F448391

General Info

Members Datasets Scaffolds Average Seq Length
459 224 918 329

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0029411|Ga0373925_0029411_1616_2614
Length 320
Sequence VTDAKRILVTGATGKVGQAFIRGLLASPDDRLAGFSIRALCHNRTLSPGPRLEIMTGPIEEQATAARALAGVTHVLHLATSKETPATIMDVAVKGLFWLLEACRASAGFRQFILIGGDAGIGHFFYPRPAPVTEAQPHSAYPGCYALSKVLELNTCCLRAPWIMEKDDFRCQLSFGEDVFGGPRWRDLVGAGQADAYLASGTVPVLLDEAGRPVKRNFVHVDDLAGAILSAIDNPAARQQTFNICMDEPVDYGELAAYLAQSRGLPSAGIRTPYHSTWLDNTKAKLLLGWRPRYDLRRLTDEAWDYQRSPDDPRVVGYPG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
222 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
223 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
224 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 2.83
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0029411 3300037068 Bacteria 4031
2 Ga0070676_10011820 3300005328 Bacteria 4753
3 Ga0070683_100001797 3300005329 Bacteria 16714
4 Ga0070690_100026581 3300005330 Bacteria 3571
5 Ga0070670_100015032 3300005331 Bacteria 6642
6 Ga0068869_100006978 3300005334 Bacteria 7190
7 Ga0068869_100013121 3300005334 Bacteria 5501
8 Ga0068869_100119027 3300005334 Bacteria 2018
9 Ga0070666_10056600 3300005335 Bacteria 2648
10 Ga0070680_100006818 3300005336 Bacteria 8703
11 Ga0070680_100194919 3300005336 Bacteria 1708
12 Ga0070682_100012852 3300005337 Bacteria 4804
13 Ga0070682_100079856 3300005337 Bacteria 2114
14 Ga0068868_100014476 3300005338 Bacteria 5813
15 Ga0068868_100023243 3300005338 Bacteria 4690
16 Ga0070691_10043254 3300005341 Bacteria 2133
17 Ga0070661_100008079 3300005344 Bacteria 7261
18 Ga0070661_100039105 3300005344 Bacteria 3456
19 Ga0070661_100074516 3300005344 Bacteria 2499
20 Ga0070668_100030351 3300005347 Bacteria 4109
21 Ga0070668_100056588 3300005347 Bacteria 3029
22 Ga0070675_100066793 3300005354 Bacteria 2975
23 Ga0070675_100185803 3300005354 Bacteria 1799
24 Ga0070675_100273321 3300005354 Bacteria 1483
25 Ga0070671_100020441 3300005355 Bacteria 5400
26 Ga0070673_100021661 3300005364 Bacteria 4665
27 Ga0070688_100042703 3300005365 Bacteria 2790
28 Ga0070688_100109508 3300005365 Bacteria 1835
29 Ga0070659_100195552 3300005366 Bacteria 1663
30 Ga0070667_100122585 3300005367 Bacteria 2262
31 Ga0070700_100001292 3300005441 Bacteria 12442
32 Ga0070663_100030159 3300005455 Bacteria 3714
33 Ga0070663_100134036 3300005455 Bacteria 1884
34 Ga0070678_100017945 3300005456 Bacteria 4573
35 Ga0070678_100022205 3300005456 Bacteria 4199
36 Ga0070662_100002148 3300005457 Bacteria 12083
37 Ga0070662_100027372 3300005457 Bacteria 3956
38 Ga0070662_100055397 3300005457 Bacteria 2876
39 Ga0070681_10017551 3300005458 Bacteria 7152
40 Ga0068867_100004779 3300005459 Bacteria 9537
41 Ga0068867_100167765 3300005459 Bacteria 1736
42 Ga0070685_10014610 3300005466 Bacteria 4161
43 Ga0070679_100080374 3300005530 Bacteria 3249
44 Ga0070679_100316071 3300005530 Bacteria 1511
45 Ga0070684_100019834 3300005535 Bacteria 5570
46 Ga0070684_100025143 3300005535 Bacteria 5001
47 Ga0070684_100112420 3300005535 Bacteria 2443
48 Ga0070684_100210774 3300005535 Bacteria 1771
49 Ga0068853_100068526 3300005539 Bacteria 3085
50 Ga0068853_100240565 3300005539 Bacteria 1659
51 Ga0068853_100244676 3300005539 Bacteria 1645
52 Ga0070672_100036643 3300005543 Bacteria 3738
53 Ga0070686_100152299 3300005544 Bacteria 1620
54 Ga0070695_100123684 3300005545 Bacteria 1774
55 Ga0070695_100125479 3300005545 Bacteria 1762
56 Ga0070696_100021194 3300005546 Bacteria 4406
57 Ga0070693_100029535 3300005547 Bacteria 2991
58 Ga0070665_100003338 3300005548 Bacteria 17199
59 Ga0070665_100491341 3300005548 Bacteria 1238
60 Ga0068855_100000150 3300005563 Bacteria 88674
61 Ga0068855_100000710 3300005563 Bacteria 40782
62 Ga0068855_100002863 3300005563 Bacteria 21190
63 Ga0068855_100031359 3300005563 Bacteria 6347
64 Ga0068855_100091428 3300005563 Bacteria 3510
65 Ga0068855_100275317 3300005563 Bacteria 1871
66 Ga0070664_100020094 3300005564 Bacteria 5499
67 Ga0070664_100030162 3300005564 Bacteria 4524
68 Ga0068857_100000278 3300005577 Bacteria 34985
69 Ga0068857_100001769 3300005577 Bacteria 17364
70 Ga0068857_100091505 3300005577 Unclassified 2723
71 Ga0068854_100002307 3300005578 Bacteria 11751
72 Ga0068854_100005586 3300005578 Bacteria 7946
73 Ga0068854_100012706 3300005578 Bacteria 5514
74 Ga0068856_100001272 3300005614 Bacteria 26535
