F448451

General Info

Members Datasets Scaffolds Average Seq Length
459 217 918 463

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_135757_c1|nmdc:mga05p37_135757_c1_888_2330
Length 480
Sequence MTCRRTAADTCRGVMVRMRIVLADIKGGDGFISKDTVVGGYGSRLKPFSKVTRLVAHVKGGFHELPSVHLAYAAALARQAGHETVSSSGALAEGDVAIMLSSLVDHRRETAWARAMRDRGVRVGFIGLAAQNLPHLFDTSADFIVVGEPESALQRLFRGDTLSGMASSPQISDLDSLPFPVWEPFLPSRRRVRVPFAGRPYGGSLPLLASRSCPEFCTYCPHRIQSTYRFRSVTNILDELSYLEDTRGRLHVVFRDPLFSQERDRVLELCDGIRARRLSHTFECETRLDRLDGDLLRVMHAAGLRAMSFGVESVAPTTLKKVGRRPIPEPHQRQVLRRCRELGIVTAAFYVIGFAEDTWESIGATIEYSIDLGSTVAQFKILTPYPGTPLFKRMQTTITETDWERFDGFTPTFTHPSLXXAELTFLLGNAYTQYYVRPSFLTNYLRIESPRVRALVKSLDAPVRRRHTREVALKERTLSC

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 1.09
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 12.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_135757_c1 3300050507 Bacteria 3017
2 JGI24746J21847_1000823 3300001977 Bacteria 4794
3 Ga0065712_10073436 3300005290 Bacteria 4387
4 Ga0070676_10002154 3300005328 Bacteria 10029
5 Ga0070690_100006893 3300005330 Bacteria 6466
6 Ga0070690_100051930 3300005330 Bacteria 2619
7 Ga0070690_100073108 3300005330 Unclassified 2230
8 Ga0070670_100078599 3300005331 Unclassified 2834
9 Ga0070677_10004154 3300005333 Bacteria 4708
10 Ga0070677_10010371 3300005333 Bacteria 3186
11 Ga0068869_100005534 3300005334 Bacteria 7952
12 Ga0068869_100021319 3300005334 Bacteria 4456
13 Ga0070666_10007681 3300005335 Bacteria 6657
14 Ga0068868_100009344 3300005338 Bacteria 7049
15 Ga0068868_100063644 3300005338 Bacteria 2926
16 Ga0068868_100067530 3300005338 Bacteria 2846
17 Ga0070689_100182408 3300005340 Bacteria 1705
18 Ga0070691_10002578 3300005341 Bacteria 8084
19 Ga0070687_100007102 3300005343 Bacteria 4639
20 Ga0070661_100082861 3300005344 Unclassified 2369
21 Ga0070669_100011904 3300005353 Bacteria 6173
22 Ga0070669_100012576 3300005353 Bacteria 6003
23 Ga0070669_100022378 3300005353 Bacteria 4518
24 Ga0070675_100003945 3300005354 Bacteria 11245
25 Ga0070675_100009113 3300005354 Bacteria 7707
26 Ga0070671_100011733 3300005355 Bacteria 7047
27 Ga0070671_100025997 3300005355 Bacteria 4808
28 Ga0070674_100005617 3300005356 Bacteria 7264
29 Ga0070673_100000718 3300005364 Bacteria 18298
30 Ga0070673_100001224 3300005364 Bacteria 14844
31 Ga0070673_100015137 3300005364 Bacteria 5404
32 Ga0070673_100058572 3300005364 Unclassified 3046
33 Ga0070688_100007957 3300005365 Bacteria 5733
34 Ga0070688_100008290 3300005365 Bacteria 5636
35 Ga0070714_100020743 3300005435 Bacteria 5371
36 Ga0070713_100167840 3300005436 Unclassified 1964
37 Ga0070711_100097301 3300005439 Unclassified 2134
38 Ga0070705_100014457 3300005440 Bacteria 4061
39 Ga0070700_100001992 3300005441 Bacteria 10368
40 Ga0070700_100009373 3300005441 Bacteria 5369
41 Ga0070700_100067888 3300005441 Unclassified 2266
42 Ga0070708_100005784 3300005445 Bacteria 9814
43 Ga0070708_100011788 3300005445 Bacteria 7113
44 Ga0070708_100013595 3300005445 Bacteria 6672
45 Ga0070663_100064930 3300005455 Bacteria 2640
46 Ga0070663_100161531 3300005455 Bacteria 1725
47 Ga0070678_100022064 3300005456 Bacteria 4208
48 Ga0070678_100026337 3300005456 Bacteria 3930
49 Ga0070678_100122099 3300005456 Bacteria 2056
50 Ga0070662_100047468 3300005457 Bacteria 3089
51 Ga0070681_10098333 3300005458 Bacteria 2873
52 Ga0068867_100010235 3300005459 Bacteria 6615
53 Ga0068867_100019633 3300005459 Bacteria 4813
54 Ga0070706_100055764 3300005467 Bacteria 3648
55 Ga0070706_100232027 3300005467 Bacteria 1723
56 Ga0070706_100241702 3300005467 Bacteria 1686
57 Ga0070707_100001823 3300005468 Bacteria 20504
58 Ga0070707_100057151 3300005468 Unclassified 3743
59 Ga0070698_100116381 3300005471 Bacteria 2637
60 Ga0070699_100000480 3300005518 Bacteria 38016
61 Ga0070699_100005774 3300005518 Bacteria 10829
62 Ga0070699_100031623 3300005518 Bacteria 4569
63 Ga0070699_100069157 3300005518 Unclassified 3068
64 Ga0070699_100155370 3300005518 Bacteria 2024
65 Ga0070679_100035148 3300005530 Bacteria 4971
66 Ga0070684_100047449 3300005535 Bacteria 3722
67 Ga0070684_100103418 3300005535 Unclassified 2548
68 Ga0070672_100009960 3300005543 Bacteria 6575
69 Ga0070672_100066110 3300005543 Unclassified 2862
70 Ga0070686_100004659 3300005544 Bacteria 7564
71 Ga0070686_100021484 3300005544 Bacteria 3838
72 Ga0070695_100018206 3300005545 Bacteria 4264
73 Ga0070696_100003832 3300005546 Bacteria 10043
74 Ga0070696_100004285 3300005546 Bacteria 9506
