F448030

General Info

Members Datasets Scaffolds Average Seq Length
457 331 421 296

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_013158|Ga0439447_013158_1255_2295
Length 346
Sequence MPESFPGPLAVRWRRFRAGRFSLLMEGEVIDSLSMGLFFLVRLSIAGAMQEGMMKTVKAGVLEIAYLEIGPVDGAPVVLLHGFPYDVHAYDEVARILASAGKRCLTPYLRGYGPTRFLDEQTMRSGEQAAIGADLLAFLDALKIEKALLAGYDWGGRAACIVAALWPERVSGLVSCGGYSIQNIAEAHQPASPEAEHLLWYQYYLHGSRGRAGLTSNRKDFCRLLWRMWSPTWRFTQEAFETTAAAFENDDFVDVVTHSYRHRFGLVEGDPAYRNIESRLAAQPRIAVPSLVLEGGADAVDPPAEEDPFARHFTGPYRREILEGIGHNVPQEAPGTFADGILSLGG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
4 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
5 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
6 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
7 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
8 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
9 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
10 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
11 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
12 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
13 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
14 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
15 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
16 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
17 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
18 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
19 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
20 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
21 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
22 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
23 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
24 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
25 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
26 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
27 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
28 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
31 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
32 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
33 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
34 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
35 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
36 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
37 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
38 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
39 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
239 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
240 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
243 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
244 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
331 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 0
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0
Rhizoplane 6.78
Rhizosphere 80.96
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2248537 2162886011 Bacteria 6522
2 JGI24742J22300_10022576 3300002244 Bacteria 1079
3 JGI25162J39368_1000081 3300002737 Bacteria 113016
4 JGI25163J39215_1000016 3300002771 Bacteria 82638
5 JGI25164J39214_1000060 3300002772 Bacteria 110667
6 JGI25151J46595_10001299 3300003187 Bacteria 17505
7 JGI25151J46595_10006332 3300003187 Bacteria 5964
8 JGI25165J46597_1000153 3300003214 Bacteria 113016
9 JGI25405J52794_10002968 3300003911 Bacteria 2948
10 Ga0065714_10002262 3300005288 Bacteria 35666
11 Ga0065714_10004999 3300005288 Bacteria 6542