75 Ga0068856_100001823 3300005614 Bacteria 22267
76 Ga0068856_100003070 3300005614 Bacteria 17059
77 Ga0068856_100017007 3300005614 Bacteria 7048
78 Ga0068856_100018168 3300005614 Bacteria 6819
79 Ga0068856_100026837 3300005614 Bacteria 5616
80 Ga0068852_100004279 3300005616 Bacteria 10072
81 Ga0068852_100020362 3300005616 Bacteria 5275
82 Ga0068852_100103009 3300005616 Bacteria 2580
83 Ga0068852_100440642 3300005616 Bacteria 1288
84 Ga0068859_100000876 3300005617 Bacteria 30715
85 Ga0068859_100007098 3300005617 Bacteria 11371
86 Ga0068859_100023675 3300005617 Bacteria 6163
87 Ga0068859_100039505 3300005617 Bacteria 4734
88 Ga0068859_100073381 3300005617 Plasmid 3460
89 Ga0068864_100005305 3300005618 Bacteria 10552
90 Ga0068864_100131873 3300005618 Bacteria 2245
91 Ga0068866_10007421 3300005718 Bacteria 4589
92 Ga0068866_10131828 3300005718 Bacteria 1422
93 Ga0068861_100163055 3300005719 Bacteria 1840
94 Ga0068851_10016627 3300005834 Bacteria 3524
95 Ga0068851_10017068 3300005834 Bacteria 3483
96 Ga0068863_100063030 3300005841 Bacteria 3506
97 Ga0068863_100188137 3300005841 Bacteria 1984
98 Ga0068863_100304294 3300005841 Bacteria 1547
99 Ga0068858_100002200 3300005842 Bacteria 19743
100 Ga0068858_100008971 3300005842 Bacteria 9577
101 Ga0068858_100011987 3300005842 Bacteria 8171
102 Ga0068858_100041187 3300005842 Bacteria 4283
103 Ga0068860_100010955 3300005843 Bacteria 8938
104 Ga0068860_100035784 3300005843 Bacteria 4761
105 Ga0068860_100039627 3300005843 Bacteria 4506
106 Ga0068860_100051924 3300005843 Bacteria 3900
107 Ga0068860_100056767 3300005843 Bacteria 3721
108 Ga0068862_100012273 3300005844 Bacteria 7085
109 Ga0068862_100021050 3300005844 Bacteria 5450
110 Ga0068862_100089662 3300005844 Bacteria 2677
111 Ga0081539_10008105 3300005985 Bacteria 9283
112 Ga0070717_10005699 3300006028 Bacteria 9106
113 Ga0070717_10304928 3300006028 Bacteria 1416
114 Ga0070717_10319310 3300006028 Bacteria 1384
115 Ga0075368_10044230 3300006042 Bacteria 1756
116 Ga0075368_10081727 3300006042 Bacteria 1315
117 Ga0070712_100116529 3300006175 Bacteria 2004
118 Ga0097621_100000193 3300006237 Bacteria 39373
119 Ga0097621_100013047 3300006237 Bacteria 6178
120 Ga0097621_100104332 3300006237 Bacteria 2389
121 Ga0097621_100375847 3300006237 Bacteria 1268
122 Ga0068871_100000784 3300006358 Bacteria 21393
123 Ga0068871_100011490 3300006358 Bacteria 6497
124 Ga0068871_100016129 3300006358 Bacteria 5614
125 Ga0068871_100016452 3300006358 Bacteria 5571
126 Ga0075428_100077223 3300006844 Bacteria 3635
127 Ga0075433_10025676 3300006852 Unclassified 4981
128 Ga0075434_100009823 3300006871 Bacteria 8946
129 Ga0097620_100000876 3300006931 Bacteria 30715
130 Ga0097620_100007098 3300006931 Bacteria 11371
131 Ga0097620_100023677 3300006931 Bacteria 6163
132 Ga0097620_100039500 3300006931 Bacteria 4734
133 Ga0097620_100073386 3300006931 Plasmid 3460
134 Ga0075435_100133373 3300007076 Bacteria 2079
135 Ga0105240_10007224 3300009093 Bacteria 16175
136 Ga0105240_10012638 3300009093 Bacteria 11641
137 Ga0105240_10180211 3300009093 Bacteria 2494
138 Ga0111539_10022775 3300009094 Bacteria 7694
139 Ga0105245_10017092 3300009098 Bacteria 6330
140 Ga0105245_10100460 3300009098 Bacteria 2676
141 Ga0105245_10525348 3300009098 Bacteria 1202
142 Ga0105247_10015206 3300009101 Bacteria 4614
143 Ga0105243_10430823 3300009148 Bacteria 1233
144 Ga0105241_10001517 3300009174 Bacteria 17795
145 Ga0105241_10008864 3300009174 Bacteria 7396
146 Ga0105241_10025368 3300009174 Bacteria 4404
147 Ga0105241_10063667 3300009174 Bacteria 2846
148 Ga0105242_10052898 3300009176 Bacteria 3315
149 Ga0105242_10132429 3300009176 Bacteria 2154
150 Ga0105248_10009130 3300009177 Bacteria 10906
151 Ga0105248_10024396 3300009177 Bacteria 6725
152 Ga0105248_10061993 3300009177 Bacteria 4199
153 Ga0105248_10077640 3300009177 Bacteria 3733
154 Ga0105237_10027632 3300009545 Bacteria 5787
155 Ga0105237_10101199 3300009545 Bacteria 2874
156 Ga0105238_10005079 3300009551 Bacteria 13010
157 Ga0105238_10006905 3300009551 Bacteria 11337
158 Ga0105238_10035109 3300009551 Bacteria 5100
159 Ga0105238_10049079 3300009551 Bacteria 4252
160 Ga0105238_10052898 3300009551 Bacteria 4081
161 Ga0105238_10117126 3300009551 Bacteria 2644
162 Ga0105249_10036696 3300009553 Bacteria 4446
163 Ga0105249_10118064 3300009553 Bacteria 2517
164 Ga0105239_10023825 3300010375 Bacteria 6741