75 Ga0070696_100006008 3300005546 Bacteria 8102
76 Ga0070665_100006326 3300005548 Bacteria 12084
77 Ga0070665_100018473 3300005548 Bacteria 6988
78 Ga0070665_100173863 3300005548 Bacteria 2154
79 Ga0070704_100082752 3300005549 Unclassified 2368
80 Ga0070704_100158316 3300005549 Bacteria 1789
81 Ga0068855_100144268 3300005563 Bacteria 2712
82 Ga0070664_100014956 3300005564 Bacteria 6333
83 Ga0070664_100023852 3300005564 Bacteria 5053
84 Ga0068857_100151248 3300005577 Bacteria 2103
85 Ga0068854_100004171 3300005578 Bacteria 9091
86 Ga0068854_100005532 3300005578 Bacteria 7981
87 Ga0068856_100259497 3300005614 Unclassified 1753
88 Ga0070702_100013685 3300005615 Bacteria 4101
89 Ga0070702_100021880 3300005615 Bacteria 3372
90 Ga0068859_100005448 3300005617 Bacteria 12941
91 Ga0068859_100016111 3300005617 Bacteria 7508
92 Ga0068859_100111145 3300005617 Bacteria 2802
93 Ga0068864_100026196 3300005618 Bacteria 4916
94 Ga0068864_100038631 3300005618 Unclassified 4078
95 Ga0068864_100207447 3300005618 Unclassified 1803
96 Ga0068866_10007097 3300005718 Bacteria 4684
97 Ga0068861_100003132 3300005719 Bacteria 10928
98 Ga0068861_100013671 3300005719 Bacteria 5685
99 Ga0068861_100025775 3300005719 Bacteria 4268
100 Ga0068861_100058946 3300005719 Unclassified 2938
101 Ga0068870_10003118 3300005840 Bacteria 6996
102 Ga0068863_100062504 3300005841 Bacteria 3521
103 Ga0068863_100145639 3300005841 Unclassified 2265
104 Ga0068858_100017623 3300005842 Bacteria 6694
105 Ga0068858_100061072 3300005842 Unclassified 3484
106 Ga0068858_100071968 3300005842 Bacteria 3207
107 Ga0068858_100092610 3300005842 Bacteria 2813
108 Ga0068860_100018106 3300005843 Bacteria 6858
109 Ga0068860_100019208 3300005843 Bacteria 6634
110 Ga0068860_100083910 3300005843 Unclassified 3030
111 Ga0068860_100156707 3300005843 Unclassified 2195
112 Ga0068862_100012618 3300005844 Bacteria 6995
113 Ga0068862_100222004 3300005844 Unclassified 1711
114 Ga0081455_10016095 3300005937 Bacteria 7234
115 Ga0081539_10005303 3300005985 Bacteria 13260
116 Ga0075365_10016653 3300006038 Bacteria 4476
117 Ga0075368_10039429 3300006042 Unclassified 1852
118 Ga0075364_10057376 3300006051 Bacteria 2550
119 Ga0075362_10001000 3300006177 Bacteria 8663
120 Ga0075362_10010270 3300006177 Bacteria 3650
121 Ga0068871_100000983 3300006358 Bacteria 19098
122 Ga0075431_100011609 3300006847 Bacteria 8882
123 Ga0075433_10016364 3300006852 Bacteria 6110
124 Ga0075433_10025684 3300006852 Bacteria 4981
125 Ga0075433_10030908 3300006852 Bacteria 4573
126 Ga0075433_10060641 3300006852 Bacteria 3313
127 Ga0075433_10127309 3300006852 Bacteria 2262
128 Ga0075434_100002694 3300006871 Bacteria 15692
129 Ga0075434_100002939 3300006871 Bacteria 15151
130 Ga0075434_100003323 3300006871 Bacteria 14382
131 Ga0075434_100012701 3300006871 Bacteria 7988
132 Ga0075434_100020696 3300006871 Bacteria 6387
133 Ga0075434_100148525 3300006871 Archaea 2364
134 Ga0075434_100223126 3300006871 Bacteria 1904
135 Ga0075434_100310853 3300006871 Bacteria 1596
136 Ga0075429_100026436 3300006880 Bacteria 5039
137 Ga0068865_100001604 3300006881 Bacteria 13249
138 Ga0068865_100007245 3300006881 Bacteria 6814
139 Ga0075436_100000305 3300006914 Bacteria 31481
140 Ga0097620_100005448 3300006931 Bacteria 12941
141 Ga0097620_100016111 3300006931 Bacteria 7508
142 Ga0097620_100111144 3300006931 Bacteria 2802
143 Ga0075435_100000012 3300007076 Bacteria 108852
144 Ga0075435_100007358 3300007076 Bacteria 7842
145 Ga0075435_100042563 3300007076 Bacteria 3633
146 Ga0075435_100050282 3300007076 Bacteria 3354
147 Ga0075435_100067359 3300007076 Bacteria 2915
148 Ga0105240_10031654 3300009093 Bacteria 6855
149 Ga0105240_10083102 3300009093 Bacteria 3931
150 Ga0111539_10001681 3300009094 Bacteria 29485
151 Ga0111539_10001822 3300009094 Bacteria 28383
152 Ga0111539_10003099 3300009094 Bacteria 22033
153 Ga0111539_10044245 3300009094 Bacteria 5334
154 Ga0111539_10063153 3300009094 Bacteria 4383
155 Ga0111539_10357233 3300009094 Bacteria 1700
156 Ga0105245_10188397 3300009098 Bacteria 1975
157 Ga0105247_10001308 3300009101 Bacteria 18279
158 Ga0105247_10040234 3300009101 Bacteria 2857
159 Ga0114129_10000153 3300009147 Bacteria 73434
160 Ga0114129_10004368 3300009147 Bacteria 19946
161 Ga0114129_10015794 3300009147 Bacteria 10735
162 Ga0114129_10015833 3300009147 Bacteria 10723
163 Ga0114129_10015886 3300009147 Bacteria 10706
164 Ga0114129_10020625 3300009147 Bacteria 9370
165 Ga0114129_10027372 3300009147 Bacteria 8072