12 Ga0065712_10068085 3300005290 Bacteria 15225
13 Ga0070658_10001588 3300005327 Bacteria 19209
14 Ga0070676_10000290 3300005328 Bacteria 22266
15 Ga0070683_100001772 3300005329 Bacteria 16802
16 Ga0070690_100155005 3300005330 Bacteria 1565
17 Ga0070670_100000416 3300005331 Bacteria 35091
18 Ga0070670_100071138 3300005331 Bacteria 2986
19 Ga0070677_10003248 3300005333 Bacteria 5236
20 Ga0068869_100001632 3300005334 Bacteria 13367
21 Ga0070680_100128895 3300005336 Bacteria 2115
22 Ga0068868_100038076 3300005338 Bacteria 3732
23 Ga0070660_100000052 3300005339 Bacteria 68022
24 Ga0070689_100001678 3300005340 Bacteria 14140
25 Ga0070687_100000134 3300005343 Bacteria 25638
26 Ga0070661_100007867 3300005344 Bacteria 7359
27 Ga0070661_100248960 3300005344 Bacteria 1371
28 Ga0070692_10015776 3300005345 Bacteria 3580
29 Ga0070669_100065038 3300005353 Bacteria 2686
30 Ga0070675_100002647 3300005354 Bacteria 13454
31 Ga0070671_100006839 3300005355 Bacteria 9128
32 Ga0070674_100002955 3300005356 Bacteria 9429
33 Ga0070688_100000725 3300005365 Bacteria 16228
34 Ga0070659_100000813 3300005366 Bacteria 22774
35 Ga0070667_100147225 3300005367 Bacteria 2066
36 Ga0070714_100172911 3300005435 Bacteria 1961
37 Ga0070713_100242713 3300005436 Bacteria 1641
38 Ga0070710_10103857 3300005437 Bacteria 1697
39 Ga0070701_10031866 3300005438 Bacteria 2619
40 Ga0070711_100014026 3300005439 Bacteria 5042
41 Ga0070711_100077928 3300005439 Bacteria 2353
42 Ga0070705_100011223 3300005440 Bacteria 4513
43 Ga0070708_100012168 3300005445 Bacteria 7014
44 Ga0070663_100000805 3300005455 Bacteria 17079
45 Ga0070663_100234191 3300005455 Bacteria 1447
46 Ga0070678_100007114 3300005456 Bacteria 6619
47 Ga0070662_100000701 3300005457 Bacteria 20526
48 Ga0070685_10000949 3300005466 Bacteria 15589
49 Ga0070706_100060343 3300005467 Bacteria 3501
50 Ga0070706_100066157 3300005467 Bacteria 3343
51 Ga0070707_100001008 3300005468 Bacteria 27893
52 Ga0070707_100128149 3300005468 Bacteria 2466
53 Ga0070707_100192068 3300005468 Bacteria 1991
54 Ga0070698_100005483 3300005471 Bacteria 13852
55 Ga0070698_100171866 3300005471 Unclassified 2108
56 Ga0070684_100002455 3300005535 Bacteria 13652
57 Ga0070697_100083531 3300005536 Bacteria 2634
58 Ga0070697_100176231 3300005536 Bacteria 1811
59 Ga0070697_100196606 3300005536 Bacteria 1713
60 Ga0068853_100000288 3300005539 Bacteria 35623
61 Ga0070672_100001812 3300005543 Bacteria 13346
62 Ga0070686_100010839 3300005544 Bacteria 5155
63 Ga0070695_100009656 3300005545 Bacteria 5746
64 Ga0070696_100007067 3300005546 Bacteria 7496
65 Ga0068855_100000202 3300005563 Bacteria 76682
66 Ga0070664_100000880 3300005564 Bacteria 23311
67 Ga0068857_100007319 3300005577 Bacteria 9508
68 Ga0068857_100494925 3300005577 Bacteria 1147
69 Ga0068854_100000406 3300005578 Bacteria 27042
70 Ga0068854_100188563 3300005578 Bacteria 1615
71 Ga0068856_100003305 3300005614 Bacteria 16389
72 Ga0068852_100001778 3300005616 Bacteria 14653
73 Ga0068859_100609995 3300005617 Unclassified 1184
74 Ga0068866_10000446 3300005718 Bacteria 19086
75 Ga0068861_100005061 3300005719 Bacteria 8894
76 Ga0068851_10000065 3300005834 Bacteria 58958
77 Ga0068870_10000197 3300005840 Bacteria 21559
78 Ga0068863_100030495 3300005841 Bacteria 5148
79 Ga0068858_100288631 3300005842 Bacteria 1563
80 Ga0068860_100507068 3300005843 Bacteria 1205
81 Ga0068862_100082740 3300005844 Bacteria 2786
82 Ga0081455_10110772 3300005937 Bacteria 2182
83 Ga0081538_10046818 3300005981 Bacteria 2661