165 Ga0105239_10047715 3300010375 Bacteria 4694
166 Ga0105239_10159981 3300010375 Bacteria 2515
167 Ga0105239_10787446 3300010375 Bacteria 1089
168 Ga0105246_10035224 3300011119 Bacteria 3344
169 Ga0157371_10002531 3300013102 Bacteria 17360
170 Ga0157369_10005308 3300013105 Bacteria 15018
171 Ga0157369_10005398 3300013105 Bacteria 14878
172 Ga0157369_10247339 3300013105 Bacteria 1862
173 Ga0157374_10011649 3300013296 Bacteria 7624
174 Ga0157374_10011864 3300013296 Bacteria 7560
175 Ga0157374_10023394 3300013296 Bacteria 5527
176 Ga0157374_10466538 3300013296 Bacteria 1265
177 Ga0157378_10001432 3300013297 Bacteria 21488
178 Ga0157378_10006048 3300013297 Bacteria 10602
179 Ga0157378_10023115 3300013297 Bacteria 5470
180 Ga0157378_10031125 3300013297 Bacteria 4712
181 Ga0157378_10033116 3300013297 Unclassified 4567
182 Ga0157378_10120482 3300013297 Bacteria 2418
183 Ga0163162_10001352 3300013306 Bacteria 22820
184 Ga0163162_10003471 3300013306 Bacteria 15061
185 Ga0163162_10007420 3300013306 Bacteria 10663
186 Ga0163162_10055174 3300013306 Bacteria 3999
187 Ga0163162_10075131 3300013306 Plasmid 3439
188 Ga0157372_10005505 3300013307 Bacteria 13460
189 Ga0157372_10016896 3300013307 Bacteria 7833
190 Ga0157372_10020949 3300013307 Bacteria 7058
191 Ga0157372_10116662 3300013307 Bacteria 3061
192 Ga0157372_10196842 3300013307 Bacteria 2334
193 Ga0157372_10350697 3300013307 Bacteria 1719
194 Ga0157372_10605226 3300013307 Bacteria 1277
195 Ga0157375_10094736 3300013308 Bacteria 3055
196 Ga0157375_10116095 3300013308 Bacteria 2781
197 Ga0157375_10282159 3300013308 Bacteria 1824
198 Ga0163163_10047057 3300014325 Bacteria 4238
199 Ga0163163_10090564 3300014325 Bacteria 3072
200 Ga0163163_10239019 3300014325 Bacteria 1866
201 Ga0157377_10064885 3300014745 Bacteria 2096
202 Ga0157379_10009247 3300014968 Bacteria 8584
203 Ga0157379_10071692 3300014968 Bacteria 3099
204 Ga0157376_10012111 3300014969 Bacteria 6388
205 Ga0157376_10068456 3300014969 Unclassified 3006
206 Ga0157376_10103175 3300014969 Bacteria 2496
207 Ga0157376_10141587 3300014969 Bacteria 2158
208 Ga0157376_10206655 3300014969 Bacteria 1810
209 Ga0163161_10008683 3300017792 Bacteria 7027
210 Ga0207656_10079667 3300025321 Bacteria 1470
211 Ga0207692_10143775 3300025898 Bacteria 1359
212 Ga0207642_10074486 3300025899 Bacteria 1627
213 Ga0207710_10006112 3300025900 Bacteria 5159
214 Ga0207680_10022637 3300025903 Bacteria 3421
215 Ga0207680_10086743 3300025903 Bacteria 1980
216 Ga0207680_10133169 3300025903 Bacteria 1640
217 Ga0207647_10048364 3300025904 Bacteria 2641
218 Ga0207647_10176037 3300025904 Bacteria 1244
219 Ga0207699_10103983 3300025906 Bacteria 1808
220 Ga0207645_10025792 3300025907 Bacteria 3802
221 Ga0207654_10000420 3300025911 Bacteria 24297
222 Ga0207654_10002275 3300025911 Bacteria 9847
223 Ga0207654_10007191 3300025911 Bacteria 5608
224 Ga0207654_10014135 3300025911 Bacteria 4119
225 Ga0207654_10019594 3300025911 Bacteria 3574
226 Ga0207654_10246917 3300025911 Unclassified 1195
227 Ga0207707_10075532 3300025912 Bacteria 2940
228 Ga0207695_10000002 3300025913 Bacteria 2188391
229 Ga0207695_10000154 3300025913 Bacteria 206200
230 Ga0207695_10000911 3300025913 Bacteria 53168
231 Ga0207695_10004455 3300025913 Bacteria 19087
232 Ga0207695_10007921 3300025913 Bacteria 13408
233 Ga0207695_10020314 3300025913 Bacteria 7610
234 Ga0207695_10043816 3300025913 Bacteria 4764
235 Ga0207695_10289947 3300025913 Bacteria 1529
236 Ga0207695_10401499 3300025913 Bacteria 1255
237 Ga0207671_10000178 3300025914 Bacteria 96763
238 Ga0207671_10013036 3300025914 Bacteria 6649
239 Ga0207671_10063828 3300025914 Bacteria 2737
240 Ga0207671_10087515 3300025914 Bacteria 2343
241 Ga0207671_10142055 3300025914 Bacteria 1850
242 Ga0207693_10206622 3300025915 Bacteria 1544
243 Ga0207657_10002904 3300025919 Bacteria 18395
244 Ga0207649_10001210 3300025920 Bacteria 15551
245 Ga0207649_10026458 3300025920 Bacteria 3394
246 Ga0207652_10007395 3300025921 Bacteria 8855
247 Ga0207652_10073513 3300025921 Bacteria 2974
248 Ga0207652_10085915 3300025921 Bacteria 2758
249 Ga0207652_10128341 3300025921 Bacteria 2260
250 Ga0207646_10329631 3300025922 Bacteria 1379
251 Ga0207681_10000571 3300025923 Bacteria 25110
252 Ga0207694_10000116 3300025924 Bacteria 84418
253 Ga0207694_10000666 3300025924 Bacteria 30834
254 Ga0207694_10020026 3300025924 Bacteria 5060
