F448250

General Info

Members Datasets Scaffolds Average Seq Length
458 190 917 307

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0020434|Ga0466967_0020434_2740_3765
Length 341
Sequence MARKVVKNLLVALTICYIAGTVVGGAGLGWMATHPGRLPITDGERREVLAQSGAGAELDDISIFAADGVLLRAWRIRPQYPNGNAVILLHGVGDNRLGVSGYGAWLVRNHYTVILPDARAHGESGGEIATYGLKESDDIHRWVDWIETKDQPRCIFGFGESMGAAQILESLSNEGRFCAVIAESPFASFRQVAYARFGRPFQTGPWLGKTFFWPTVEAGFLFVRWRFGLSMDDASPEDAVRKTHVPVLLIHGLSDRNIPPFHSFEIQSQNPSRVTLWPVPGAVHCGAHAVAPEEFERRVLNWYAQHGLGGGNSQPQETTVSEAARNHGKTEHRVPSREWRP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.15
Rhizosphere 95.41
Stem 0
Stem Tuber 0
Unclassified 14.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0020434 3300045976 Bacteria 5353
2 MBSR1b_contig_10687149 2162886012 Bacteria 1246
3 MBSR1b_contig_3075083 2162886012 Bacteria 1242
4 JGI24752J21851_1006737 3300001976 Bacteria 1502
5 rootH1_10072367 3300003316 Bacteria 7950
6 rootH1_10072367 3300003323 Unclassified 2315
7 Ga0065712_10110185 3300005290 Bacteria 1841
8 Ga0065715_10100445 3300005293 Bacteria 3282
9 Ga0070676_10187489 3300005328 Bacteria 1348
10 Ga0070683_100004307 3300005329 Bacteria 11694
11 Ga0070683_100009684 3300005329 Bacteria 8247
12 Ga0070683_100036129 3300005329 Bacteria 4519
13 Ga0070683_100076595 3300005329 Unclassified 3127
14 Ga0070683_100251286 3300005329 Bacteria 1682
15 Ga0070690_100057445 3300005330 Bacteria 2497
16 Ga0070670_100007497 3300005331 Bacteria 9265
17 Ga0070670_100026211 3300005331 Bacteria 5018
18 Ga0070670_100041851 3300005331 Bacteria 3937
19 Ga0068869_100022308 3300005334 Bacteria 4361
20 Ga0068869_100048921 3300005334 Bacteria 3059
21 Ga0068869_100062619 3300005334 Bacteria 2731
22 Ga0070666_10079788 3300005335 Bacteria 2235
23 Ga0070666_10227544 3300005335 Unclassified 1316
24 Ga0070680_100012656 3300005336 Bacteria 6558
25 Ga0070680_100078238 3300005336 Bacteria 2724
26 Ga0070680_100121078 3300005336 Bacteria 2185
27 Ga0070682_100006308 3300005337 Bacteria 6654
28 Ga0068868_100006130 3300005338 Bacteria 8496
29 Ga0068868_100011241 3300005338 Bacteria 6519
30 Ga0068868_100012374 3300005338 Bacteria 6235
31 Ga0068868_100023859 3300005338 Unclassified 4634
32 Ga0068868_100052668 3300005338 Bacteria 3204
33 Ga0070660_100025956 3300005339 Bacteria 4359
34 Ga0070689_100006955 3300005340 Bacteria 7882
35 Ga0070689_100059374 3300005340 Bacteria 2973
36 Ga0070661_100012471 3300005344 Bacteria 5945
37 Ga0070661_100041300 3300005344 Bacteria 3366
38 Ga0070661_100044100 3300005344 Bacteria 3258
39 Ga0070668_100172756 3300005347 Unclassified 1760
40 Ga0070669_100040776 3300005353 Bacteria 3375
41 Ga0070675_100149865 3300005354 Bacteria 1999
42 Ga0070675_100320355 3300005354 Bacteria 1369
43 Ga0070671_100049424 3300005355 Bacteria 3499
44 Ga0070674_100021966 3300005356 Bacteria 4109
45 Ga0070673_100034755 3300005364 Bacteria 3817
46 Ga0070673_100172782 3300005364 Bacteria 1845
47 Ga0070673_100306633 3300005364 Bacteria 1399
48 Ga0070688_100010733 3300005365 Bacteria 5062
49 Ga0070688_100022461 3300005365 Bacteria 3698
50 Ga0070659_100004378 3300005366 Bacteria 10084
51 Ga0070659_100161572 3300005366 Bacteria 1832
52 Ga0070659_100237321 3300005366 Unclassified 1508
53 Ga0070667_100321921 3300005367 Bacteria 1395
54 Ga0070667_100374468 3300005367 Bacteria 1292
55 Ga0070709_10001348 3300005434 Bacteria 13386
56 Ga0070709_10031423 3300005434 Bacteria 3193
57 Ga0070714_100240426 3300005435 Bacteria 1671
58 Ga0070713_100029297 3300005436 Bacteria 4358
59 Ga0070713_100057955 3300005436 Bacteria 3228
60 Ga0070713_100060784 3300005436 Unclassified 3159
61 Ga0070713_100281461 3300005436 Bacteria 1526
62 Ga0070710_10020947 3300005437 Bacteria 3400
63 Ga0070711_100103082 3300005439 Bacteria 2079
64 Ga0070700_100220723 3300005441 Bacteria 1343
65 Ga0070708_100030903 3300005445 Bacteria 4633
66 Ga0070708_100096027 3300005445 Bacteria 2707
67 Ga0070708_100097593 3300005445 Bacteria 2686
68 Ga0070663_100037445 3300005455 Bacteria 3377
69 Ga0070663_100347827 3300005455 Bacteria 1199
70 Ga0070678_100049234 3300005456 Bacteria 3040
71 Ga0070678_100099999 3300005456 Bacteria 2245
72 Ga0070678_100332117 3300005456 Bacteria 1301
73 Ga0070662_100269475 3300005457 Unclassified 1374
74 Ga0070662_100316595 3300005457 Bacteria 1271
75 Ga0070681_10000514 3300005458 Bacteria 31694
76 Ga0070681_10001119 3300005458 Bacteria 22976
77 Ga0070681_10163981 3300005458 Bacteria 2146
78 Ga0068867_100025222 3300005459 Unclassified 4265