84 Ga0081540_1001798 3300005983 Bacteria 17972
85 Ga0081539_10004590 3300005985 Bacteria 15078
86 Ga0070717_10284254 3300006028 Bacteria 1468
87 Ga0070717_10616999 3300006028 Bacteria 984
88 Ga0070712_100002146 3300006175 Bacteria 12130
89 Ga0070712_100263572 3300006175 Bacteria 1382
90 Ga0070712_100300268 3300006175 Bacteria 1299
91 Ga0075367_10263020 3300006178 Bacteria 1083
92 Ga0097621_100000918 3300006237 Bacteria 20604
93 Ga0075370_10021067 3300006353 Bacteria 3570
94 Ga0075370_10024243 3300006353 Bacteria 3350
95 Ga0068871_100001441 3300006358 Bacteria 15931
96 Ga0075428_100097377 3300006844 Unclassified 3207
97 Ga0075428_100168635 3300006844 Bacteria 2374
98 Ga0075428_100259600 3300006844 Bacteria 1871
99 Ga0075428_100444670 3300006844 Bacteria 1388
100 Ga0075431_100056035 3300006847 Bacteria 4066
101 Ga0075433_10007389 3300006852 Bacteria 8721
102 Ga0075434_100017537 3300006871 Bacteria 6901
103 Ga0075434_100109807 3300006871 Bacteria 2768
104 Ga0075434_100147280 3300006871 Bacteria 2375
105 Ga0075429_100005732 3300006880 Bacteria 10717
106 Ga0075429_100011692 3300006880 Bacteria 7611
107 Ga0075429_100031959 3300006880 Bacteria 4576
108 Ga0075436_100047351 3300006914 Bacteria 2966
109 Ga0097620_100610023 3300006931 Unclassified 1184
110 Ga0075435_100016670 3300007076 Bacteria 5541
111 Ga0075435_100019967 3300007076 Bacteria 5122
112 Ga0105251_10014606 3300009011 Bacteria 4330
113 Ga0105244_10001757 3300009036 Bacteria 17030
114 Ga0105244_10044419 3300009036 Bacteria 2289
115 Ga0105240_10003064 3300009093 Bacteria 26280
116 Ga0111539_10014556 3300009094 Bacteria 9822
117 Ga0111539_10015198 3300009094 Bacteria 9589
118 Ga0111539_10019377 3300009094 Bacteria 8399
119 Ga0105245_10003480 3300009098 Bacteria 14099
120 Ga0105247_10000835 3300009101 Bacteria 23400
121 Ga0114129_10046663 3300009147 Bacteria 6088
122 Ga0114129_10260107 3300009147 Unclassified 2326
123 Ga0114129_10287093 3300009147 Bacteria 2197
124 Ga0114129_10344929 3300009147 Unclassified 1974
125 Ga0105243_10000310 3300009148 Bacteria 53933
126 Ga0105243_10003726 3300009148 Bacteria 12228
127 Ga0105243_10004796 3300009148 Bacteria 10628
128 Ga0105243_10043712 3300009148 Bacteria 3511
129 Ga0105241_10000829 3300009174 Bacteria 23452
130 Ga0105242_10001542 3300009176 Bacteria 18118
131 Ga0105248_10014172 3300009177 Bacteria 8776
132 Ga0105237_10000190 3300009545 Bacteria 87182
133 Ga0105238_10003095 3300009551 Bacteria 16587
134 Ga0105238_10105833 3300009551 Bacteria 2795
135 Ga0105238_10271615 3300009551 Bacteria 1676
136 Ga0105249_10000986 3300009553 Bacteria 25228
137 Ga0105249_10161751 3300009553 Bacteria 2164
138 Ga0105239_10003835 3300010375 Bacteria 18255
139 Ga0105246_10012204 3300011119 Bacteria 5354
140 Ga0105246_10171990 3300011119 Bacteria 1660
141 Ga0157373_10006961 3300013100 Bacteria 8421
142 Ga0157371_10000264 3300013102 Bacteria 71499
143 Ga0157371_10004934 3300013102 Bacteria 11461
144 Ga0157371_10203782 3300013102 Bacteria 1419
145 Ga0157369_10000161 3300013105 Bacteria 94988
146 Ga0157374_10002380 3300013296 Bacteria 15849
147 Ga0157378_10010750 3300013297 Bacteria 8001
148 Ga0163162_10007385 3300013306 Bacteria 10687
149 Ga0163162_10144033 3300013306 Bacteria 2498
150 Ga0163162_10184906 3300013306 Bacteria 2210
151 Ga0157372_10007592 3300013307 Bacteria 11528
152 Ga0157375_10004227 3300013308 Bacteria 12449
153 Ga0157375_10200441 3300013308 Bacteria 2152
154 Ga0163163_10061450 3300014325 Bacteria 3722
155 Ga0163163_10406509 3300014325 Bacteria 1420