255 Ga0207694_10020549 3300025924 Bacteria 4997
256 Ga0207694_10035634 3300025924 Bacteria 3818
257 Ga0207694_10043395 3300025924 Bacteria 3471
258 Ga0207694_10177893 3300025924 Unclassified 1724
259 Ga0207694_10190218 3300025924 Bacteria 1667
260 Ga0207687_10025276 3300025927 Bacteria 3973
261 Ga0207687_10026734 3300025927 Bacteria 3867
262 Ga0207687_10120648 3300025927 Bacteria 1960
263 Ga0207687_10404169 3300025927 Bacteria 1124
264 Ga0207644_10154179 3300025931 Bacteria 1780
265 Ga0207706_10000422 3300025933 Bacteria 45508
266 Ga0207706_10025761 3300025933 Bacteria 5268
267 Ga0207706_10107898 3300025933 Bacteria 2450
268 Ga0207686_10113675 3300025934 Bacteria 1831
269 Ga0207709_10017525 3300025935 Bacteria 3997
270 Ga0207691_10045838 3300025940 Bacteria 4019
271 Ga0207691_10106093 3300025940 Bacteria 2502
272 Ga0207711_10035862 3300025941 Bacteria 4206
273 Ga0207711_10067212 3300025941 Bacteria 3102
274 Ga0207711_10228900 3300025941 Bacteria 1702
275 Ga0207689_10000828 3300025942 Bacteria 29823
276 Ga0207689_10025184 3300025942 Bacteria 4987
277 Ga0207689_10025360 3300025942 Bacteria 4968
278 Ga0207661_10059537 3300025944 Bacteria 3078
279 Ga0207661_10085444 3300025944 Bacteria 2615
280 Ga0207679_10022231 3300025945 Bacteria 4315
281 Ga0207679_10030245 3300025945 Bacteria 3779
282 Ga0207679_10084708 3300025945 Bacteria 2433
283 Ga0207667_10001892 3300025949 Bacteria 26289
284 Ga0207667_10019336 3300025949 Bacteria 7607
285 Ga0207667_10020840 3300025949 Bacteria 7279
286 Ga0207667_10034679 3300025949 Bacteria 5417
287 Ga0207667_10261096 3300025949 Bacteria 1771
288 Ga0207667_10292059 3300025949 Bacteria 1665
289 Ga0207651_10014308 3300025960 Bacteria 4575
290 Ga0207712_10030997 3300025961 Bacteria 3599
291 Ga0207668_10029543 3300025972 Bacteria 3593
292 Ga0207640_10005753 3300025981 Bacteria 6757
293 Ga0207640_10014132 3300025981 Bacteria 4590
294 Ga0207640_10181831 3300025981 Bacteria 1577
295 Ga0207658_10137485 3300025986 Bacteria 1972
296 Ga0207658_10174244 3300025986 Bacteria 1775
297 Ga0207677_10004322 3300026023 Bacteria 7612
298 Ga0207677_10004935 3300026023 Bacteria 7207
299 Ga0207677_10016441 3300026023 Bacteria 4384
300 Ga0207677_10021064 3300026023 Bacteria 3976
301 Ga0207677_10080859 3300026023 Bacteria 2330
302 Ga0207703_10009984 3300026035 Bacteria 7446
303 Ga0207703_10026410 3300026035 Bacteria 4570
304 Ga0207703_10052537 3300026035 Bacteria 3309
305 Ga0207639_10002961 3300026041 Bacteria 11420
306 Ga0207639_10003068 3300026041 Bacteria 11237
307 Ga0207639_10020864 3300026041 Bacteria 4698
308 Ga0207639_10264562 3300026041 Bacteria 1506
309 Ga0207678_10001295 3300026067 Bacteria 23151
310 Ga0207678_10016957 3300026067 Bacteria 6396
311 Ga0207708_10002797 3300026075 Bacteria 12827
312 Ga0207702_10010247 3300026078 Bacteria 7849
313 Ga0207702_10020176 3300026078 Bacteria 5520
314 Ga0207702_10026169 3300026078 Bacteria 4842
315 Ga0207702_10031738 3300026078 Bacteria 4404
316 Ga0207702_10063133 3300026078 Unclassified 3167
317 Ga0207702_10395897 3300026078 Bacteria 1331
318 Ga0207641_10005245 3300026088 Bacteria 11081
319 Ga0207641_10013260 3300026088 Bacteria 6760
320 Ga0207641_10056445 3300026088 Bacteria 3338
321 Ga0207641_10111995 3300026088 Bacteria 2421
322 Ga0207641_10194966 3300026088 Bacteria 1864
323 Ga0207648_10005925 3300026089 Bacteria 12225
324 Ga0207648_10012699 3300026089 Bacteria 7872
325 Ga0207648_10216242 3300026089 Bacteria 1702
326 Ga0207676_10016423 3300026095 Bacteria 5361
327 Ga0207676_10075723 3300026095 Bacteria 2716
328 Ga0207676_10372016 3300026095 Bacteria 1328
329 Ga0207674_10000505 3300026116 Bacteria 51554
330 Ga0207674_10003555 3300026116 Bacteria 19018
331 Ga0207674_10003635 3300026116 Bacteria 18801
332 Ga0207674_10047394 3300026116 Bacteria 4406
333 Ga0207674_10070236 3300026116 Bacteria 3521
334 Ga0207674_10232434 3300026116 Bacteria 1791
335 Ga0207674_10262890 3300026116 Bacteria 1673
336 Ga0207675_100082887 3300026118 Bacteria 3008
337 Ga0207675_100110208 3300026118 Bacteria 2597
338 Ga0207675_100137546 3300026118 Bacteria 2319
339 Ga0207683_10005853 3300026121 Bacteria 10542
340 Ga0207683_10120691 3300026121 Bacteria 2353
341 Ga0207698_10000777 3300026142 Bacteria 18558
342 Ga0207698_10068821 3300026142 Bacteria 2797
343 Ga0207698_10085396 3300026142 Bacteria 2563
344 Ga0207698_10382287 3300026142 Unclassified 1340
