660 Ga0105238_10264696
661 Ga0105249_10022293
662 Ga0105249_10197219
663 Ga0105239_10001226
664 Ga0105239_10013249
665 Ga0105239_10015246
666 Ga0105239_10018430
667 Ga0105239_10022290
668 Ga0105239_10107415
669 Ga0105246_10009977
670 Ga0105246_10026930
671 Ga0105246_11128122
672 Ga0157373_10694620
673 Ga0157370_10005388
674 Ga0157370_10005697
675 Ga0157370_10065660
676 Ga0157370_10093921
677 Ga0157369_10012537
678 Ga0157369_10016609
679 Ga0157369_10025527
680 Ga0157369_10027764
681 Ga0157369_10090152
682 Ga0157374_10002548
683 Ga0157374_10093573
684 Ga0157374_10152625
685 Ga0157374_10273318
686 Ga0157378_10029111
687 Ga0157378_10094482
688 Ga0157378_10245104
689 Ga0157378_10370766
690 Ga0157378_10463047
691 Ga0157378_10995342
692 Ga0163162_10005058
693 Ga0163162_10023874
694 Ga0163162_10591441
695 Ga0163162_10980747
696 Ga0163162_11611106
697 Ga0157372_10006289
698 Ga0157372_10007430
699 Ga0157372_10310741
700 Ga0157372_10457522
701 Ga0157372_10589937
702 Ga0157375_10025562
703 Ga0157375_10131034
704 Ga0157375_10234262
705 Ga0157375_10688566
706 Ga0163163_10001395
707 Ga0163163_10028597
708 Ga0163163_10086337
709 Ga0163163_10205774
710 Ga0163163_10456654
711 Ga0163163_10619412
712 Ga0157379_10021657
713 Ga0157379_10108838
714 Ga0157379_10525365
715 Ga0157376_10014188
716 Ga0157376_10033113
717 Ga0157376_10596661
718 Ga0157376_10964784
719 Ga0157376_11025723
720 Ga0228598_1030994
721 Ga0207642_10033679
722 Ga0207680_10002365
723 Ga0207705_10044428
724 Ga0207684_10683359
725 Ga0207654_10039608
726 Ga0207654_10125240
727 Ga0207654_10254804
728 Ga0207654_10274549
729 Ga0207707_10003367
730 Ga0207707_10012611
731 Ga0207707_10013097
732 Ga0207707_10070753
733 Ga0207707_10109581
734 Ga0207707_10227341
735 Ga0207695_10001639
736 Ga0207695_10005363
737 Ga0207695_10055021
738 Ga0207695_10193019
739 Ga0207695_10385848
740 Ga0207695_10426950
741 Ga0207671_10012157
742 Ga0207671_10026825
743 Ga0207671_10196670
744 Ga0207663_10044393
745 Ga0207663_10251547
746 Ga0207663_10269827
747 Ga0207663_10405916
748 Ga0207660_10126523
749 Ga0207660_10173188
750 Ga0207660_10456205
751 Ga0207660_10826579
752 Ga0207657_10000386
753 Ga0207657_10020314
754 Ga0207657_10474539
755 Ga0207649_10054066
756 Ga0207649_10139677
757 Ga0207652_10002321
758 Ga0207652_10067781
759 Ga0207652_10237581
760 Ga0207652_10552130
761 Ga0207694_10001085
762 Ga0207694_10004314
763 Ga0207694_10046413
764 Ga0207694_10181410
765 Ga0207694_10430255
766 Ga0207659_10888980
767 Ga0207687_10002120
768 Ga0207687_10005383
769 Ga0207687_10008907
770 Ga0207687_10017442
771 Ga0207687_10091421
772 Ga0207700_10381746
773 Ga0207700_10523654
774 Ga0207664_10270364
775 Ga0207644_10088195
776 Ga0207644_10352588
777 Ga0207690_10123633
778 Ga0207690_10195005
779 Ga0207686_10050688
780 Ga0207686_10078979
781 Ga0207686_10086653
782 Ga0207686_10090653
783 Ga0207686_10093995
784 Ga0207686_10199338
785 Ga0207686_10201693
786 Ga0207686_10488171
787 Ga0207686_10695081
788 Ga0207709_10283016
789 Ga0207670_10155104
790 Ga0207670_10288829
791 Ga0207670_10475842
792 Ga0207665_10219759
793 Ga0207711_10013901
794 Ga0207711_10033103
795 Ga0207711_10043128
796 Ga0207711_10825023
797 Ga0207661_10000034
798 Ga0207661_10004572
799 Ga0207661_10024831
800 Ga0207661_10157988
801 Ga0207661_10458554
802 Ga0207679_10470438
803 Ga0207679_11119879
804 Ga0207667_10000483
805 Ga0207667_10005354
806 Ga0207667_10018556
807 Ga0207667_10051536
808 Ga0207667_10057175
809 Ga0207651_10150814
810 Ga0207712_10014175
811 Ga0207658_10269456
812 Ga0207658_10547517
813 Ga0207658_11055495
814 Ga0207677_10013594
815 Ga0207677_10018391
816 Ga0207703_10020649
817 Ga0207703_10036336
818 Ga0207703_10074911
819 Ga0207703_10142707
820 Ga0207703_10240936
821 Ga0207639_10013659
822 Ga0207639_10026292
823 Ga0207639_10059308
824 Ga0207639_10064257
825 Ga0207639_10098810
826 Ga0207639_10541270
827 Ga0207702_10003479
828 Ga0207702_10082481
829 Ga0207702_10101241
830 Ga0207702_10167970
831 Ga0207702_10232516
832 Ga0207702_10254782
833 Ga0207702_10399494
834 Ga0207641_10225363
835 Ga0207641_10414279
836 Ga0207648_10010649
837 Ga0207648_10018879
838 Ga0207676_10028265
839 Ga0207676_11081175
840 Ga0207674_10000097
841 Ga0207674_10001062
842 Ga0207674_10016287
843 Ga0207674_10047625
844 Ga0207674_10422938
845 Ga0207675_100280930
846 Ga0207698_10017034
847 Ga0207698_10423758
848 Ga0207698_10495409
849 Ga0268266_10150586
850 Ga0268264_10016010
851 Ga0268264_10431595
852 Ga0265338_10129193
853 Ga0265313_10015102
854 Ga0265314_10000538
855 Ga0265314_10005421
856 Ga0265342_10163809
857 Ga0373926_0031064
858 Ga0373934_0001598
859 Ga0373934_0109501
860 Ga0373945_0147435
861 Ga0373954_0041287
862 Ga0373954_0052492
863 Ga0373954_0201086
864 Ga0373955_0066533
865 Ga0373955_0167791
866 Ga0373935_0127901
867 Ga0373935_0229110
868 Ga0373933_0021082
869 Ga0373933_0049859
870 Ga0373933_0062094
871 Ga0373947_0136992
872 Ga0373937_0036257
873 Ga0373937_0085857
874 Ga0373937_0096120
875 Ga0373925_0067782
876 Ga0436365_1743358
877 Ga0495629_0244875
878 Ga0495653_0345404
879 Ga0495580_0054511
880 Ga0495580_0157950
881 Ga0495580_0539619
882 Ga0495582_0077446
883 Ga0495582_0129580
884 Ga0495639_0016386
885 Ga0495594_0030113
886 Ga0495628_0863386
887 Ga0495652_0020656
888 Ga0495652_0062751
889 Ga0495652_0308852
890 Ga0495665_0024905
891 Ga0495586_0075900
892 Ga0495586_0097642
893 Ga0495587_0026826
894 Ga0495587_0051833
895 Ga0495634_0040948
896 Ga0495599_0008990
897 Ga0495623_0051476
898 Ga0495658_0357760
899 Ga0495613_0661929
900 Ga0495674_0082811
901 Ga0495674_0169942
902 Ga0495674_0266330
903 Ga0495680_0108415
904 Ga0495684_0027163
905 Ga0495684_0208078
906 Ga0495684_0643768
907 Ga0495602_0012797
908 Ga0495602_0390199
909 Ga0495614_0397360
910 Ga0496102_0182899
911 Ga0496115_0067234
912 Ga0501033_0023883
913 Ga0501034_0005261
914 Ga0501038_0253993
915 Ga0501047_0041385
916 Ga0501073_0175858
917 Ga0501035_0020129
918 Ga0501044_0039695
919 nmdc:mga09592_123446_c1
920 nmdc:mga0qj67_15070_c1
921 nmdc:mga0n895_223303_c1
922 Ga0495619_0776599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