79 Ga0068867_100041140 3300005459 Unclassified 3377
80 Ga0068867_100171784 3300005459 Unclassified 1717
81 Ga0068867_100324557 3300005459 Bacteria 1276
82 Ga0070685_10004909 3300005466 Bacteria 6765
83 Ga0070685_10005825 3300005466 Bacteria 6266
84 Ga0070706_100319459 3300005467 Bacteria 1448
85 Ga0070679_100013394 3300005530 Bacteria 7853
86 Ga0070679_100014600 3300005530 Bacteria 7547
87 Ga0070679_100014764 3300005530 Bacteria 7505
88 Ga0070684_100007282 3300005535 Bacteria 8601
89 Ga0070684_100007471 3300005535 Bacteria 8499
90 Ga0070684_100015390 3300005535 Bacteria 6230
91 Ga0070684_100090420 3300005535 Bacteria 2722
92 Ga0070684_100180740 3300005535 Bacteria 1918
93 Ga0068853_100131027 3300005539 Bacteria 2244
94 Ga0068853_100292880 3300005539 Bacteria 1503
95 Ga0068853_100410705 3300005539 Unclassified 1268
96 Ga0070672_100014434 3300005543 Bacteria 5598
97 Ga0070672_100081644 3300005543 Bacteria 2592
98 Ga0070686_100004505 3300005544 Bacteria 7680
99 Ga0070686_100025348 3300005544 Bacteria 3568
100 Ga0070693_100044850 3300005547 Bacteria 2503
101 Ga0068855_100010203 3300005563 Bacteria 11323
102 Ga0068855_100010902 3300005563 Bacteria 10972
103 Ga0068855_100013792 3300005563 Bacteria 9743
104 Ga0068855_100177271 3300005563 Bacteria 2411
105 Ga0068855_100411448 3300005563 Bacteria 1480
106 Ga0070664_100005376 3300005564 Bacteria 10283
107 Ga0070664_100013863 3300005564 Bacteria 6571
108 Ga0070664_100032531 3300005564 Bacteria 4364
109 Ga0070664_100433139 3300005564 Unclassified 1205
110 Ga0068857_100001081 3300005577 Bacteria 21107
111 Ga0068857_100004136 3300005577 Bacteria 12228
112 Ga0068857_100024356 3300005577 Bacteria 5327
113 Ga0068857_100293377 3300005577 Bacteria 1498
114 Ga0068854_100015913 3300005578 Bacteria 4998
115 Ga0068854_100031231 3300005578 Unclassified 3700
116 Ga0068854_100192879 3300005578 Bacteria 1597
117 Ga0068854_100251093 3300005578 Unclassified 1412
118 Ga0068856_100002225 3300005614 Bacteria 20054
119 Ga0068856_100040101 3300005614 Bacteria 4598
120 Ga0068856_100059958 3300005614 Bacteria 3759
121 Ga0068856_100230485 3300005614 Bacteria 1867
122 Ga0070702_100100168 3300005615 Bacteria 1776
123 Ga0068852_100009232 3300005616 Bacteria 7307
124 Ga0068852_100144100 3300005616 Bacteria 2208
125 Ga0068852_100526894 3300005616 Bacteria 1179
126 Ga0068859_100007323 3300005617 Bacteria 11192
127 Ga0068859_100012539 3300005617 Bacteria 8528
128 Ga0068859_100060496 3300005617 Bacteria 3816
129 Ga0068859_100083417 3300005617 Bacteria 3239
130 Ga0068859_100366716 3300005617 Unclassified 1535
131 Ga0068864_100003304 3300005618 Bacteria 13322
132 Ga0068864_100009671 3300005618 Bacteria 7954
133 Ga0068864_100016028 3300005618 Bacteria 6235
134 Ga0068864_100027086 3300005618 Bacteria 4837
135 Ga0068866_10007790 3300005718 Bacteria 4494
136 Ga0068866_10235453 3300005718 Bacteria 1112
137 Ga0068861_100022036 3300005719 Bacteria 4585
138 Ga0068861_100203303 3300005719 Bacteria 1664
139 Ga0068861_100460406 3300005719 Bacteria 1142
140 Ga0068851_10009593 3300005834 Bacteria 4507
141 Ga0068870_10002102 3300005840 Bacteria 8254
142 Ga0068870_10027377 3300005840 Bacteria 2850
143 Ga0068863_100011528 3300005841 Bacteria 8550
144 Ga0068863_100017251 3300005841 Bacteria 6924
145 Ga0068863_100046320 3300005841 Bacteria 4127
146 Ga0068863_100138469 3300005841 Bacteria 2326
147 Ga0068858_100000375 3300005842 Bacteria 46749
148 Ga0068858_100017640 3300005842 Bacteria 6691
149 Ga0068858_100026042 3300005842 Bacteria 5439
150 Ga0068858_100093491 3300005842 Bacteria 2799
151 Ga0068858_100169631 3300005842 Bacteria 2057
152 Ga0068860_100016008 3300005843 Bacteria 7316
153 Ga0068860_100023944 3300005843 Bacteria 5901
154 Ga0068862_100013979 3300005844 Bacteria 6656
155 Ga0068862_100058745 3300005844 Bacteria 3300
156 Ga0070717_10010079 3300006028 Bacteria 7115
157 Ga0070717_10223325 3300006028 Unclassified 1656
158 Ga0070717_10421422 3300006028 Bacteria 1201
159 Ga0097621_100000506 3300006237 Bacteria 27267
160 Ga0097621_100008272 3300006237 Bacteria 7486
161 Ga0097621_100022406 3300006237 Unclassified 4903
162 Ga0097621_100035049 3300006237 Bacteria 4008
163 Ga0097621_100102612 3300006237 Bacteria 2408
164 Ga0068871_100000535 3300006358 Bacteria 25899
165 Ga0068871_100000685 3300006358 Bacteria 23033
166 Ga0068871_100033008 3300006358 Bacteria 4094
167 Ga0068871_100220896 3300006358 Unclassified 1642
168 Ga0068871_100397869 3300006358 Bacteria 1226