345 Ga0207428_10057914 3300027907 Bacteria 3076
346 Ga0268266_10026635 3300028379 Bacteria 4919
347 Ga0268266_10048804 3300028379 Bacteria 3629
348 Ga0268265_10044410 3300028380 Bacteria 3309
349 Ga0268265_10049713 3300028380 Bacteria 3155
350 Ga0268264_10042828 3300028381 Bacteria 3749
351 Ga0268264_10065689 3300028381 Bacteria 3057
352 Ga0265334_10006365 3300028573 Bacteria 5091
353 Ga0265318_10000233 3300028577 Bacteria 48146
354 Ga0265338_10149199 3300028800 Bacteria 1819
355 Ga0265320_10026665 3300031240 Bacteria 3021
356 Ga0265320_10048854 3300031240 Bacteria 2062
357 Ga0265325_10020593 3300031241 Unclassified 3635
358 Ga0265325_10030228 3300031241 Bacteria 2906
359 Ga0265331_10013771 3300031250 Bacteria 4336
360 Ga0307513_10236017 3300031456 Bacteria 1638
361 Ga0265313_10002318 3300031595 Bacteria 16684
362 Ga0265313_10016952 3300031595 Bacteria 4164
363 Ga0265314_10017391 3300031711 Bacteria 5645
364 Ga0373936_0012150 3300035113 Bacteria 3270
365 Ga0373954_0100739 3300035118 Bacteria 1393
366 Ga0373943_0024519 3300035170 Bacteria 2813
367 Ga0373946_0049426 3300035171 Bacteria 1753
368 Ga0373955_0211505 3300035172 Bacteria 1156
369 Ga0373961_0031495 3300035241 Bacteria 1482
370 Ga0373931_0044538 3300035691 Bacteria 2341
371 Ga0373935_0027572 3300035692 Bacteria 3511
372 Ga0373933_0179893 3300035724 Bacteria 1349
373 Ga0373947_0020904 3300035725 Bacteria 3784
374 Ga0373947_0170303 3300035725 Bacteria 1413
375 Ga0373937_0034485 3300036401 Bacteria 4604
376 Ga0373925_0010634 3300037068 Bacteria 6673
377 Ga0395905_0205296 3300037471 Bacteria 1847
378 Ga0436365_1497713 3300039437 Bacteria 1906
379 Ga0451797_1343841 3300041453 Bacteria 1585
380 Ga0466960_0173831 3300044901 Bacteria 1164
381 Ga0466967_0256425 3300045976 Bacteria 1672
382 Ga0495592_0378410 3300046454 Bacteria 901
383 Ga0495603_0063833 3300046455 Bacteria 2172
384 Ga0495603_0116607 3300046455 Bacteria 1557
385 Ga0495629_0023770 3300046459 Bacteria 4365
386 Ga0495629_0091313 3300046459 Bacteria 2125
387 Ga0495651_0161874 3300046462 Bacteria 1602
388 Ga0495653_0154202 3300046463 Bacteria 1602
389 Ga0495580_0017481 3300046472 Bacteria 5363
390 Ga0495582_0009293 3300046473 Bacteria 5422
391 Ga0495662_0094055 3300046476 Bacteria 1463
392 Ga0495662_0210088 3300046476 Bacteria 959
393 Ga0495618_0111080 3300046514 Bacteria 1755
394 Ga0495630_0051367 3300046517 Bacteria 3086
395 Ga0495630_0056029 3300046517 Bacteria 2954
396 Ga0495630_0275650 3300046517 Bacteria 1285
397 Ga0495630_0347872 3300046517 Bacteria 1134
398 Ga0495665_0015177 3300046531 Bacteria 4152
399 Ga0495640_0267716 3300046533 Bacteria 1066
400 Ga0495586_0149788 3300046535 Bacteria 1312
401 Ga0495587_0092586 3300046536 Bacteria 1746
402 Ga0495587_0214510 3300046536 Bacteria 1086
403 Ga0495645_0103881 3300046543 Bacteria 2018
404 Ga0495667_0133130 3300046559 Bacteria 1603
405 Ga0495634_0045684 3300046642 Bacteria 2959
406 Ga0495635_0065826 3300046663 Bacteria 2486
407 Ga0495647_0183197 3300046681 Bacteria 912
408 Ga0495658_0076795 3300046683 Bacteria 1953
409 Ga0495613_0113367 3300046689 Bacteria 1952
410 Ga0495624_0028610 3300046690 Bacteria 3640
411 Ga0495624_0047435 3300046690 Bacteria 2730
412 Ga0495600_0167876 3300046809 Bacteria 1417
413 Ga0495581_0028435 3300047315 Bacteria 3240
414 Ga0495674_0048269 3300047319 Bacteria 3768
415 Ga0495674_0054267 3300047319 Bacteria 3520
416 Ga0495676_0168127 3300047321 Bacteria 1545
417 Ga0495676_0288135 3300047321 Bacteria 1110
418 Ga0495680_0019952 3300047322 Bacteria 5650
419 Ga0495684_0077238 3300047471 Bacteria 2529
420 Ga0495593_0116140 3300047673 Bacteria 1364
421 Ga0495602_0216983 3300048088 Bacteria 1447
422 Ga0496100_0059260 3300048903 Bacteria 2515
423 Ga0496101_0045851 3300048904 Unclassified 3133
424 Ga0496101_0118556 3300048904 Bacteria 1999
425 Ga0496102_0181828 3300048905 Bacteria 1981
426 Ga0496105_0109889 3300048908 Bacteria 2276
427 Ga0496107_0015617 3300048910 Bacteria 5324
428 Ga0496108_0264332 3300048911 Bacteria 1497
429 Ga0496108_0319878 3300048911 Bacteria 1353
430 Ga0496112_0080451 3300048915 Bacteria 3222
431 Ga0496114_0000157 3300048917 Bacteria 48126
432 Ga0496115_0069371 3300048918 Bacteria 2855
433 Ga0496115_0080636 3300048918 Bacteria 2650
434 Ga0501036_0193118 3300049572 Bacteria 1713
435 Ga0501047_0248186 3300049581 Bacteria 1629