166 Ga0114129_10078510 3300009147 Bacteria 4592
167 Ga0114129_10094228 3300009147 Unclassified 4147
168 Ga0114129_10170132 3300009147 Bacteria 2971
169 Ga0114129_10355801 3300009147 Unclassified 1939
170 Ga0114129_10357169 3300009147 Bacteria 1934
171 Ga0105243_10004496 3300009148 Bacteria 11020
172 Ga0105243_10026162 3300009148 Bacteria 4465
173 Ga0105242_10015625 3300009176 Bacteria 5897
174 Ga0105242_10029826 3300009176 Unclassified 4353
175 Ga0105242_10093831 3300009176 Unclassified 2531
176 Ga0105242_10148635 3300009176 Unclassified 2041
177 Ga0105242_10247047 3300009176 Bacteria 1606
178 Ga0105248_10004152 3300009177 Bacteria 16021
179 Ga0105248_10020608 3300009177 Bacteria 7307
180 Ga0105248_10028166 3300009177 Bacteria 6256
181 Ga0105248_10035993 3300009177 Bacteria 5537
182 Ga0105248_10055467 3300009177 Bacteria 4445
183 Ga0105248_10116668 3300009177 Unclassified 3011
184 Ga0105238_10010227 3300009551 Bacteria 9408
185 Ga0105249_10009530 3300009553 Bacteria 8508
186 Ga0105249_10148245 3300009553 Bacteria 2256
187 Ga0105246_10077231 3300011119 Bacteria 2362
188 Ga0105246_10135493 3300011119 Bacteria 1845
189 Ga0163162_10015046 3300013306 Bacteria 7557
190 Ga0157375_10256897 3300013308 Unclassified 1909
191 Ga0163163_10009290 3300014325 Bacteria 8771
192 Ga0163163_10065882 3300014325 Bacteria 3597
193 Ga0157380_10019511 3300014326 Bacteria 5053
194 Ga0157380_10019677 3300014326 Bacteria 5035
195 Ga0157380_10021741 3300014326 Bacteria 4817
196 Ga0157380_10041398 3300014326 Bacteria 3595
197 Ga0157380_10074855 3300014326 Bacteria 2750
198 Ga0157380_10224041 3300014326 Bacteria 1684
199 Ga0157377_10015151 3300014745 Bacteria 3936
200 Ga0157377_10054341 3300014745 Bacteria 2267
201 Ga0157379_10013635 3300014968 Bacteria 7122
202 Ga0157379_10058203 3300014968 Bacteria 3455
203 Ga0157379_10068979 3300014968 Unclassified 3161
204 Ga0157376_10013440 3300014969 Bacteria 6108
205 Ga0157376_10039983 3300014969 Unclassified 3830
206 Ga0157376_10046424 3300014969 Bacteria 3582
207 Ga0157376_10056086 3300014969 Unclassified 3290
208 Ga0163161_10006838 3300017792 Bacteria 7891
209 Ga0207697_10002571 3300025315 Bacteria 9337
210 Ga0207682_10002778 3300025893 Bacteria 7748
211 Ga0207682_10008735 3300025893 Bacteria 4008
212 Ga0207688_10011624 3300025901 Bacteria 4787
213 Ga0207645_10009335 3300025907 Bacteria 6790
214 Ga0207645_10010470 3300025907 Bacteria 6367
215 Ga0207645_10010472 3300025907 Bacteria 6366
216 Ga0207643_10004226 3300025908 Bacteria 7736
217 Ga0207643_10073516 3300025908 Bacteria 1971
218 Ga0207684_10025242 3300025910 Bacteria 5065
219 Ga0207695_10201532 3300025913 Unclassified 1904
220 Ga0207662_10005323 3300025918 Bacteria 6844
221 Ga0207662_10019468 3300025918 Bacteria 3864
222 Ga0207662_10027644 3300025918 Bacteria 3274
223 Ga0207662_10133577 3300025918 Bacteria 1567
224 Ga0207649_10100213 3300025920 Bacteria 1915
225 Ga0207652_10072038 3300025921 Bacteria 3004
226 Ga0207646_10084164 3300025922 Bacteria 2846
227 Ga0207646_10135785 3300025922 Bacteria 2215
228 Ga0207646_10136974 3300025922 Bacteria 2204
229 Ga0207646_10215204 3300025922 Unclassified 1735
230 Ga0207681_10013300 3300025923 Bacteria 5090
231 Ga0207681_10026199 3300025923 Bacteria 3758
232 Ga0207681_10061785 3300025923 Bacteria 2577
233 Ga0207694_10005515 3300025924 Bacteria 9710
234 Ga0207650_10015686 3300025925 Bacteria 5282
235 Ga0207650_10191688 3300025925 Bacteria 1633
236 Ga0207659_10002413 3300025926 Bacteria 11126
237 Ga0207659_10006238 3300025926 Bacteria 7293
238 Ga0207659_10009242 3300025926 Bacteria 6155
239 Ga0207659_10015855 3300025926 Bacteria 4895
240 Ga0207659_10109111 3300025926 Bacteria 2100
241 Ga0207687_10028799 3300025927 Bacteria 3732
242 Ga0207687_10066639 3300025927 Unclassified 2560
243 Ga0207700_10131698 3300025928 Unclassified 2042
244 Ga0207664_10036925 3300025929 Bacteria 3778
245 Ga0207644_10004503 3300025931 Bacteria 9054
246 Ga0207690_10027640 3300025932 Bacteria 3587
247 Ga0207706_10006430 3300025933 Bacteria 10912
248 Ga0207706_10025632 3300025933 Bacteria 5282
249 Ga0207706_10043902 3300025933 Bacteria 3961
250 Ga0207706_10208017 3300025933 Bacteria 1715
251 Ga0207686_10043704 3300025934 Unclassified 2747
252 Ga0207686_10157174 3300025934 Bacteria 1590
253 Ga0207709_10012657 3300025935 Bacteria 4650
254 Ga0207669_10005780 3300025937 Bacteria 5587
255 Ga0207704_10008092 3300025938 Bacteria 5007
256 Ga0207691_10013506 3300025940 Bacteria 7811
257 Ga0207691_10015117 3300025940 Bacteria 7345