169 Ga0068871_100475292 3300006358 Unclassified 1123
170 Ga0075434_100205194 3300006871 Bacteria 1991
171 Ga0068865_100008364 3300006881 Bacteria 6396
172 Ga0068865_100018956 3300006881 Bacteria 4447
173 Ga0068865_100086148 3300006881 Bacteria 2267
174 Ga0075436_100254188 3300006914 Unclassified 1252
175 Ga0097620_100007323 3300006931 Bacteria 11192
176 Ga0097620_100012539 3300006931 Bacteria 8528
177 Ga0097620_100060505 3300006931 Bacteria 3816
178 Ga0097620_100083412 3300006931 Bacteria 3239
179 Ga0097620_100366729 3300006931 Unclassified 1535
180 Ga0075435_100030073 3300007076 Bacteria 4268
181 Ga0105240_10020222 3300009093 Bacteria 8886
182 Ga0105240_10058494 3300009093 Bacteria 4812
183 Ga0105240_10075789 3300009093 Unclassified 4148
184 Ga0105240_10082607 3300009093 Bacteria 3945
185 Ga0105240_10164796 3300009093 Bacteria 2629
186 Ga0105240_10518996 3300009093 Unclassified 1322
187 Ga0105245_10001231 3300009098 Bacteria 23089
188 Ga0105245_10014727 3300009098 Bacteria 6811
189 Ga0105245_10031070 3300009098 Bacteria 4724
190 Ga0105247_10027192 3300009101 Unclassified 3460
191 Ga0105241_10038644 3300009174 Bacteria 3598
192 Ga0105241_10132768 3300009174 Unclassified 2018
193 Ga0105242_10579066 3300009176 Bacteria 1081
194 Ga0105248_10084023 3300009177 Bacteria 3581
195 Ga0105248_10124740 3300009177 Bacteria 2905
196 Ga0105248_10147892 3300009177 Unclassified 2651
197 Ga0105237_10012422 3300009545 Bacteria 8976
198 Ga0105237_10123183 3300009545 Unclassified 2587
199 Ga0105237_10220510 3300009545 Bacteria 1897
200 Ga0105237_10308887 3300009545 Bacteria 1584
201 Ga0105237_10363025 3300009545 Bacteria 1453
202 Ga0105238_10001026 3300009551 Bacteria 28422
203 Ga0105238_10099965 3300009551 Bacteria 2884
204 Ga0105238_10113815 3300009551 Bacteria 2685
205 Ga0105238_10183465 3300009551 Bacteria 2069
206 Ga0105238_10342227 3300009551 Unclassified 1484
207 Ga0105249_10173130 3300009553 Bacteria 2095
208 Ga0105249_10354213 3300009553 Bacteria 1488
209 Ga0105239_10035483 3300010375 Bacteria 5477
210 Ga0105239_10039496 3300010375 Bacteria 5171
211 Ga0105239_10044867 3300010375 Unclassified 4845
212 Ga0105239_10153298 3300010375 Bacteria 2572
213 Ga0105239_10199168 3300010375 Bacteria 2243
214 Ga0105246_10000186 3300011119 Bacteria 30726
215 Ga0105246_10165165 3300011119 Unclassified 1690
216 Ga0157373_10005638 3300013100 Bacteria 9380
217 Ga0157373_10006490 3300013100 Bacteria 8730
218 Ga0157373_10010939 3300013100 Bacteria 6680
219 Ga0157373_10140138 3300013100 Unclassified 1700
220 Ga0157371_10006790 3300013102 Bacteria 9356
221 Ga0157371_10030660 3300013102 Bacteria 3878
222 Ga0157371_10038498 3300013102 Bacteria 3421
223 Ga0157371_10056664 3300013102 Bacteria 2780
224 Ga0157370_10055766 3300013104 Bacteria 3762
225 Ga0157370_10064511 3300013104 Unclassified 3468
226 Ga0157369_10000353 3300013105 Bacteria 61209
227 Ga0157369_10008810 3300013105 Bacteria 11560
228 Ga0157369_10021106 3300013105 Bacteria 7281
229 Ga0157369_10189979 3300013105 Unclassified 2158
230 Ga0157369_10208166 3300013105 Bacteria 2051
231 Ga0157374_10000232 3300013296 Bacteria 51675
232 Ga0157374_10001168 3300013296 Bacteria 22398
233 Ga0157374_10003773 3300013296 Bacteria 12742
234 Ga0157374_10003942 3300013296 Bacteria 12472
235 Ga0157374_10112442 3300013296 Bacteria 2620
236 Ga0157374_10353506 3300013296 Unclassified 1460
237 Ga0157378_10000493 3300013297 Bacteria 37407
238 Ga0157378_10000951 3300013297 Bacteria 26593
239 Ga0157378_10001878 3300013297 Bacteria 18866
240 Ga0157378_10003997 3300013297 Bacteria 13024
241 Ga0157378_10011110 3300013297 Bacteria 7880
242 Ga0157378_10126648 3300013297 Bacteria 2360
243 Ga0163162_10004214 3300013306 Bacteria 13823
244 Ga0163162_10090123 3300013306 Unclassified 3148
245 Ga0163162_10379775 3300013306 Bacteria 1546
246 Ga0163162_10666802 3300013306 Bacteria 1163
247 Ga0157372_10000565 3300013307 Bacteria 40736
248 Ga0157372_10001006 3300013307 Bacteria 30802
249 Ga0157372_10001010 3300013307 Bacteria 30756
250 Ga0157372_10004155 3300013307 Bacteria 15493
251 Ga0157372_10007667 3300013307 Bacteria 11479
252 Ga0157372_10010811 3300013307 Bacteria 9717
253 Ga0157372_10011500 3300013307 Bacteria 9413
254 Ga0157372_10123904 3300013307 Bacteria 2971
255 Ga0157372_10126251 3300013307 Bacteria 2941
256 Ga0157372_10168249 3300013307 Unclassified 2535
257 Ga0157372_10178013 3300013307 Bacteria 2462
258 Ga0157372_10184366 3300013307 Unclassified 2417