436 Ga0501048_0053764 3300049582 Bacteria 2862
437 Ga0501072_0187712 3300049588 Bacteria 1649
438 Ga0501073_0003025 3300049589 Bacteria 12606
439 Ga0501075_0313024 3300049591 Bacteria 1196
440 Ga0501081_0101783 3300049743 Bacteria 2031
441 nmdc:mga00v17_141990_c1 3300050491 Bacteria 1540
442 nmdc:mga04h51_40049_c1 3300050495 Bacteria 1525
443 nmdc:mga05p37_18069_c1 3300050507 Bacteria 8518
444 nmdc:mga05p37_399535_c1 3300050507 Bacteria 1605
445 nmdc:mga08y16_93078_c1 3300050511 Bacteria 3141
446 nmdc:mga0n895_24900_c1 3300050512 Bacteria 5647
447 nmdc:mga0rr50_176229_c1 3300050513 Bacteria 1745
448 nmdc:mga0a205_37222_c1 3300050515 Unclassified 4679
449 Ga0495601_0007356 3300053077 Bacteria 6457
450 Ga0495601_0007901 3300053077 Bacteria 6267
451 Ga0495601_0181984 3300053077 Bacteria 1374
452 Ga0495595_0059644 3300053084 Bacteria 1784
453 Ga0495619_0031919 3300053085 Bacteria 3415
454 Ga0501082_0016818 3300060353 Bacteria 6299
455 Ga0501082_0048173 3300060353 Bacteria 3673
456 2511243079 2511231002 Bacteria 5042903
457 2643969737 2643221592 Bacteria 6608788
458 2644141322 2643221625 Bacteria 6512927
459 2644274371 2643221648 Bacteria 6521465
460 Ga0373925_0029411
461 Ga0070676_10011820
462 Ga0070683_100001797
463 Ga0070690_100026581
464 Ga0070670_100015032
465 Ga0068869_100006978
466 Ga0068869_100013121
467 Ga0068869_100119027
468 Ga0070666_10056600
469 Ga0070680_100006818
470 Ga0070680_100194919
471 Ga0070682_100012852
472 Ga0070682_100079856
473 Ga0068868_100014476
474 Ga0068868_100023243
475 Ga0070691_10043254
476 Ga0070661_100008079
477 Ga0070661_100039105
478 Ga0070661_100074516
479 Ga0070668_100030351
480 Ga0070668_100056588
481 Ga0070675_100066793
482 Ga0070675_100185803
483 Ga0070675_100273321
484 Ga0070671_100020441
485 Ga0070673_100021661
486 Ga0070688_100042703
487 Ga0070688_100109508
488 Ga0070659_100195552
489 Ga0070667_100122585
490 Ga0070700_100001292
491 Ga0070663_100030159
492 Ga0070663_100134036
493 Ga0070678_100017945
494 Ga0070678_100022205
495 Ga0070662_100002148
496 Ga0070662_100027372
497 Ga0070662_100055397
498 Ga0070681_10017551
499 Ga0068867_100004779
500 Ga0068867_100167765
501 Ga0070685_10014610
502 Ga0070679_100080374
503 Ga0070679_100316071
504 Ga0070684_100019834
505 Ga0070684_100025143
506 Ga0070684_100112420
507 Ga0070684_100210774
508 Ga0068853_100068526
509 Ga0068853_100240565
510 Ga0068853_100244676
511 Ga0070672_100036643
512 Ga0070686_100152299
513 Ga0070695_100123684
514 Ga0070695_100125479
515 Ga0070696_100021194
516 Ga0070693_100029535
517 Ga0070665_100003338
518 Ga0070665_100491341
519 Ga0068855_100000150
520 Ga0068855_100000710
521 Ga0068855_100002863
522 Ga0068855_100031359
523 Ga0068855_100091428
524 Ga0068855_100275317
525 Ga0070664_100020094
526 Ga0070664_100030162
527 Ga0068857_100000278
528 Ga0068857_100001769
529 Ga0068857_100091505
530 Ga0068854_100002307
531 Ga0068854_100005586
532 Ga0068854_100012706
533 Ga0068856_100001272
534 Ga0068856_100001823
535 Ga0068856_100003070
536 Ga0068856_100017007
537 Ga0068856_100018168
538 Ga0068856_100026837
539 Ga0068852_100004279
540 Ga0068852_100020362
541 Ga0068852_100103009
542 Ga0068852_100440642
543 Ga0068859_100000876
544 Ga0068859_100007098
545 Ga0068859_100023675
546 Ga0068859_100039505
547 Ga0068859_100073381
548 Ga0068864_100005305
549 Ga0068864_100131873
550 Ga0068866_10007421
551 Ga0068866_10131828
552 Ga0068861_100163055
553 Ga0068851_10016627
554 Ga0068851_10017068
555 Ga0068863_100063030
556 Ga0068863_100188137
557 Ga0068863_100304294
558 Ga0068858_100002200
559 Ga0068858_100008971
560 Ga0068858_100011987
561 Ga0068858_100041187
562 Ga0068860_100010955
563 Ga0068860_100035784
564 Ga0068860_100039627
565 Ga0068860_100051924
566 Ga0068860_100056767
567 Ga0068862_100012273
568 Ga0068862_100021050
569 Ga0068862_100089662
570 Ga0081539_10008105
571 Ga0070717_10005699
572 Ga0070717_10304928
573 Ga0070717_10319310
574 Ga0075368_10044230
575 Ga0075368_10081727
576 Ga0070712_100116529
577 Ga0097621_100000193
578 Ga0097621_100013047
579 Ga0097621_100104332
580 Ga0097621_100375847
581 Ga0068871_100000784
582 Ga0068871_100011490
583 Ga0068871_100016129
584 Ga0068871_100016452
585 Ga0075428_100077223
586 Ga0075433_10025676
587 Ga0075434_100009823
588 Ga0097620_100000876
589 Ga0097620_100007098
590 Ga0097620_100023677
591 Ga0097620_100039500
592 Ga0097620_100073386
593 Ga0075435_100133373