258 Ga0207691_10018112 3300025940 Bacteria 6670
259 Ga0207691_10041882 3300025940 Bacteria 4224
260 Ga0207691_10077907 3300025940 Unclassified 2985
261 Ga0207711_10002803 3300025941 Bacteria 15320
262 Ga0207711_10002992 3300025941 Bacteria 14770
263 Ga0207711_10071743 3300025941 Bacteria 3006
264 Ga0207689_10003160 3300025942 Bacteria 15105
265 Ga0207689_10003182 3300025942 Bacteria 15059
266 Ga0207689_10004016 3300025942 Bacteria 13377
267 Ga0207661_10012184 3300025944 Bacteria 6244
268 Ga0207679_10006664 3300025945 Bacteria 7312
269 Ga0207679_10029864 3300025945 Bacteria 3799
270 Ga0207679_10148515 3300025945 Unclassified 1904
271 Ga0207651_10040858 3300025960 Unclassified 3073
272 Ga0207651_10078480 3300025960 Bacteria 2368
273 Ga0207712_10012583 3300025961 Bacteria 5408
274 Ga0207668_10045421 3300025972 Bacteria 2996
275 Ga0207668_10085800 3300025972 Unclassified 2298
276 Ga0207640_10145735 3300025981 Bacteria 1732
277 Ga0207658_10010962 3300025986 Bacteria 6172
278 Ga0207658_10169844 3300025986 Bacteria 1796
279 Ga0207677_10010755 3300026023 Bacteria 5188
280 Ga0207677_10052258 3300026023 Bacteria 2775
281 Ga0207703_10013310 3300026035 Bacteria 6409
282 Ga0207703_10014989 3300026035 Bacteria 6050
283 Ga0207703_10045833 3300026035 Bacteria 3518
284 Ga0207703_10131693 3300026035 Unclassified 2160
285 Ga0207703_10173851 3300026035 Bacteria 1896
286 Ga0207678_10063230 3300026067 Bacteria 3180
287 Ga0207678_10087169 3300026067 Bacteria 2668
288 Ga0207678_10138741 3300026067 Unclassified 2075
289 Ga0207708_10000706 3300026075 Bacteria 25251
290 Ga0207708_10009103 3300026075 Bacteria 7348
291 Ga0207708_10050745 3300026075 Bacteria 3158
292 Ga0207641_10010481 3300026088 Bacteria 7610
293 Ga0207648_10006451 3300026089 Bacteria 11658
294 Ga0207648_10007078 3300026089 Bacteria 11070
295 Ga0207648_10016579 3300026089 Bacteria 6725
296 Ga0207648_10042434 3300026089 Bacteria 3993
297 Ga0207648_10059700 3300026089 Bacteria 3326
298 Ga0207676_10027671 3300026095 Unclassified 4225
299 Ga0207676_10030367 3300026095 Bacteria 4056
300 Ga0207676_10037844 3300026095 Bacteria 3680
301 Ga0207674_10193862 3300026116 Bacteria 1982
302 Ga0207675_100001595 3300026118 Bacteria 22714
303 Ga0207675_100011388 3300026118 Bacteria 8324
304 Ga0207675_100013653 3300026118 Bacteria 7580
305 Ga0207675_100025146 3300026118 Bacteria 5540
306 Ga0207675_100039047 3300026118 Bacteria 4430
307 Ga0207675_100067905 3300026118 Unclassified 3332
308 Ga0207675_100100304 3300026118 Unclassified 2727
309 Ga0207683_10012512 3300026121 Bacteria 7239
310 Ga0207683_10019234 3300026121 Bacteria 5831
311 Ga0207683_10093289 3300026121 Unclassified 2683
312 Ga0207428_10000041 3300027907 Bacteria 203097
313 Ga0207428_10004093 3300027907 Bacteria 13970
314 Ga0207428_10012928 3300027907 Bacteria 7317
315 Ga0207428_10036425 3300027907 Bacteria 4013
316 Ga0268266_10009780 3300028379 Bacteria 8435
317 Ga0268266_10042170 3300028379 Bacteria 3896
318 Ga0268265_10055038 3300028380 Bacteria 3021
319 Ga0268265_10078194 3300028380 Bacteria 2601
320 Ga0268265_10193567 3300028380 Bacteria 1758
321 Ga0268264_10150879 3300028381 Bacteria 2083
322 Ga0268264_10209053 3300028381 Bacteria 1790
323 Ga0373930_0001321 3300034816 Bacteria 3646
324 Ga0373938_0001546 3300034957 Bacteria 3695
325 Ga0373929_0000574 3300035085 Bacteria 7085
326 Ga0373934_0030216 3300035086 Bacteria 2119
327 Ga0373940_0000066 3300035088 Bacteria 11878
328 Ga0373949_0000676 3300035090 Bacteria 11092
329 Ga0373932_0000173 3300035112 Bacteria 18853
330 Ga0373939_0000561 3300035114 Bacteria 9292
331 Ga0373941_0003930 3300035115 Bacteria 3407
332 Ga0373960_0022515 3300035121 Bacteria 1688
333 Ga0373946_0006791 3300035171 Unclassified 4161
334 Ga0373942_0000218 3300035207 Bacteria 15047
335 Ga0373961_0000622 3300035241 Bacteria 12857
336 Ga0373962_0000441 3300035242 Bacteria 9071
337 Ga0373924_0016906 3300035410 Unclassified 2790
338 Ga0373931_0006859 3300035691 Bacteria 5354
339 Ga0373947_0072539 3300035725 Unclassified 2114
340 Ga0373937_0227421 3300036401 Bacteria 1756
341 Ga0453683_0047118 3300044673 Bacteria 2702
342 Ga0451576_0025728 3300045051 Bacteria 6339
343 Ga0451576_0389907 3300045051 Unclassified 1460
344 Ga0495629_0123067 3300046459 Bacteria 1807
345 Ga0495651_0099232 3300046462 Bacteria 2172
346 Ga0495651_0188999 3300046462 Bacteria 1451
347 Ga0495653_0038376 3300046463 Bacteria 3760
348 Ga0495608_0005022 3300046511 Bacteria 9466