156 Ga0182008_10000050 3300014497 Bacteria 103527
157 Ga0182008_10003128 3300014497 Bacteria 10127
158 Ga0182008_10024635 3300014497 Bacteria 3062
159 Ga0157377_10000141 3300014745 Bacteria 45798
160 Ga0157379_10000079 3300014968 Bacteria 63166
161 Ga0157376_10001389 3300014969 Bacteria 15949
162 Ga0182006_1002944 3300015261 Bacteria 9007
163 Ga0182007_10000383 3300015262 Bacteria 27816
164 Ga0213876_10020279 3300021384 Bacteria 3513
165 Ga0213876_10039609 3300021384 Bacteria 2490
166 Ga0213876_10039761 3300021384 Bacteria 2485
167 Ga0209760_100041 3300025207 Bacteria 115995
168 Ga0207427_100104 3300025231 Bacteria 119099
169 Ga0209437_100348 3300025233 Bacteria 54213
170 Ga0209148_1000377 3300025254 Bacteria 54144
171 Ga0209129_1004420 3300025258 Bacteria 5486
172 Ga0209233_1000202 3300025261 Bacteria 119099
173 Ga0209455_1000299 3300025272 Bacteria 51077
174 Ga0209025_1000244 3300025294 Bacteria 127938
175 Ga0209025_1001083 3300025294 Bacteria 39415
176 Ga0207426_1060307 3300025302 Bacteria 1093
177 Ga0207697_10058552 3300025315 Bacteria 1600
178 Ga0207656_10001575 3300025321 Bacteria 7584
179 Ga0207655_1000285 3300025728 Bacteria 77315
180 Ga0207655_1001301 3300025728 Bacteria 23616
181 Ga0207655_1009652 3300025728 Bacteria 5967
182 Ga0207713_1028623 3300025735 Bacteria 2509
183 Ga0207682_10000319 3300025893 Bacteria 21917
184 Ga0207710_10005587 3300025900 Bacteria 5410
185 Ga0207688_10000015 3300025901 Bacteria 57722
186 Ga0207680_10002258 3300025903 Bacteria 8988
187 Ga0207647_10004455 3300025904 Bacteria 10380
188 Ga0207699_10206421 3300025906 Bacteria 1334
189 Ga0207645_10000025 3300025907 Bacteria 98264
190 Ga0207643_10000023 3300025908 Bacteria 104515
191 Ga0207705_10019245 3300025909 Bacteria 4883
192 Ga0207684_10011436 3300025910 Bacteria 7764
193 Ga0207684_10047516 3300025910 Bacteria 3640
194 Ga0207654_10005498 3300025911 Bacteria 6411
195 Ga0207695_10017104 3300025913 Bacteria 8455
196 Ga0207671_10045493 3300025914 Bacteria 3246
197 Ga0207693_10002609 3300025915 Bacteria 15668
198 Ga0207693_10106776 3300025915 Bacteria 2196
199 Ga0207693_10470289 3300025915 Bacteria 982
200 Ga0207663_10005937 3300025916 Bacteria 6198
201 Ga0207660_10041423 3300025917 Bacteria 3227
202 Ga0207662_10000346 3300025918 Bacteria 20992
203 Ga0207657_10000067 3300025919 Bacteria 97934
204 Ga0207657_10137903 3300025919 Bacteria 1995
205 Ga0207649_10004571 3300025920 Bacteria 7508
206 Ga0207649_10210596 3300025920 Bacteria 1379
207 Ga0207646_10001835 3300025922 Bacteria 25670
208 Ga0207646_10006933 3300025922 Bacteria 11629
209 Ga0207646_10448973 3300025922 Bacteria 1163
210 Ga0207681_10004137 3300025923 Bacteria 8998
211 Ga0207694_10003230 3300025924 Bacteria 12989
212 Ga0207650_10000147 3300025925 Bacteria 85501
213 Ga0207650_10001599 3300025925 Bacteria 16169
214 Ga0207659_10003682 3300025926 Bacteria 9240
215 Ga0207687_10002309 3300025927 Bacteria 12983
216 Ga0207644_10001339 3300025931 Bacteria 15822
217 Ga0207706_10000119 3300025933 Bacteria 84681
218 Ga0207709_10000280 3300025935 Bacteria 58638
219 Ga0207709_10001108 3300025935 Bacteria 19734
220 Ga0207709_10019553 3300025935 Bacteria 3811
221 Ga0207709_10025878 3300025935 Bacteria 3364
222 Ga0207670_10000100 3300025936 Bacteria 59919
223 Ga0207669_10006044 3300025937 Bacteria 5494
224 Ga0207704_10003255 3300025938 Bacteria 7366
225 Ga0207665_10057232 3300025939 Bacteria 2633
226 Ga0207691_10000079 3300025940 Bacteria 82300
227 Ga0207711_10000189 3300025941 Bacteria 65922
228 Ga0207689_10001164 3300025942 Bacteria 25319