594 Ga0105240_10007224
595 Ga0105240_10012638
596 Ga0105240_10180211
597 Ga0111539_10022775
598 Ga0105245_10017092
599 Ga0105245_10100460
600 Ga0105245_10525348
601 Ga0105247_10015206
602 Ga0105243_10430823
603 Ga0105241_10001517
604 Ga0105241_10008864
605 Ga0105241_10025368
606 Ga0105241_10063667
607 Ga0105242_10052898
608 Ga0105242_10132429
609 Ga0105248_10009130
610 Ga0105248_10024396
611 Ga0105248_10061993
612 Ga0105248_10077640
613 Ga0105237_10027632
614 Ga0105237_10101199
615 Ga0105238_10005079
616 Ga0105238_10006905
617 Ga0105238_10035109
618 Ga0105238_10049079
619 Ga0105238_10052898
620 Ga0105238_10117126
621 Ga0105249_10036696
622 Ga0105249_10118064
623 Ga0105239_10023825
624 Ga0105239_10047715
625 Ga0105239_10159981
626 Ga0105239_10787446
627 Ga0105246_10035224
628 Ga0157371_10002531
629 Ga0157369_10005308
630 Ga0157369_10005398
631 Ga0157369_10247339
632 Ga0157374_10011649
633 Ga0157374_10011864
634 Ga0157374_10023394
635 Ga0157374_10466538
636 Ga0157378_10001432
637 Ga0157378_10006048
638 Ga0157378_10023115
639 Ga0157378_10031125
640 Ga0157378_10033116
641 Ga0157378_10120482
642 Ga0163162_10001352
643 Ga0163162_10003471
644 Ga0163162_10007420
645 Ga0163162_10055174
646 Ga0163162_10075131
647 Ga0157372_10005505
648 Ga0157372_10016896
649 Ga0157372_10020949
650 Ga0157372_10116662
651 Ga0157372_10196842
652 Ga0157372_10350697
653 Ga0157372_10605226
654 Ga0157375_10094736
655 Ga0157375_10116095
656 Ga0157375_10282159
657 Ga0163163_10047057
658 Ga0163163_10090564
659 Ga0163163_10239019
660 Ga0157377_10064885
661 Ga0157379_10009247
662 Ga0157379_10071692
663 Ga0157376_10012111
664 Ga0157376_10068456
665 Ga0157376_10103175
666 Ga0157376_10141587
667 Ga0157376_10206655
668 Ga0163161_10008683
669 Ga0207656_10079667
670 Ga0207692_10143775
671 Ga0207642_10074486
672 Ga0207710_10006112
673 Ga0207680_10022637
674 Ga0207680_10086743
675 Ga0207680_10133169
676 Ga0207647_10048364
677 Ga0207647_10176037
678 Ga0207699_10103983
679 Ga0207645_10025792
680 Ga0207654_10000420
681 Ga0207654_10002275
682 Ga0207654_10007191
683 Ga0207654_10014135
684 Ga0207654_10019594
685 Ga0207654_10246917
686 Ga0207707_10075532
687 Ga0207695_10000002
688 Ga0207695_10000154
689 Ga0207695_10000911
690 Ga0207695_10004455
691 Ga0207695_10007921
692 Ga0207695_10020314
693 Ga0207695_10043816
694 Ga0207695_10289947
695 Ga0207695_10401499
696 Ga0207671_10000178
697 Ga0207671_10013036
698 Ga0207671_10063828
699 Ga0207671_10087515
700 Ga0207671_10142055
701 Ga0207693_10206622
702 Ga0207657_10002904
703 Ga0207649_10001210
704 Ga0207649_10026458
705 Ga0207652_10007395
706 Ga0207652_10073513
707 Ga0207652_10085915
708 Ga0207652_10128341
709 Ga0207646_10329631
710 Ga0207681_10000571
711 Ga0207694_10000116
712 Ga0207694_10000666
713 Ga0207694_10020026
714 Ga0207694_10020549
715 Ga0207694_10035634
716 Ga0207694_10043395
717 Ga0207694_10177893
718 Ga0207694_10190218
719 Ga0207687_10025276
720 Ga0207687_10026734
721 Ga0207687_10120648
722 Ga0207687_10404169
723 Ga0207644_10154179
724 Ga0207706_10000422
725 Ga0207706_10025761
726 Ga0207706_10107898
727 Ga0207686_10113675
728 Ga0207709_10017525
729 Ga0207691_10045838
730 Ga0207691_10106093
731 Ga0207711_10035862
732 Ga0207711_10067212
733 Ga0207711_10228900
734 Ga0207689_10000828
735 Ga0207689_10025184
736 Ga0207689_10025360
737 Ga0207661_10059537
738 Ga0207661_10085444
739 Ga0207679_10022231
740 Ga0207679_10030245
741 Ga0207679_10084708
742 Ga0207667_10001892
743 Ga0207667_10019336
744 Ga0207667_10020840
745 Ga0207667_10034679
746 Ga0207667_10261096
747 Ga0207667_10292059
748 Ga0207651_10014308
749 Ga0207712_10030997
750 Ga0207668_10029543
751 Ga0207640_10005753
752 Ga0207640_10014132
753 Ga0207640_10181831
754 Ga0207658_10137485
755 Ga0207658_10174244
756 Ga0207677_10004322
757 Ga0207677_10004935
758 Ga0207677_10016441
759 Ga0207677_10021064
760 Ga0207677_10080859
761 Ga0207703_10009984
762 Ga0207703_10026410
763 Ga0207703_10052537
764 Ga0207639_10002961
765 Ga0207639_10003068
766 Ga0207639_10020864
767 Ga0207639_10264562
768 Ga0207678_10001295
769 Ga0207678_10016957
770 Ga0207708_10002797
771 Ga0207702_10010247
772 Ga0207702_10020176
773 Ga0207702_10026169
774 Ga0207702_10031738
775 Ga0207702_10063133
776 Ga0207702_10395897
777 Ga0207641_10005245
778 Ga0207641_10013260
779 Ga0207641_10056445
780 Ga0207641_10111995
781 Ga0207641_10194966
782 Ga0207648_10005925