349 Ga0495652_0041130 3300046529 Bacteria 3992
350 Ga0495645_0002883 3300046543 Bacteria 11674
351 Ga0495656_0023095 3300046615 Bacteria 2444
352 Ga0495647_0006923 3300046681 Bacteria 3776
353 Ga0495658_0014098 3300046683 Bacteria 4076
354 Ga0495669_0013230 3300046684 Unclassified 3514
355 Ga0495613_0002297 3300046689 Bacteria 14479
356 Ga0495674_0008046 3300047319 Bacteria 10065
357 Ga0495684_0000747 3300047471 Bacteria 26203
358 Ga0495684_0057105 3300047471 Bacteria 2975
359 Ga0496104_0030378 3300048907 Bacteria 5021
360 Ga0496106_0094325 3300048909 Unclassified 2314
361 Ga0496107_0058825 3300048910 Viruses 2780
362 Ga0496113_0030081 3300048916 Bacteria 3928
363 Ga0496113_0098977 3300048916 Bacteria 2258
364 Ga0501031_0007356 3300049568 Bacteria 7177
365 Ga0501032_0003211 3300049569 Bacteria 12566
366 Ga0501032_0041472 3300049569 Bacteria 3125
367 Ga0501033_0000840 3300049570 Bacteria 28057
368 Ga0501033_0001633 3300049570 Bacteria 19683
369 Ga0501034_0023851 3300049571 Bacteria 6230
370 Ga0501034_0115041 3300049571 Bacteria 2678
371 Ga0501034_0153403 3300049571 Bacteria 2278
372 Ga0501036_0003227 3300049572 Bacteria 13005
373 Ga0501036_0008827 3300049572 Bacteria 8276
374 Ga0501037_0001117 3300049573 Bacteria 19932
375 Ga0501037_0042919 3300049573 Unclassified 3323
376 Ga0501038_0001068 3300049574 Bacteria 24735
377 Ga0501042_0180387 3300049578 Bacteria 1523
378 Ga0501043_0048876 3300049579 Bacteria 3324
379 Ga0501046_0002503 3300049580 Bacteria 17207
380 Ga0501047_0004378 3300049581 Bacteria 13290
381 Ga0501047_0005191 3300049581 Bacteria 12226
382 Ga0501047_0008268 3300049581 Bacteria 9821
383 Ga0501048_0010355 3300049582 Bacteria 6965
384 Ga0501048_0060347 3300049582 Bacteria 2687
385 Ga0501067_0005668 3300049583 Bacteria 6932
386 Ga0501068_0019638 3300049584 Bacteria 3927
387 Ga0501070_0007239 3300049586 Bacteria 9422
388 Ga0501070_0010639 3300049586 Bacteria 7776
389 Ga0501073_0007229 3300049589 Bacteria 8266
390 Ga0501073_0012179 3300049589 Bacteria 6279
391 Ga0501073_0037576 3300049589 Bacteria 3436
392 Ga0501074_0004313 3300049590 Bacteria 10156
393 Ga0501076_0047978 3300049592 Bacteria 3376
394 Ga0501076_0099080 3300049592 Bacteria 2348
395 Ga0501079_0005515 3300049741 Bacteria 9432
396 Ga0501079_0015532 3300049741 Bacteria 5812
397 Ga0501080_0017331 3300049742 Bacteria 6658
398 Ga0501080_0038776 3300049742 Bacteria 4446
399 Ga0501083_0006968 3300049744 Bacteria 8018
400 Ga0501083_0058812 3300049744 Bacteria 2571
401 Ga0501083_0111790 3300049744 Bacteria 1795
402 Ga0501035_0001367 3300049822 Bacteria 25092
403 Ga0501044_0004959 3300049823 Bacteria 14884
404 Ga0501044_0007308 3300049823 Bacteria 12137
405 nmdc:mga03683_20801_c1 3300050489 Bacteria 2523
406 nmdc:mga0yw44_6290_c1 3300050492 Bacteria 5723
407 nmdc:mga0k408_388_c2 3300050493 Bacteria 14713
408 nmdc:mga06z11_369_c1 3300050494 Bacteria 17005
409 nmdc:mga07m45_8854_c1 3300050496 Bacteria 5193
410 nmdc:mga05p37_142447_c1 3300050507 Bacteria 1668
411 nmdc:mga05p37_148482_c1 3300050507 Bacteria 2869
412 nmdc:mga05p37_17015_c1 3300050507 Bacteria 8769
413 nmdc:mga05p37_17741_c1 3300050507 Bacteria 8590
414 nmdc:mga05p37_19524_c1 3300050507 Bacteria 8199
415 nmdc:mga05p37_20223_c1 3300050507 Bacteria 8058
416 nmdc:mga05p37_21043_c1 3300050507 Bacteria 7894
417 nmdc:mga05p37_3402_c1 3300050507 Bacteria 18563
418 nmdc:mga05p37_39098_c1 3300050507 Bacteria 5821
419 nmdc:mga05p37_42748_c1 3300050507 Bacteria 5570
420 nmdc:mga05p37_44036_c1 3300050507 Bacteria 5491
421 nmdc:mga05p37_48334_c1 3300050507 Bacteria 5233
422 nmdc:mga05p37_52930_c1 3300050507 Bacteria 4993
423 nmdc:mga05p37_76861_c1 3300050507 Unclassified 4110
424 nmdc:mga09592_113114_c1 3300050508 Unclassified 2329
425 nmdc:mga09592_14113_c1 3300050508 Bacteria 6520
426 nmdc:mga06r32_175621_c1 3300050510 Bacteria 2126
427 nmdc:mga08y16_121626_c1 3300050511 Unclassified 2717
428 nmdc:mga08y16_1593_c1 3300050511 Bacteria 22918
429 nmdc:mga08y16_22307_c1 3300050511 Bacteria 6681
430 nmdc:mga08y16_78200_c1 3300050511 Bacteria 3449
431 nmdc:mga08y16_925_c1 3300050511 Bacteria 28503
432 nmdc:mga0n895_100358_c1 3300050512 Bacteria 2903
433 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
434 nmdc:mga0n895_33336_c1 3300050512 Bacteria 4949
435 nmdc:mga0n895_4403_c1 3300050512 Bacteria 11565
436 nmdc:mga0n895_53343_c1 3300050512 Bacteria 3973
437 nmdc:mga0n895_94282_c1 3300050512 Bacteria 2997
438 nmdc:mga0rr50_115973_c1 3300050513 Bacteria 2126