6

176

0.76

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

7

203

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yvt-assembly1.cif.gz_A crystal structure of aq_1956 0.826 3 190
2yvt-assembly1.cif.gz_A crystal structure of aq_1956 0.7848 3 190
1uf3-assembly1.cif.gz_C crystal structure of tt1561 of thermus thermophilus hb8 0.7805 2 192
3rl4-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 g252h mutant 0.7666 2 190
3rl3-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 0.7541 2 190
ID Description Score Start End Superfamily
af_Q58562_1_216_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8345 2 195 3.60.21.10
2yvtA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8262 1 190 3.60.21.10
af_Q22306_84_377_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8204 2 190 3.60.21.10
af_Q58562_1_216_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8156 2 195 3.60.21.10
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.8046 3 75 3.60.21.40
ID Description Score Start End GO Terms
AF-A0A257VTM0-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9979 3 77 GO:0016787
AF-A0A7Y5LHY2-F1-model_v4 Metallophosphoesterase 0.9893 3 197 GO:0016787
AF-A0A2U3KRV6-F1-model_v4 Metallophosphoesterase (Modular protein) 0.9867 2 198 GO:0016787
AF-Q028H5-F1-model_v4 Metallophosphoesterase 0.9813 3 198 GO:0016787
AF-A0A7V6D0D0-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9809 2 160 GO:0016787

Map