229 Ga0207661_10003663 3300025944 Bacteria 10706
230 Ga0207679_10000531 3300025945 Bacteria 25768
231 Ga0207679_10001426 3300025945 Bacteria 15043
232 Ga0207667_10113926 3300025949 Bacteria 2788
233 Ga0207651_10002161 3300025960 Bacteria 9301
234 Ga0207651_10279801 3300025960 Bacteria 1378
235 Ga0207712_10000157 3300025961 Bacteria 70058
236 Ga0207712_10048663 3300025961 Bacteria 2950
237 Ga0207668_10004328 3300025972 Bacteria 8336
238 Ga0207658_10000885 3300025986 Bacteria 24958
239 Ga0207677_10000113 3300026023 Bacteria 65880
240 Ga0207703_10002397 3300026035 Bacteria 16297
241 Ga0207639_10093313 3300026041 Bacteria 2414
242 Ga0207639_10095516 3300026041 Bacteria 2389
243 Ga0207678_10004616 3300026067 Bacteria 12376
244 Ga0207678_10223987 3300026067 Bacteria 1610
245 Ga0207708_10052922 3300026075 Bacteria 3092
246 Ga0207702_10030569 3300026078 Bacteria 4487
247 Ga0207641_10009975 3300026088 Bacteria 7815
248 Ga0207648_10000095 3300026089 Bacteria 84340
249 Ga0207676_10005002 3300026095 Bacteria 9387
250 Ga0207674_10001904 3300026116 Bacteria 26535
251 Ga0207674_10123837 3300026116 Bacteria 2551
252 Ga0207675_100001269 3300026118 Bacteria 25244
253 Ga0207683_10000050 3300026121 Bacteria 87435
254 Ga0207698_10007847 3300026142 Bacteria 6712
255 Ga0209970_1006384 3300027614 Bacteria 1933
256 Ga0209983_1000121 3300027665 Bacteria 13836
257 Ga0209971_1000070 3300027682 Bacteria 31653
258 Ga0209966_1000042 3300027695 Bacteria 53500
259 Ga0209998_10000127 3300027717 Bacteria 29842
260 Ga0268266_10000415 3300028379 Bacteria 64982
261 Ga0268266_10087294 3300028379 Bacteria 2729
262 Ga0268265_10005984 3300028380 Bacteria 8278
263 Ga0268265_10006904 3300028380 Bacteria 7680
264 Ga0268264_10001060 3300028381 Bacteria 27306
265 Ga0268264_10503256 3300028381 Bacteria 1182
266 Ga0265338_10009743 3300028800 Bacteria 11397
267 Ga0307405_10035526 3300031731 Bacteria 2977
268 Ga0373955_0302225 3300035172 Bacteria 965
269 Ga0373935_0047600 3300035692 Bacteria 2712
270 Ga0373927_0146796 3300035695 Bacteria 1544
271 Ga0373947_0038381 3300035725 Bacteria 2845
272 Ga0373937_0094562 3300036401 Bacteria 2771
273 Ga0373925_0076960 3300037068 Bacteria 2531
274 Ga0373925_0206700 3300037068 Bacteria 1563
275 Ga0436365_0628342 3300039437 Bacteria 21312
276 Ga0436362_1260443 3300039453 Bacteria 1342
277 Ga0439436_0033840 3300041404 Bacteria 1479
278 Ga0439438_000491 3300041405 Bacteria 17909
279 Ga0439447_013158 3300041407 Bacteria 2354
280 Ga0439466_0020609 3300041411 Bacteria 2348
281 Ga0439432_003095 3300042006 Bacteria 6196
282 Ga0450889_005401 3300042144 Bacteria 1273
283 Ga0450909_006935 3300042185 Bacteria 1634
284 Ga0451577_0025297 3300042876 Bacteria 5388
285 Ga0451577_0087727 3300042876 Bacteria 2775
286 Ga0453683_0094466 3300044673 Bacteria 1875
287 Ga0451576_0002155 3300045051 Bacteria 30466
288 Ga0451576_0036547 3300045051 Bacteria 5205
289 Ga0451576_0128687 3300045051 Bacteria 2639
290 Ga0451576_0139484 3300045051 Bacteria 2529
291 Ga0466967_0429485 3300045976 Bacteria 1289
292 Ga0495629_0290505 3300046459 Bacteria 1121
293 Ga0495650_0007708 3300046471 Bacteria 6414
294 Ga0495580_0002649 3300046472 Bacteria 15549
295 Ga0495580_0086230 3300046472 Bacteria 2187
296 Ga0495605_0002430 3300046474 Bacteria 11518
297 Ga0495585_0083781 3300046492 Bacteria 1725
298 Ga0495596_0000793 3300046500 Bacteria 19224
299 Ga0495607_0000094 3300046501 Bacteria 92515
300 Ga0495607_0000224 3300046501 Bacteria 60214
301 Ga0495607_0000530 3300046501 Bacteria 37462