439 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
440 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
441 nmdc:mga0rr50_97643_c1 3300050513 Bacteria 2301
442 nmdc:mga08x19_13308_c1 3300050514 Bacteria 4971
443 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
444 nmdc:mga0a205_19785_c1 3300050515 Bacteria 6352
445 nmdc:mga0a205_2346_c1 3300050515 Bacteria 16706
446 nmdc:mga0a205_29871_c1 3300050515 Bacteria 4518
447 nmdc:mga0a205_7003_c1 3300050515 Bacteria 10186
448 nmdc:mga0a205_88182_c1 3300050515 Bacteria 2998
449 Ga0495601_0006397 3300053077 Bacteria 6887
450 Ga0495601_0009632 3300053077 Bacteria 5720
451 Ga0495601_0057904 3300053077 Bacteria 2455
452 Ga0495601_0078215 3300053077 Bacteria 2119
453 Ga0495619_0001802 3300053085 Bacteria 14250
454 Ga0495619_0027711 3300053085 Bacteria 3652
455 Ga0495619_0135796 3300053085 Unclassified 1692
456 Ga0501084_0007657 3300054114 Bacteria 8900
457 Ga0501082_0015688 3300060353 Bacteria 6517
458 Ga0501082_0043859 3300060353 Bacteria 3857
459 Ga0501082_0079373 3300060353 Bacteria 2831
460 nmdc:mga05p37_135757_c1
461 JGI24746J21847_1000823
462 Ga0065712_10073436
463 Ga0070676_10002154
464 Ga0070690_100006893
465 Ga0070690_100051930
466 Ga0070690_100073108
467 Ga0070670_100078599
468 Ga0070677_10004154
469 Ga0070677_10010371
470 Ga0068869_100005534
471 Ga0068869_100021319
472 Ga0070666_10007681
473 Ga0068868_100009344
474 Ga0068868_100063644
475 Ga0068868_100067530
476 Ga0070689_100182408
477 Ga0070691_10002578
478 Ga0070687_100007102
479 Ga0070661_100082861
480 Ga0070669_100011904
481 Ga0070669_100012576
482 Ga0070669_100022378
483 Ga0070675_100003945
484 Ga0070675_100009113
485 Ga0070671_100011733
486 Ga0070671_100025997
487 Ga0070674_100005617
488 Ga0070673_100000718
489 Ga0070673_100001224
490 Ga0070673_100015137
491 Ga0070673_100058572
492 Ga0070688_100007957
493 Ga0070688_100008290
494 Ga0070714_100020743
495 Ga0070713_100167840
496 Ga0070711_100097301
497 Ga0070705_100014457
498 Ga0070700_100001992
499 Ga0070700_100009373
500 Ga0070700_100067888
501 Ga0070708_100005784
502 Ga0070708_100011788
503 Ga0070708_100013595
504 Ga0070663_100064930
505 Ga0070663_100161531
506 Ga0070678_100022064
507 Ga0070678_100026337
508 Ga0070678_100122099
509 Ga0070662_100047468
510 Ga0070681_10098333
511 Ga0068867_100010235
512 Ga0068867_100019633
513 Ga0070706_100055764
514 Ga0070706_100232027
515 Ga0070706_100241702
516 Ga0070707_100001823
517 Ga0070707_100057151
518 Ga0070698_100116381
519 Ga0070699_100000480
520 Ga0070699_100005774
521 Ga0070699_100031623
522 Ga0070699_100069157
523 Ga0070699_100155370
524 Ga0070679_100035148
525 Ga0070684_100047449
526 Ga0070684_100103418
527 Ga0070672_100009960
528 Ga0070672_100066110
529 Ga0070686_100004659
530 Ga0070686_100021484
531 Ga0070695_100018206
532 Ga0070696_100003832
533 Ga0070696_100004285
534 Ga0070696_100006008
535 Ga0070665_100006326
536 Ga0070665_100018473
537 Ga0070665_100173863
538 Ga0070704_100082752
539 Ga0070704_100158316
540 Ga0068855_100144268
541 Ga0070664_100014956
542 Ga0070664_100023852
543 Ga0068857_100151248
544 Ga0068854_100004171
545 Ga0068854_100005532
546 Ga0068856_100259497
547 Ga0070702_100013685
548 Ga0070702_100021880
549 Ga0068859_100005448
550 Ga0068859_100016111
551 Ga0068859_100111145
552 Ga0068864_100026196
553 Ga0068864_100038631
554 Ga0068864_100207447
555 Ga0068866_10007097
556 Ga0068861_100003132
557 Ga0068861_100013671
558 Ga0068861_100025775
559 Ga0068861_100058946
560 Ga0068870_10003118
561 Ga0068863_100062504
562 Ga0068863_100145639
563 Ga0068858_100017623
564 Ga0068858_100061072
565 Ga0068858_100071968
566 Ga0068858_100092610
567 Ga0068860_100018106
568 Ga0068860_100019208
569 Ga0068860_100083910
570 Ga0068860_100156707
571 Ga0068862_100012618
572 Ga0068862_100222004
573 Ga0081455_10016095
574 Ga0081539_10005303
575 Ga0075365_10016653
576 Ga0075368_10039429
577 Ga0075364_10057376
578 Ga0075362_10001000
579 Ga0075362_10010270
580 Ga0068871_100000983
581 Ga0075431_100011609
582 Ga0075433_10016364
583 Ga0075433_10025684
584 Ga0075433_10030908
585 Ga0075433_10060641
586 Ga0075433_10127309
587 Ga0075434_100002694
588 Ga0075434_100002939
589 Ga0075434_100003323
590 Ga0075434_100012701
591 Ga0075434_100020696
592 Ga0075434_100148525
593 Ga0075434_100223126
594 Ga0075434_100310853
595 Ga0075429_100026436
596 Ga0068865_100001604
597 Ga0068865_100007245
598 Ga0075436_100000305
599 Ga0097620_100005448
600 Ga0097620_100016111
601 Ga0097620_100111144
602 Ga0075435_100000012