259 Ga0157372_10214798 3300013307 Bacteria 2229
260 Ga0157372_10546114 3300013307 Bacteria 1351
261 Ga0157372_10593466 3300013307 Bacteria 1291
262 Ga0157375_10041769 3300013308 Bacteria 4431
263 Ga0157375_10056847 3300013308 Bacteria 3865
264 Ga0163163_10003050 3300014325 Bacteria 14171
265 Ga0163163_10008547 3300014325 Bacteria 9101
266 Ga0163163_10173554 3300014325 Bacteria 2202
267 Ga0163163_10180558 3300014325 Unclassified 2158
268 Ga0182008_10006833 3300014497 Bacteria 6347
269 Ga0157377_10000320 3300014745 Bacteria 21845
270 Ga0157377_10002255 3300014745 Bacteria 8477
271 Ga0157377_10086236 3300014745 Bacteria 1845
272 Ga0157379_10004703 3300014968 Bacteria 11722
273 Ga0157379_10017036 3300014968 Bacteria 6397
274 Ga0157379_10023022 3300014968 Bacteria 5522
275 Ga0157379_10028806 3300014968 Bacteria 4939
276 Ga0157379_10113616 3300014968 Bacteria 2434
277 Ga0157379_10291279 3300014968 Bacteria 1487
278 Ga0157376_10000907 3300014969 Bacteria 19274
279 Ga0157376_10006887 3300014969 Bacteria 8049
280 Ga0157376_10010395 3300014969 Bacteria 6805
281 Ga0163161_10003989 3300017792 Bacteria 10343
282 Ga0163161_10408283 3300017792 Bacteria 1090
283 Ga0207697_10016919 3300025315 Bacteria 3000
284 Ga0207692_10026222 3300025898 Unclassified 2732
285 Ga0207642_10003085 3300025899 Bacteria 5222
286 Ga0207642_10177617 3300025899 Unclassified 1157
287 Ga0207710_10012959 3300025900 Bacteria 3512
288 Ga0207680_10097240 3300025903 Bacteria 1885
289 Ga0207647_10038484 3300025904 Bacteria 3023
290 Ga0207647_10053893 3300025904 Bacteria 2476
291 Ga0207699_10345664 3300025906 Unclassified 1049
292 Ga0207645_10000104 3300025907 Bacteria 62309
293 Ga0207645_10005885 3300025907 Bacteria 8834
294 Ga0207643_10000328 3300025908 Bacteria 32545
295 Ga0207643_10000528 3300025908 Bacteria 24521
296 Ga0207684_10268936 3300025910 Bacteria 1471
297 Ga0207654_10019982 3300025911 Bacteria 3543
298 Ga0207654_10065115 3300025911 Bacteria 2145
299 Ga0207707_10002352 3300025912 Bacteria 17035
300 Ga0207707_10094424 3300025912 Unclassified 2613
301 Ga0207707_10281341 3300025912 Unclassified 1441
302 Ga0207707_10361839 3300025912 Bacteria 1249
303 Ga0207695_10016411 3300025913 Bacteria 8664
304 Ga0207695_10071280 3300025913 Unclassified 3549
305 Ga0207695_10211139 3300025913 Unclassified 1852
306 Ga0207693_10000272 3300025915 Bacteria 47757
307 Ga0207662_10184351 3300025918 Unclassified 1344
308 Ga0207657_10000321 3300025919 Bacteria 51030
309 Ga0207649_10000149 3300025920 Bacteria 57837
310 Ga0207649_10000612 3300025920 Bacteria 24135
311 Ga0207649_10163106 3300025920 Bacteria 1546
312 Ga0207652_10010885 3300025921 Bacteria 7331
313 Ga0207652_10055022 3300025921 Bacteria 3421
314 Ga0207652_10213538 3300025921 Bacteria 1738
315 Ga0207652_10452243 3300025921 Unclassified 1158
316 Ga0207694_10001534 3300025924 Bacteria 19645
317 Ga0207694_10194905 3300025924 Bacteria 1647
318 Ga0207650_10000152 3300025925 Bacteria 83134
319 Ga0207650_10000170 3300025925 Bacteria 77357
320 Ga0207659_10065730 3300025926 Bacteria 2629
321 Ga0207687_10189902 3300025927 Unclassified 1598
322 Ga0207700_10045975 3300025928 Bacteria 3225
323 Ga0207700_10049926 3300025928 Bacteria 3114
324 Ga0207700_10321862 3300025928 Bacteria 1340
325 Ga0207664_10006288 3300025929 Bacteria 8162
326 Ga0207664_10197898 3300025929 Bacteria 1733
327 Ga0207664_10432287 3300025929 Unclassified 1174
328 Ga0207644_10021594 3300025931 Unclassified 4389
329 Ga0207644_10027585 3300025931 Bacteria 3924
330 Ga0207690_10021863 3300025932 Bacteria 3973
331 Ga0207690_10079648 3300025932 Bacteria 2283
332 Ga0207706_10372960 3300025933 Bacteria 1239
333 Ga0207670_10034248 3300025936 Bacteria 3280
334 Ga0207669_10187700 3300025937 Bacteria 1488
335 Ga0207704_10010269 3300025938 Bacteria 4558
336 Ga0207704_10030739 3300025938 Bacteria 3015
337 Ga0207704_10057003 3300025938 Bacteria 2397
338 Ga0207665_10027799 3300025939 Bacteria 3736
339 Ga0207665_10130937 3300025939 Bacteria 1781
340 Ga0207691_10000308 3300025940 Bacteria 48637
341 Ga0207691_10000417 3300025940 Bacteria 42618
342 Ga0207711_10062381 3300025941 Bacteria 3215
343 Ga0207711_10297086 3300025941 Unclassified 1489
344 Ga0207711_10399902 3300025941 Bacteria 1276
345 Ga0207689_10001387 3300025942 Bacteria 23193
346 Ga0207689_10001737 3300025942 Bacteria 20583
347 Ga0207689_10076672 3300025942 Bacteria 2748
348 Ga0207689_10426122 3300025942 Bacteria 1107
349 Ga0207661_10001053 3300025944 Bacteria 18328