302 Ga0495607_0021489 3300046501 Bacteria 4060
303 Ga0495606_0004740 3300046507 Bacteria 13395
304 Ga0495610_0000840 3300046512 Bacteria 28602
305 Ga0495620_0000181 3300046515 Bacteria 48918
306 Ga0495620_0031535 3300046515 Bacteria 2428
307 Ga0495630_0349274 3300046517 Bacteria 1132
308 Ga0495632_0000022 3300046519 Bacteria 187045
309 Ga0495632_0000492 3300046519 Bacteria 37278
310 Ga0495648_0000236 3300046524 Bacteria 63182
311 Ga0495654_0000923 3300046530 Bacteria 21856
312 Ga0495654_0001535 3300046530 Bacteria 15672
313 Ga0495609_0000214 3300046538 Bacteria 57759
314 Ga0495656_0003948 3300046615 Bacteria 5035
315 Ga0495656_0009485 3300046615 Bacteria 3500
316 Ga0495625_0000242 3300046660 Bacteria 85764
317 Ga0495661_0038071 3300046665 Bacteria 2999
318 Ga0495671_0009897 3300046692 Bacteria 5305
319 Ga0495660_0000316 3300046810 Bacteria 43536
320 Ga0495660_0000353 3300046810 Bacteria 40596
321 Ga0495660_0029994 3300046810 Bacteria 3065
322 Ga0495674_0088530 3300047319 Bacteria 2648
323 Ga0495683_0000014 3300047323 Bacteria 199398
324 Ga0495687_040316 3300047443 Bacteria 2058
325 Ga0495679_004826 3300047446 Bacteria 6094
326 Ga0495681_0115295 3300047470 Bacteria 1159
327 Ga0495684_0350920 3300047471 Bacteria 1047
328 Ga0495626_0000010 3300048091 Bacteria 270265
329 Ga0496100_0100141 3300048903 Bacteria 1995
330 Ga0496102_0001170 3300048905 Bacteria 23917
331 Ga0496102_0036346 3300048905 Bacteria 4437
332 Ga0496103_0115093 3300048906 Bacteria 1710
333 Ga0496106_0005729 3300048909 Bacteria 9192
334 Ga0496106_0238036 3300048909 Bacteria 1454
335 Ga0496106_0310864 3300048909 Bacteria 1264
336 Ga0496107_0013880 3300048910 Bacteria 5631
337 Ga0496107_0014757 3300048910 Bacteria 5471
338 Ga0496108_0062730 3300048911 Bacteria 3129
339 Ga0496109_0031366 3300048912 Bacteria 4769
340 Ga0496109_0087463 3300048912 Bacteria 2878
341 Ga0496110_0012626 3300048913 Bacteria 6948
342 Ga0496112_0000706 3300048915 Bacteria 23155
343 Ga0496115_0078325 3300048918 Bacteria 2689
344 Ga0496116_0000290 3300048919 Bacteria 85274
345 Ga0496116_0006174 3300048919 Bacteria 10956
346 Ga0496117_0005356 3300048920 Bacteria 13519
347 Ga0496117_0038298 3300048920 Bacteria 3558
348 Ga0496118_0007440 3300048921 Bacteria 11601
349 Ga0496118_0066631 3300048921 Bacteria 2627
350 Ga0496121_0000255 3300048924 Bacteria 113201
351 Ga0496121_0004122 3300048924 Bacteria 19920
352 Ga0496121_0022587 3300048924 Bacteria 6095
353 Ga0496122_0000654 3300048925 Bacteria 69918
354 Ga0496122_0102436 3300048925 Bacteria 1909
355 Ga0496123_0000688 3300048926 Bacteria 55759
356 Ga0496124_0000004 3300048927 Bacteria 976131
357 Ga0496124_0017153 3300048927 Bacteria 6843
358 Ga0496125_0016989 3300048928 Bacteria 6957
359 Ga0496125_0070849 3300048928 Bacteria 2727
360 Ga0495682_0000169 3300049460 Bacteria 55128
361 Ga0501033_0167467 3300049570 Bacteria 1579
362 Ga0501034_0535495 3300049571 Bacteria 1082
363 Ga0501036_0403902 3300049572 Bacteria 1140
364 Ga0501038_0325005 3300049574 Bacteria 1202
365 Ga0501040_0046212 3300049576 Bacteria 2972
366 Ga0501042_0057975 3300049578 Bacteria 2764
367 Ga0501046_0010569 3300049580 Bacteria 7921
368 Ga0501047_0292641 3300049581 Bacteria 1472
369 Ga0501048_0121839 3300049582 Bacteria 1843
370 Ga0501048_0217995 3300049582 Bacteria 1353
371 Ga0501048_0288750 3300049582 Bacteria 1166
372 Ga0501071_0042738 3300049587 Bacteria 3248
373 Ga0501072_0063873 3300049588 Bacteria 2904
374 Ga0501072_0076321 3300049588 Bacteria 2651
375 Ga0501075_0004477 3300049591 Bacteria 9462