783 Ga0207648_10012699
784 Ga0207648_10216242
785 Ga0207676_10016423
786 Ga0207676_10075723
787 Ga0207676_10372016
788 Ga0207674_10000505
789 Ga0207674_10003555
790 Ga0207674_10003635
791 Ga0207674_10047394
792 Ga0207674_10070236
793 Ga0207674_10232434
794 Ga0207674_10262890
795 Ga0207675_100082887
796 Ga0207675_100110208
797 Ga0207675_100137546
798 Ga0207683_10005853
799 Ga0207683_10120691
800 Ga0207698_10000777
801 Ga0207698_10068821
802 Ga0207698_10085396
803 Ga0207698_10382287
804 Ga0207428_10057914
805 Ga0268266_10026635
806 Ga0268266_10048804
807 Ga0268265_10044410
808 Ga0268265_10049713
809 Ga0268264_10042828
810 Ga0268264_10065689
811 Ga0265334_10006365
812 Ga0265318_10000233
813 Ga0265338_10149199
814 Ga0265320_10026665
815 Ga0265320_10048854
816 Ga0265325_10020593
817 Ga0265325_10030228
818 Ga0265331_10013771
819 Ga0307513_10236017
820 Ga0265313_10002318
821 Ga0265313_10016952
822 Ga0265314_10017391
823 Ga0373936_0012150
824 Ga0373954_0100739
825 Ga0373943_0024519
826 Ga0373946_0049426
827 Ga0373955_0211505
828 Ga0373961_0031495
829 Ga0373931_0044538
830 Ga0373935_0027572
831 Ga0373933_0179893
832 Ga0373947_0020904
833 Ga0373947_0170303
834 Ga0373937_0034485
835 Ga0373925_0010634
836 Ga0395905_0205296
837 Ga0436365_1497713
838 Ga0451797_1343841
839 Ga0466960_0173831
840 Ga0466967_0256425
841 Ga0495592_0378410
842 Ga0495603_0063833
843 Ga0495603_0116607
844 Ga0495629_0023770
845 Ga0495629_0091313
846 Ga0495651_0161874
847 Ga0495653_0154202
848 Ga0495580_0017481
849 Ga0495582_0009293
850 Ga0495662_0094055
851 Ga0495662_0210088
852 Ga0495618_0111080
853 Ga0495630_0051367
854 Ga0495630_0056029
855 Ga0495630_0275650
856 Ga0495630_0347872
857 Ga0495665_0015177
858 Ga0495640_0267716
859 Ga0495586_0149788
860 Ga0495587_0092586
861 Ga0495587_0214510
862 Ga0495645_0103881
863 Ga0495667_0133130
864 Ga0495634_0045684
865 Ga0495635_0065826
866 Ga0495647_0183197
867 Ga0495658_0076795
868 Ga0495613_0113367
869 Ga0495624_0028610
870 Ga0495624_0047435
871 Ga0495600_0167876
872 Ga0495581_0028435
873 Ga0495674_0048269
874 Ga0495674_0054267
875 Ga0495676_0168127
876 Ga0495676_0288135
877 Ga0495680_0019952
878 Ga0495684_0077238
879 Ga0495593_0116140
880 Ga0495602_0216983
881 Ga0496100_0059260
882 Ga0496101_0045851
883 Ga0496101_0118556
884 Ga0496102_0181828
885 Ga0496105_0109889
886 Ga0496107_0015617
887 Ga0496108_0264332
888 Ga0496108_0319878
889 Ga0496112_0080451
890 Ga0496114_0000157
891 Ga0496115_0069371
892 Ga0496115_0080636
893 Ga0501036_0193118
894 Ga0501047_0248186
895 Ga0501048_0053764
896 Ga0501072_0187712
897 Ga0501073_0003025
898 Ga0501075_0313024
899 Ga0501081_0101783
900 nmdc:mga00v17_141990_c1
901 nmdc:mga04h51_40049_c1
902 nmdc:mga05p37_18069_c1
903 nmdc:mga05p37_399535_c1
904 nmdc:mga08y16_93078_c1
905 nmdc:mga0n895_24900_c1
906 nmdc:mga0rr50_176229_c1
907 nmdc:mga0a205_37222_c1
908 Ga0495601_0007356
909 Ga0495601_0007901
910 Ga0495601_0181984
911 Ga0495595_0059644
912 Ga0495619_0031919
913 Ga0501082_0016818
914 Ga0501082_0048173
915 2511243079
916 2643969737
917 2644141322
918 2644274371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

7

157

0.83

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

8

151

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8251 3 314
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8184 3 314
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8152 2 172
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8136 2 312
4id9-assembly1.cif.gz_B crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound nad, monoclinic form 1 0.8113 4 313
ID Description Score Start End Superfamily
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8596 2 98 3.40.50.20
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8488 2 98 3.40.50.720
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.847 2 100 3.40.50.20
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8332 2 252 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8308 5 302 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A843RLZ8-F1-model_v4 NAD(P)H-binding protein 0.9927 4 69
AF-A0A4Q3NHM6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9756 2 328
AF-A0A2E4DSE3-F1-model_v4 UDP-glucose 4-epimerase 0.9733 4 328
AF-A0A7W6XKQ3-F1-model_v4 deleted 0.9724 1 328
AF-A0A1L3LXI2-F1-model_v4 UDP-glucose 4-epimerase protein (EC 5.1.3.2) 0.9713 4 328 GO:0003978

Map