350 Ga0207661_10011576 3300025944 Bacteria 6399
351 Ga0207661_10057094 3300025944 Unclassified 3137
352 Ga0207661_10347998 3300025944 Bacteria 1336
353 Ga0207679_10000080 3300025945 Bacteria 84997
354 Ga0207679_10000298 3300025945 Bacteria 37205
355 Ga0207667_10009724 3300025949 Bacteria 11306
356 Ga0207667_10017879 3300025949 Bacteria 7968
357 Ga0207667_10035191 3300025949 Bacteria 5373
358 Ga0207667_10056445 3300025949 Bacteria 4125
359 Ga0207651_10013134 3300025960 Bacteria 4724
360 Ga0207651_10117712 3300025960 Bacteria 2008
361 Ga0207712_10014990 3300025961 Unclassified 4995
362 Ga0207640_10030711 3300025981 Bacteria 3312
363 Ga0207640_10106956 3300025981 Bacteria 1974
364 Ga0207640_10443230 3300025981 Bacteria 1068
365 Ga0207658_10047384 3300025986 Bacteria 3145
366 Ga0207658_10206465 3300025986 Bacteria 1643
367 Ga0207677_10005229 3300026023 Bacteria 7024
368 Ga0207677_10139407 3300026023 Unclassified 1854
369 Ga0207703_10023050 3300026035 Bacteria 4888
370 Ga0207703_10023498 3300026035 Bacteria 4843
371 Ga0207703_10040728 3300026035 Bacteria 3719
372 Ga0207703_10053704 3300026035 Bacteria 3275
373 Ga0207703_10070237 3300026035 Bacteria 2890
374 Ga0207639_10303554 3300026041 Bacteria 1412
375 Ga0207639_10499346 3300026041 Bacteria 1111
376 Ga0207678_10000912 3300026067 Bacteria 27031
377 Ga0207678_10001414 3300026067 Bacteria 22033
378 Ga0207702_10000408 3300026078 Bacteria 49067
379 Ga0207702_10002163 3300026078 Bacteria 18863
380 Ga0207702_10008604 3300026078 Bacteria 8605
381 Ga0207702_10029909 3300026078 Bacteria 4535
382 Ga0207641_10000052 3300026088 Bacteria 173672
383 Ga0207641_10001162 3300026088 Bacteria 26474
384 Ga0207641_10012293 3300026088 Bacteria 7023
385 Ga0207641_10012922 3300026088 Bacteria 6851
386 Ga0207641_10247574 3300026088 Bacteria 1663
387 Ga0207648_10001643 3300026089 Bacteria 24510
388 Ga0207648_10005790 3300026089 Bacteria 12381
389 Ga0207648_10297252 3300026089 Unclassified 1447
390 Ga0207648_10403324 3300026089 Bacteria 1239
391 Ga0207676_10000176 3300026095 Bacteria 56110
392 Ga0207676_10000478 3300026095 Bacteria 33685
393 Ga0207676_10005564 3300026095 Bacteria 8911
394 Ga0207674_10000561 3300026116 Bacteria 48618
395 Ga0207674_10001476 3300026116 Bacteria 30398
396 Ga0207674_10333967 3300026116 Bacteria 1465
397 Ga0207674_10386660 3300026116 Bacteria 1353
398 Ga0207675_100017609 3300026118 Bacteria 6664
399 Ga0207675_100117921 3300026118 Bacteria 2509
400 Ga0207683_10001699 3300026121 Bacteria 19684
401 Ga0207683_10250993 3300026121 Bacteria 1615
402 Ga0207698_10056363 3300026142 Bacteria 3034
403 Ga0207698_10398470 3300026142 Bacteria 1315
404 Ga0268266_10015485 3300028379 Bacteria 6543
405 Ga0268266_10052904 3300028379 Bacteria 3487
406 Ga0268265_10006702 3300028380 Bacteria 7796
407 Ga0268265_10008845 3300028380 Bacteria 6805
408 Ga0268264_10115391 3300028381 Bacteria 2359
409 Ga0268264_10374708 3300028381 Bacteria 1361
410 Ga0265760_10005356 3300031090 Bacteria 3682
411 Ga0265332_10033843 3300031238 Unclassified 2223
412 Ga0307408_100040777 3300031548 Bacteria 3289
413 Ga0265314_10110140 3300031711 Bacteria 1751
414 Ga0265342_10056919 3300031712 Unclassified 2316
415 Ga0307405_10029679 3300031731 Bacteria 3199
416 Ga0307410_10019909 3300031852 Bacteria 4093
417 Ga0307409_100148833 3300031995 Bacteria 2029
418 Ga0307416_100035711 3300032002 Bacteria 3801
419 Ga0307416_100191903 3300032002 Bacteria 1928
420 Ga0373923_0074333 3300035111 Bacteria 1465
421 Ga0373931_0070701 3300035691 Unclassified 1905
422 Ga0373927_0030792 3300035695 Bacteria 3500
423 Ga0373925_0138612 3300037068 Bacteria 1903
424 Ga0395898_0128074 3300037466 Unclassified 2432
425 Ga0395901_0664529 3300038443 Unclassified 1044
426 Ga0436362_0028250 3300039453 Bacteria 2865
427 Ga0466961_0115722 3300044693 Bacteria 1685
428 Ga0466963_0022006 3300044694 Bacteria 4031
429 Ga0466963_0025421 3300044694 Bacteria 3776
430 Ga0451576_0549503 3300045051 Bacteria 1213
431 Ga0466967_0000391 3300045976 Bacteria 20499
432 Ga0466967_0003625 3300045976 Bacteria 10144
433 Ga0495580_0179255 3300046472 Unclassified 1463
434 Ga0495630_0503755 3300046517 Unclassified 928
435 Ga0495645_0134685 3300046543 Unclassified 1729
436 Ga0495670_0121690 3300046691 Bacteria 1356
437 Ga0496100_0119868 3300048903 Bacteria 1839
438 Ga0496102_0017453 3300048905 Bacteria 6288
439 Ga0496102_0428428 3300048905 Bacteria 1242
440 Ga0496108_0000242 3300048911 Bacteria 48793