603 Ga0075435_100007358
604 Ga0075435_100042563
605 Ga0075435_100050282
606 Ga0075435_100067359
607 Ga0105240_10031654
608 Ga0105240_10083102
609 Ga0111539_10001681
610 Ga0111539_10001822
611 Ga0111539_10003099
612 Ga0111539_10044245
613 Ga0111539_10063153
614 Ga0111539_10357233
615 Ga0105245_10188397
616 Ga0105247_10001308
617 Ga0105247_10040234
618 Ga0114129_10000153
619 Ga0114129_10004368
620 Ga0114129_10015794
621 Ga0114129_10015833
622 Ga0114129_10015886
623 Ga0114129_10020625
624 Ga0114129_10027372
625 Ga0114129_10078510
626 Ga0114129_10094228
627 Ga0114129_10170132
628 Ga0114129_10355801
629 Ga0114129_10357169
630 Ga0105243_10004496
631 Ga0105243_10026162
632 Ga0105242_10015625
633 Ga0105242_10029826
634 Ga0105242_10093831
635 Ga0105242_10148635
636 Ga0105242_10247047
637 Ga0105248_10004152
638 Ga0105248_10020608
639 Ga0105248_10028166
640 Ga0105248_10035993
641 Ga0105248_10055467
642 Ga0105248_10116668
643 Ga0105238_10010227
644 Ga0105249_10009530
645 Ga0105249_10148245
646 Ga0105246_10077231
647 Ga0105246_10135493
648 Ga0163162_10015046
649 Ga0157375_10256897
650 Ga0163163_10009290
651 Ga0163163_10065882
652 Ga0157380_10019511
653 Ga0157380_10019677
654 Ga0157380_10021741
655 Ga0157380_10041398
656 Ga0157380_10074855
657 Ga0157380_10224041
658 Ga0157377_10015151
659 Ga0157377_10054341
660 Ga0157379_10013635
661 Ga0157379_10058203
662 Ga0157379_10068979
663 Ga0157376_10013440
664 Ga0157376_10039983
665 Ga0157376_10046424
666 Ga0157376_10056086
667 Ga0163161_10006838
668 Ga0207697_10002571
669 Ga0207682_10002778
670 Ga0207682_10008735
671 Ga0207688_10011624
672 Ga0207645_10009335
673 Ga0207645_10010470
674 Ga0207645_10010472
675 Ga0207643_10004226
676 Ga0207643_10073516
677 Ga0207684_10025242
678 Ga0207695_10201532
679 Ga0207662_10005323
680 Ga0207662_10019468
681 Ga0207662_10027644
682 Ga0207662_10133577
683 Ga0207649_10100213
684 Ga0207652_10072038
685 Ga0207646_10084164
686 Ga0207646_10135785
687 Ga0207646_10136974
688 Ga0207646_10215204
689 Ga0207681_10013300
690 Ga0207681_10026199
691 Ga0207681_10061785
692 Ga0207694_10005515
693 Ga0207650_10015686
694 Ga0207650_10191688
695 Ga0207659_10002413
696 Ga0207659_10006238
697 Ga0207659_10009242
698 Ga0207659_10015855
699 Ga0207659_10109111
700 Ga0207687_10028799
701 Ga0207687_10066639
702 Ga0207700_10131698
703 Ga0207664_10036925
704 Ga0207644_10004503
705 Ga0207690_10027640
706 Ga0207706_10006430
707 Ga0207706_10025632
708 Ga0207706_10043902
709 Ga0207706_10208017
710 Ga0207686_10043704
711 Ga0207686_10157174
712 Ga0207709_10012657
713 Ga0207669_10005780
714 Ga0207704_10008092
715 Ga0207691_10013506
716 Ga0207691_10015117
717 Ga0207691_10018112
718 Ga0207691_10041882
719 Ga0207691_10077907
720 Ga0207711_10002803
721 Ga0207711_10002992
722 Ga0207711_10071743
723 Ga0207689_10003160
724 Ga0207689_10003182
725 Ga0207689_10004016
726 Ga0207661_10012184
727 Ga0207679_10006664
728 Ga0207679_10029864
729 Ga0207679_10148515
730 Ga0207651_10040858
731 Ga0207651_10078480
732 Ga0207712_10012583
733 Ga0207668_10045421
734 Ga0207668_10085800
735 Ga0207640_10145735
736 Ga0207658_10010962
737 Ga0207658_10169844
738 Ga0207677_10010755
739 Ga0207677_10052258
740 Ga0207703_10013310
741 Ga0207703_10014989
742 Ga0207703_10045833
743 Ga0207703_10131693
744 Ga0207703_10173851
745 Ga0207678_10063230
746 Ga0207678_10087169
747 Ga0207678_10138741
748 Ga0207708_10000706
749 Ga0207708_10009103
750 Ga0207708_10050745
751 Ga0207641_10010481
752 Ga0207648_10006451
753 Ga0207648_10007078
754 Ga0207648_10016579
755 Ga0207648_10042434
756 Ga0207648_10059700
757 Ga0207676_10027671
758 Ga0207676_10030367
759 Ga0207676_10037844
760 Ga0207674_10193862
761 Ga0207675_100001595
762 Ga0207675_100011388
763 Ga0207675_100013653
764 Ga0207675_100025146
765 Ga0207675_100039047
766 Ga0207675_100067905
767 Ga0207675_100100304
768 Ga0207683_10012512
769 Ga0207683_10019234
770 Ga0207683_10093289
771 Ga0207428_10000041
772 Ga0207428_10004093
773 Ga0207428_10012928
774 Ga0207428_10036425
775 Ga0268266_10009780
776 Ga0268266_10042170
777 Ga0268265_10055038
778 Ga0268265_10078194
779 Ga0268265_10193567
780 Ga0268264_10150879
781 Ga0268264_10209053
782 Ga0373930_0001321
783 Ga0373938_0001546
784 Ga0373929_0000574
785 Ga0373934_0030216
786 Ga0373940_0000066
787 Ga0373949_0000676
788 Ga0373932_0000173
789 Ga0373939_0000561
790 Ga0373941_0003930
791 Ga0373960_0022515
792 Ga0373946_0006791
793 Ga0373942_0000218
794 Ga0373961_0000622
795 Ga0373962_0000441