376 Ga0501076_0000949 3300049592 Bacteria 18914
377 Ga0501076_0313858 3300049592 Bacteria 1286
378 Ga0501077_0002556 3300049593 Bacteria 10911
379 Ga0501079_0025494 3300049741 Bacteria 4534
380 Ga0501080_0050722 3300049742 Bacteria 3862
381 Ga0501081_0012354 3300049743 Bacteria 5609
382 Ga0501083_0056039 3300049744 Bacteria 2642
383 Ga0501045_0046525 3300049824 Bacteria 3160
384 nmdc:mga0k408_20506_c1 3300050493 Bacteria 3703
385 nmdc:mga07m45_2016_c1 3300050496 Bacteria 7703
386 nmdc:mga07m45_3006_c1 3300050496 Bacteria 8036
387 nmdc:mga05p37_12706_c1 3300050507 Bacteria 10064
388 nmdc:mga05p37_198027_c1 3300050507 Unclassified 2435
389 nmdc:mga05p37_32968_c1 3300050507 Bacteria 6342
390 nmdc:mga05p37_351599_c1 3300050507 Bacteria 1735
391 nmdc:mga05p37_61662_c1 3300050507 Bacteria 4616
392 nmdc:mga05p37_76650_c1 3300050507 Bacteria 4116
393 nmdc:mga09592_2326_c1 3300050508 Bacteria 15337
394 nmdc:mga09592_368921_c1 3300050508 Bacteria 1242
395 nmdc:mga09592_86625_c1 3300050508 Bacteria 2673
396 nmdc:mga09592_98997_c1 3300050508 Bacteria 2496
397 nmdc:mga06r32_43096_c1 3300050510 Bacteria 4293
398 nmdc:mga08y16_6236_c1 3300050511 Bacteria 12503
399 nmdc:mga08y16_65497_c1 3300050511 Bacteria 3793
400 nmdc:mga08y16_6961_c1 3300050511 Bacteria 11853
401 nmdc:mga0n895_20267_c1 3300050512 Bacteria 6198
402 nmdc:mga0n895_387825_c1 3300050512 Bacteria 1413
403 nmdc:mga0n895_62203_c1 3300050512 Bacteria 3688
404 nmdc:mga0rr50_351000_c1 3300050513 Bacteria 1241
405 nmdc:mga0rr50_368708_c1 3300050513 Unclassified 1210
406 nmdc:mga0rr50_37999_c1 3300050513 Bacteria 3480
407 nmdc:mga0rr50_490839_c1 3300050513 Bacteria 1043
408 nmdc:mga08x19_116436_c1 3300050514 Bacteria 1787
409 nmdc:mga08x19_59413_c1 3300050514 Bacteria 2475
410 nmdc:mga0a205_1366_c1 3300050515 Bacteria 20598
411 nmdc:mga0a205_202625_c1 3300050515 Bacteria 1874
412 nmdc:mga0a205_77333_c1 3300050515 Bacteria 3215
413 Ga0500583_0003828 3300053092 Bacteria 4811
414 Ga0500555_040490 3300053103 Bacteria 1298
415 Ga0500588_0004769 3300053146 Unclassified 2960
416 Ga0501084_0013285 3300054114 Bacteria 6813
417 Ga0501082_0002686 3300060353 Bacteria 15543
418 Ga0530510_0003767 3300061734 Bacteria 10442
419 Ga0530510_0020627 3300061734 Bacteria 4686
420 Ga0530510_0237610 3300061734 Bacteria 1356
421 Ga0530510_0262991 3300061734 Bacteria 1287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_490839_c1 nmdc:mga0rr50_490839_c1_30_767 244
2 3300006175 Ga0070712_100263572 Ga0070712_1002635722 268
3 3300025915 Ga0207693_10106776 Ga0207693_101067762 268
4 3300039453 Ga0436362_1260443 Ga0436362_1260443_186_1061 268
5 3300005435 Ga0070714_100172911 Ga0070714_1001729112 269
6 3300005439 Ga0070711_100077928 Ga0070711_1000779284 269
7 3300006028 Ga0070717_10284254 Ga0070717_102842541 269
8 3300006175 Ga0070712_100002146 Ga0070712_1000021462 269
9 3300025906 Ga0207699_10206421 Ga0207699_102064212 269
10 3300025915 Ga0207693_10002609 Ga0207693_100026092 269
11 3300005437 Ga0070710_10103857 Ga0070710_101038571 270
12 3300005536 Ga0070697_100196606 Ga0070697_1001966062 273
13 3300006175 Ga0070712_100300268 Ga0070712_1003002682 273
14 3300025915 Ga0207693_10470289 Ga0207693_104702892 273
15 3300007076 Ga0075435_100016670 Ga0075435_1000166706 279
16 3300050513 nmdc:mga0rr50_368708_c1 nmdc:mga0rr50_368708_c1_52_1047 279
17 3300042144 Ga0450889_005401 Ga0450889_005401_396_1244 281
18 3300042006 Ga0439432_003095 Ga0439432_003095_1548_2573 285
19 3300046459 Ga0495629_0290505 Ga0495629_0290505_33_896 287