441 Ga0496108_0000335 3300048911 Bacteria 39863
442 Ga0496109_0000120 3300048912 Bacteria 81828
443 Ga0496109_0000184 3300048912 Bacteria 62326
444 Ga0496110_0001177 3300048913 Bacteria 18607
445 Ga0496110_0003869 3300048913 Bacteria 11531
446 Ga0496111_0002331 3300048914 Bacteria 11438
447 Ga0496112_0000034 3300048915 Bacteria 107237
448 Ga0496112_0000198 3300048915 Bacteria 39413
449 Ga0496112_0011281 3300048915 Bacteria 8151
450 Ga0496112_0060399 3300048915 Bacteria 3736
451 Ga0496112_0241685 3300048915 Bacteria 1758
452 Ga0496112_0449436 3300048915 Unclassified 1226
453 Ga0496113_0000789 3300048916 Bacteria 16423
454 Ga0496113_0260058 3300048916 Bacteria 1387
455 Ga0496115_0038909 3300048918 Bacteria 3777
456 nmdc:mga0n895_193518_c1 3300050512 Bacteria 2065
457 nmdc:mga0rr50_12138_c1 3300050513 Bacteria 5553
458 nmdc:mga08x19_230214_c1 3300050514 Unclassified 1275
459 Ga0500590_138220 3300053148 Bacteria 1117
460 Ga0466967_0020434
461 MBSR1b_contig_10687149
462 MBSR1b_contig_3075083
463 JGI24752J21851_1006737
464 rootH1_10072367
465 Ga0065712_10110185
466 Ga0065715_10100445
467 Ga0070676_10187489
468 Ga0070683_100004307
469 Ga0070683_100009684
470 Ga0070683_100036129
471 Ga0070683_100076595
472 Ga0070683_100251286
473 Ga0070690_100057445
474 Ga0070670_100007497
475 Ga0070670_100026211
476 Ga0070670_100041851
477 Ga0068869_100022308
478 Ga0068869_100048921
479 Ga0068869_100062619
480 Ga0070666_10079788
481 Ga0070666_10227544
482 Ga0070680_100012656
483 Ga0070680_100078238
484 Ga0070680_100121078
485 Ga0070682_100006308
486 Ga0068868_100006130
487 Ga0068868_100011241
488 Ga0068868_100012374
489 Ga0068868_100023859
490 Ga0068868_100052668
491 Ga0070660_100025956
492 Ga0070689_100006955
493 Ga0070689_100059374
494 Ga0070661_100012471
495 Ga0070661_100041300
496 Ga0070661_100044100
497 Ga0070668_100172756
498 Ga0070669_100040776
499 Ga0070675_100149865
500 Ga0070675_100320355
501 Ga0070671_100049424
502 Ga0070674_100021966
503 Ga0070673_100034755
504 Ga0070673_100172782
505 Ga0070673_100306633
506 Ga0070688_100010733
507 Ga0070688_100022461
508 Ga0070659_100004378
509 Ga0070659_100161572
510 Ga0070659_100237321
511 Ga0070667_100321921
512 Ga0070667_100374468
513 Ga0070709_10001348
514 Ga0070709_10031423
515 Ga0070714_100240426
516 Ga0070713_100029297
517 Ga0070713_100057955
518 Ga0070713_100060784
519 Ga0070713_100281461
520 Ga0070710_10020947
521 Ga0070711_100103082
522 Ga0070700_100220723
523 Ga0070708_100030903
524 Ga0070708_100096027
525 Ga0070708_100097593
526 Ga0070663_100037445
527 Ga0070663_100347827
528 Ga0070678_100049234
529 Ga0070678_100099999
530 Ga0070678_100332117
531 Ga0070662_100269475
532 Ga0070662_100316595
533 Ga0070681_10000514
534 Ga0070681_10001119
535 Ga0070681_10163981
536 Ga0068867_100025222
537 Ga0068867_100041140
538 Ga0068867_100171784
539 Ga0068867_100324557
540 Ga0070685_10004909
541 Ga0070685_10005825
542 Ga0070706_100319459
543 Ga0070679_100013394
544 Ga0070679_100014600
545 Ga0070679_100014764
546 Ga0070684_100007282
547 Ga0070684_100007471
548 Ga0070684_100015390
549 Ga0070684_100090420
550 Ga0070684_100180740
551 Ga0068853_100131027
552 Ga0068853_100292880
553 Ga0068853_100410705
554 Ga0070672_100014434
555 Ga0070672_100081644
556 Ga0070686_100004505
557 Ga0070686_100025348
558 Ga0070693_100044850
559 Ga0068855_100010203
560 Ga0068855_100010902
561 Ga0068855_100013792
562 Ga0068855_100177271
563 Ga0068855_100411448
564 Ga0070664_100005376
565 Ga0070664_100013863
566 Ga0070664_100032531
567 Ga0070664_100433139
568 Ga0068857_100001081
569 Ga0068857_100004136
570 Ga0068857_100024356
571 Ga0068857_100293377
572 Ga0068854_100015913
573 Ga0068854_100031231
574 Ga0068854_100192879
575 Ga0068854_100251093
576 Ga0068856_100002225
577 Ga0068856_100040101
578 Ga0068856_100059958
579 Ga0068856_100230485
580 Ga0070702_100100168
581 Ga0068852_100009232
582 Ga0068852_100144100
583 Ga0068852_100526894
584 Ga0068859_100007323
585 Ga0068859_100012539
586 Ga0068859_100060496
587 Ga0068859_100083417
588 Ga0068859_100366716
589 Ga0068864_100003304
590 Ga0068864_100009671
591 Ga0068864_100016028
592 Ga0068864_100027086
593 Ga0068866_10007790
594 Ga0068866_10235453
595 Ga0068861_100022036
596 Ga0068861_100203303
597 Ga0068861_100460406
598 Ga0068851_10009593
599 Ga0068870_10002102
600 Ga0068870_10027377
601 Ga0068863_100011528
602 Ga0068863_100017251
603 Ga0068863_100046320
604 Ga0068863_100138469
605 Ga0068858_100000375
606 Ga0068858_100017640