796 Ga0373924_0016906
797 Ga0373931_0006859
798 Ga0373947_0072539
799 Ga0373937_0227421
800 Ga0453683_0047118
801 Ga0451576_0025728
802 Ga0451576_0389907
803 Ga0495629_0123067
804 Ga0495651_0099232
805 Ga0495651_0188999
806 Ga0495653_0038376
807 Ga0495608_0005022
808 Ga0495652_0041130
809 Ga0495645_0002883
810 Ga0495656_0023095
811 Ga0495647_0006923
812 Ga0495658_0014098
813 Ga0495669_0013230
814 Ga0495613_0002297
815 Ga0495674_0008046
816 Ga0495684_0000747
817 Ga0495684_0057105
818 Ga0496104_0030378
819 Ga0496106_0094325
820 Ga0496107_0058825
821 Ga0496113_0030081
822 Ga0496113_0098977
823 Ga0501031_0007356
824 Ga0501032_0003211
825 Ga0501032_0041472
826 Ga0501033_0000840
827 Ga0501033_0001633
828 Ga0501034_0023851
829 Ga0501034_0115041
830 Ga0501034_0153403
831 Ga0501036_0003227
832 Ga0501036_0008827
833 Ga0501037_0001117
834 Ga0501037_0042919
835 Ga0501038_0001068
836 Ga0501042_0180387
837 Ga0501043_0048876
838 Ga0501046_0002503
839 Ga0501047_0004378
840 Ga0501047_0005191
841 Ga0501047_0008268
842 Ga0501048_0010355
843 Ga0501048_0060347
844 Ga0501067_0005668
845 Ga0501068_0019638
846 Ga0501070_0007239
847 Ga0501070_0010639
848 Ga0501073_0007229
849 Ga0501073_0012179
850 Ga0501073_0037576
851 Ga0501074_0004313
852 Ga0501076_0047978
853 Ga0501076_0099080
854 Ga0501079_0005515
855 Ga0501079_0015532
856 Ga0501080_0017331
857 Ga0501080_0038776
858 Ga0501083_0006968
859 Ga0501083_0058812
860 Ga0501083_0111790
861 Ga0501035_0001367
862 Ga0501044_0004959
863 Ga0501044_0007308
864 nmdc:mga03683_20801_c1
865 nmdc:mga0yw44_6290_c1
866 nmdc:mga0k408_388_c2
867 nmdc:mga06z11_369_c1
868 nmdc:mga07m45_8854_c1
869 nmdc:mga05p37_142447_c1
870 nmdc:mga05p37_148482_c1
871 nmdc:mga05p37_17015_c1
872 nmdc:mga05p37_17741_c1
873 nmdc:mga05p37_19524_c1
874 nmdc:mga05p37_20223_c1
875 nmdc:mga05p37_21043_c1
876 nmdc:mga05p37_3402_c1
877 nmdc:mga05p37_39098_c1
878 nmdc:mga05p37_42748_c1
879 nmdc:mga05p37_44036_c1
880 nmdc:mga05p37_48334_c1
881 nmdc:mga05p37_52930_c1
882 nmdc:mga05p37_76861_c1
883 nmdc:mga09592_113114_c1
884 nmdc:mga09592_14113_c1
885 nmdc:mga06r32_175621_c1
886 nmdc:mga08y16_121626_c1
887 nmdc:mga08y16_1593_c1
888 nmdc:mga08y16_22307_c1
889 nmdc:mga08y16_78200_c1
890 nmdc:mga08y16_925_c1
891 nmdc:mga0n895_100358_c1
892 nmdc:mga0n895_12_c1
893 nmdc:mga0n895_33336_c1
894 nmdc:mga0n895_4403_c1
895 nmdc:mga0n895_53343_c1
896 nmdc:mga0n895_94282_c1
897 nmdc:mga0rr50_115973_c1
898 nmdc:mga0rr50_191_c1
899 nmdc:mga0rr50_1_c1
900 nmdc:mga0rr50_97643_c1
901 nmdc:mga08x19_13308_c1
902 nmdc:mga08x19_87_c1
903 nmdc:mga0a205_19785_c1
904 nmdc:mga0a205_2346_c1
905 nmdc:mga0a205_29871_c1
906 nmdc:mga0a205_7003_c1
907 nmdc:mga0a205_88182_c1
908 Ga0495601_0006397
909 Ga0495601_0009632
910 Ga0495601_0057904
911 Ga0495601_0078215
912 Ga0495619_0001802
913 Ga0495619_0027711
914 Ga0495619_0135796
915 Ga0501084_0007657
916 Ga0501082_0015688
917 Ga0501082_0043859
918 Ga0501082_0079373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

207

368

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.8007 2 445
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.7841 2 445
4q37-assembly2.cif.gz_B crystal structure of the hypothetical protein tm0182 thermotoga maritima, n-terminal domain. 0.7748 79 148
4jc0-assembly2.cif.gz_B crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 0.7453 54 415
6b4c-assembly10.cif.gz_J structure of viperin from trichoderma virens 0.7262 211 389
ID Description Score Start End Superfamily
af_Q58882_171_402_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8397 190 375 3.80.30.20
af_P96395_164_380_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.81 189 379 3.80.30.20
af_Q58275_166_383_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8067 188 387 3.80.30.20
af_Q7K4W1_211_437_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8029 187 418 3.80.30.20
af_Q58376_168_384_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.7886 187 372 3.80.30.20
ID Description Score Start End GO Terms
AF-X0RJT7-F1-model_v4 Radical SAM core domain-containing protein 0.9748 294 428 GO:0005829
GO:0051536
AF-A0A7X8UE23-F1-model_v4 Radical SAM protein 0.9429 1 432 GO:0003824
GO:0005829
GO:0051539
AF-X0RJT7-F1-model_v4 Radical SAM core domain-containing protein 0.9213 294 428 GO:0005829
GO:0051536
AF-A0A7X8UE23-F1-model_v4 Radical SAM protein 0.908 1 432 GO:0003824
GO:0005829
GO:0051539
AF-X1UKC1-F1-model_v4 Radical SAM core domain-containing protein 0.9029 187 426 GO:0003824
GO:0051539

Map