607 Ga0068858_100026042
608 Ga0068858_100093491
609 Ga0068858_100169631
610 Ga0068860_100016008
611 Ga0068860_100023944
612 Ga0068862_100013979
613 Ga0068862_100058745
614 Ga0070717_10010079
615 Ga0070717_10223325
616 Ga0070717_10421422
617 Ga0097621_100000506
618 Ga0097621_100008272
619 Ga0097621_100022406
620 Ga0097621_100035049
621 Ga0097621_100102612
622 Ga0068871_100000535
623 Ga0068871_100000685
624 Ga0068871_100033008
625 Ga0068871_100220896
626 Ga0068871_100397869
627 Ga0068871_100475292
628 Ga0075434_100205194
629 Ga0068865_100008364
630 Ga0068865_100018956
631 Ga0068865_100086148
632 Ga0075436_100254188
633 Ga0097620_100007323
634 Ga0097620_100012539
635 Ga0097620_100060505
636 Ga0097620_100083412
637 Ga0097620_100366729
638 Ga0075435_100030073
639 Ga0105240_10020222
640 Ga0105240_10058494
641 Ga0105240_10075789
642 Ga0105240_10082607
643 Ga0105240_10164796
644 Ga0105240_10518996
645 Ga0105245_10001231
646 Ga0105245_10014727
647 Ga0105245_10031070
648 Ga0105247_10027192
649 Ga0105241_10038644
650 Ga0105241_10132768
651 Ga0105242_10579066
652 Ga0105248_10084023
653 Ga0105248_10124740
654 Ga0105248_10147892
655 Ga0105237_10012422
656 Ga0105237_10123183
657 Ga0105237_10220510
658 Ga0105237_10308887
659 Ga0105237_10363025
660 Ga0105238_10001026
661 Ga0105238_10099965
662 Ga0105238_10113815
663 Ga0105238_10183465
664 Ga0105238_10342227
665 Ga0105249_10173130
666 Ga0105249_10354213
667 Ga0105239_10035483
668 Ga0105239_10039496
669 Ga0105239_10044867
670 Ga0105239_10153298
671 Ga0105239_10199168
672 Ga0105246_10000186
673 Ga0105246_10165165
674 Ga0157373_10005638
675 Ga0157373_10006490
676 Ga0157373_10010939
677 Ga0157373_10140138
678 Ga0157371_10006790
679 Ga0157371_10030660
680 Ga0157371_10038498
681 Ga0157371_10056664
682 Ga0157370_10055766
683 Ga0157370_10064511
684 Ga0157369_10000353
685 Ga0157369_10008810
686 Ga0157369_10021106
687 Ga0157369_10189979
688 Ga0157369_10208166
689 Ga0157374_10000232
690 Ga0157374_10001168
691 Ga0157374_10003773
692 Ga0157374_10003942
693 Ga0157374_10112442
694 Ga0157374_10353506
695 Ga0157378_10000493
696 Ga0157378_10000951
697 Ga0157378_10001878
698 Ga0157378_10003997
699 Ga0157378_10011110
700 Ga0157378_10126648
701 Ga0163162_10004214
702 Ga0163162_10090123
703 Ga0163162_10379775
704 Ga0163162_10666802
705 Ga0157372_10000565
706 Ga0157372_10001006
707 Ga0157372_10001010
708 Ga0157372_10004155
709 Ga0157372_10007667
710 Ga0157372_10010811
711 Ga0157372_10011500
712 Ga0157372_10123904
713 Ga0157372_10126251
714 Ga0157372_10168249
715 Ga0157372_10178013
716 Ga0157372_10184366
717 Ga0157372_10214798
718 Ga0157372_10546114
719 Ga0157372_10593466
720 Ga0157375_10041769
721 Ga0157375_10056847
722 Ga0163163_10003050
723 Ga0163163_10008547
724 Ga0163163_10173554
725 Ga0163163_10180558
726 Ga0182008_10006833
727 Ga0157377_10000320
728 Ga0157377_10002255
729 Ga0157377_10086236
730 Ga0157379_10004703
731 Ga0157379_10017036
732 Ga0157379_10023022
733 Ga0157379_10028806
734 Ga0157379_10113616
735 Ga0157379_10291279
736 Ga0157376_10000907
737 Ga0157376_10006887
738 Ga0157376_10010395
739 Ga0163161_10003989
740 Ga0163161_10408283
741 Ga0207697_10016919
742 Ga0207692_10026222
743 Ga0207642_10003085
744 Ga0207642_10177617
745 Ga0207710_10012959
746 Ga0207680_10097240
747 Ga0207647_10038484
748 Ga0207647_10053893
749 Ga0207699_10345664
750 Ga0207645_10000104
751 Ga0207645_10005885
752 Ga0207643_10000328
753 Ga0207643_10000528
754 Ga0207684_10268936
755 Ga0207654_10019982
756 Ga0207654_10065115
757 Ga0207707_10002352
758 Ga0207707_10094424
759 Ga0207707_10281341
760 Ga0207707_10361839
761 Ga0207695_10016411
762 Ga0207695_10071280
763 Ga0207695_10211139
764 Ga0207693_10000272
765 Ga0207662_10184351
766 Ga0207657_10000321
767 Ga0207649_10000149
768 Ga0207649_10000612
769 Ga0207649_10163106
770 Ga0207652_10010885
771 Ga0207652_10055022
772 Ga0207652_10213538
773 Ga0207652_10452243
774 Ga0207694_10001534
775 Ga0207694_10194905
776 Ga0207650_10000152
777 Ga0207650_10000170
778 Ga0207659_10065730
779 Ga0207687_10189902
780 Ga0207700_10045975
781 Ga0207700_10049926
782 Ga0207700_10321862
783 Ga0207664_10006288
784 Ga0207664_10197898
785 Ga0207664_10432287
786 Ga0207644_10021594
787 Ga0207644_10027585
788 Ga0207690_10021863
789 Ga0207690_10079648
790 Ga0207706_10372960
791 Ga0207670_10034248
792 Ga0207669_10187700
793 Ga0207704_10010269
794 Ga0207704_10030739
795 Ga0207704_10057003
796 Ga0207665_10027799
797 Ga0207665_10130937
798 Ga0207691_10000308
799 Ga0207691_10000417
800 Ga0207711_10062381
801 Ga0207711_10297086
802 Ga0207711_10399902
803 Ga0207689_10001387
804 Ga0207689_10001737
805 Ga0207689_10076672
806 Ga0207689_10426122
807 Ga0207661_10001053
808 Ga0207661_10011576
809 Ga0207661_10057094
810 Ga0207661_10347998
811 Ga0207679_10000080
812 Ga0207679_10000298
813 Ga0207667_10009724
814 Ga0207667_10017879
815 Ga0207667_10035191
816 Ga0207667_10056445
817 Ga0207651_10013134
818 Ga0207651_10117712
819 Ga0207712_10014990
820 Ga0207640_10030711
821 Ga0207640_10106956
822 Ga0207640_10443230
823 Ga0207658_10047384
824 Ga0207658_10206465
825 Ga0207677_10005229
826 Ga0207677_10139407
827 Ga0207703_10023050
828 Ga0207703_10023498
829 Ga0207703_10040728
830 Ga0207703_10053704
831 Ga0207703_10070237
832 Ga0207639_10303554
833 Ga0207639_10499346
834 Ga0207678_10000912
835 Ga0207678_10001414
836 Ga0207702_10000408
837 Ga0207702_10002163
838 Ga0207702_10008604
839 Ga0207702_10029909
840 Ga0207641_10000052
841 Ga0207641_10001162
842 Ga0207641_10012293
843 Ga0207641_10012922
844 Ga0207641_10247574
845 Ga0207648_10001643
846 Ga0207648_10005790
847 Ga0207648_10297252
848 Ga0207648_10403324
849 Ga0207676_10000176
850 Ga0207676_10000478
851 Ga0207676_10005564
852 Ga0207674_10000561
853 Ga0207674_10001476
854 Ga0207674_10333967
855 Ga0207674_10386660
856 Ga0207675_100017609
857 Ga0207675_100117921
858 Ga0207683_10001699
859 Ga0207683_10250993
860 Ga0207698_10056363
861 Ga0207698_10398470
862 Ga0268266_10015485
863 Ga0268266_10052904
864 Ga0268265_10006702
865 Ga0268265_10008845
866 Ga0268264_10115391
867 Ga0268264_10374708
868 Ga0265760_10005356
869 Ga0265332_10033843
870 Ga0307408_100040777
871 Ga0265314_10110140
872 Ga0265342_10056919
873 Ga0307405_10029679
874 Ga0307410_10019909
875 Ga0307409_100148833
876 Ga0307416_100035711
877 Ga0307416_100191903
878 Ga0373923_0074333
879 Ga0373931_0070701
880 Ga0373927_0030792
881 Ga0373925_0138612
882 Ga0395898_0128074
883 Ga0395901_0664529
884 Ga0436362_0028250
885 Ga0466961_0115722
886 Ga0466963_0022006
887 Ga0466963_0025421
888 Ga0451576_0549503
889 Ga0466967_0000391
890 Ga0466967_0003625
891 Ga0495580_0179255
892 Ga0495630_0503755
893 Ga0495645_0134685
894 Ga0495670_0121690
895 Ga0496100_0119868
896 Ga0496102_0017453
897 Ga0496102_0428428
898 Ga0496108_0000242
899 Ga0496108_0000335
900 Ga0496109_0000120
901 Ga0496109_0000184
902 Ga0496110_0001177
903 Ga0496110_0003869
904 Ga0496111_0002331
905 Ga0496112_0000034
906 Ga0496112_0000198
907 Ga0496112_0011281
908 Ga0496112_0060399
909 Ga0496112_0241685
910 Ga0496112_0449436
911 Ga0496113_0000789
912 Ga0496113_0260058
913 Ga0496115_0038909
914 nmdc:mga0n895_193518_c1
915 nmdc:mga0rr50_12138_c1
916 nmdc:mga08x19_230214_c1
917 Ga0500590_138220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

81

224

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

84

197

0.84

PF00326

Peptidase_S9

Prolyl oligopeptidase family

98

309

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

86

298

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5m-assembly1.cif.gz_A structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.841 35 308
5g5m-assembly1.cif.gz_B structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.8323 34 308
5g5m-assembly1.cif.gz_A structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.8315 35 308
5g5m-assembly1.cif.gz_B structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.8231 34 308
5g5c-assembly1.cif.gz_A-2 structure of the pyrococcus furiosus esterase pf2001 with space group c2221 0.823 34 308
ID Description Score Start End Superfamily
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8888 59 190 3.40.50.1820
af_Q556N4_172_504_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8821 57 308 3.40.50.1820
af_A4HWS5_203_477_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8718 56 306 3.40.50.1820
af_A4I567_26_292_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8659 34 285 3.40.50.1820
af_Q0DRS5_1_166_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8645 141 308 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9QM75-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.982 32 309
AF-A0A7R8GEY5-F1-model_v4 deleted 0.9514 57 305
AF-A0A845TX26-F1-model_v4 Alpha/beta fold hydrolase 0.9423 4 308 GO:0016787
AF-A0A2V9QM75-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9416 32 309
AF-A0A3D5NSY0-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9314 50 306

Map