20 3300046517 Ga0495630_0349274 Ga0495630_0349274_121_984 287
21 iso_pu_bacteria 2643221605 2644039498 287
22 3300049582 Ga0501048_0121839 Ga0501048_0121839_535_1404 288
23 3300049824 Ga0501045_0046525 Ga0501045_0046525_181_1050 288
24 3300061734 Ga0530510_0237610 Ga0530510_0237610_247_1116 288
25 iso_pu_bacteria 2582581307 2585270862 288
26 iso_pu_bacteria 2585427531 2585558586 288
27 iso_pu_bacteria 2595698237 2596374109 288
28 iso_pu_bacteria 2902405164 2902411860 288
29 iso_pu_bacteria 2928125067 2928129693 288
30 iso_pu_bacteria 2939657138 2939658851 288
31 3300002244 JGI24742J22300_10022576 JGI24742J22300_100225762 289
32 3300005327 Ga0070658_10001588 Ga0070658_100015884 289
33 3300005328 Ga0070676_10000290 Ga0070676_100002908 289
34 3300005329 Ga0070683_100001772 Ga0070683_1000017727 289
35 3300005330 Ga0070690_100155005 Ga0070690_1001550052 289
36 3300005331 Ga0070670_100071138 Ga0070670_1000711382 289
37 3300005333 Ga0070677_10003248 Ga0070677_100032483 289
38 3300005334 Ga0068869_100001632 Ga0068869_1000016321 289
39 3300005336 Ga0070680_100128895 Ga0070680_1001288953 289
40 3300005338 Ga0068868_100038076 Ga0068868_1000380764 289
41 3300005339 Ga0070660_100000052 Ga0070660_1000000521 289
42 3300005340 Ga0070689_100001678 Ga0070689_1000016787 289
43 3300005343 Ga0070687_100000134 Ga0070687_1000001344 289
44 3300005344 Ga0070661_100007867 Ga0070661_1000078671 289
45 3300005345 Ga0070692_10015776 Ga0070692_100157763 289
46 3300005353 Ga0070669_100065038 Ga0070669_1000650383 289
47 3300005354 Ga0070675_100002647 Ga0070675_1000026476 289
48 3300005355 Ga0070671_100006839 Ga0070671_1000068398 289
49 3300005356 Ga0070674_100002955 Ga0070674_1000029558 289
50 3300005365 Ga0070688_100000725 Ga0070688_1000007253 289
51 3300005366 Ga0070659_100000813 Ga0070659_10000081319 289
52 3300005367 Ga0070667_100147225 Ga0070667_1001472251 289
53 3300005436 Ga0070713_100242713 Ga0070713_1002427132 289
54 3300005438 Ga0070701_10031866 Ga0070701_100318661 289
55 3300005440 Ga0070705_100011223 Ga0070705_1000112232 289
56 3300005455 Ga0070663_100000805 Ga0070663_1000008058 289
57 3300005456 Ga0070678_100007114 Ga0070678_1000071144 289
58 3300005457 Ga0070662_100000701 Ga0070662_10000070120 289
59 3300005466 Ga0070685_10000949 Ga0070685_1000094913 289
60 3300005467 Ga0070706_100060343 Ga0070706_1000603432 289
61 3300005535 Ga0070684_100002455 Ga0070684_10000245511 289
62 3300005539 Ga0068853_100000288 Ga0068853_10000028826 289
63 3300005543 Ga0070672_100001812 Ga0070672_1000018122 289
64 3300005544 Ga0070686_100010839 Ga0070686_1000108393 289
65 3300005545 Ga0070695_100009656 Ga0070695_1000096564 289
66 3300005546 Ga0070696_100007067 Ga0070696_1000070676 289
67 3300005563 Ga0068855_100000202 Ga0068855_1000002028 289
68 3300005564 Ga0070664_100000880 Ga0070664_1000008807 289
69 3300005577 Ga0068857_100007319 Ga0068857_1000073197 289
70 3300005578 Ga0068854_100000406 Ga0068854_10000040617 289
71 3300005614 Ga0068856_100003305 Ga0068856_1000033058 289
72 3300005616 Ga0068852_100001778 Ga0068852_10000177812 289
73 3300005718 Ga0068866_10000446 Ga0068866_1000044612 289
74 3300005719 Ga0068861_100005061 Ga0068861_1000050613 289
75 3300005834 Ga0068851_10000065 Ga0068851_1000006512 289
76 3300005840 Ga0068870_10000197 Ga0068870_1000019713 289
77 3300005841 Ga0068863_100030495 Ga0068863_1000304954 289
78 3300005842 Ga0068858_100288631 Ga0068858_1002886311 289
79 3300005844 Ga0068862_100082740 Ga0068862_1000827402 289
80 3300005983 Ga0081540_1001798 Ga0081540_100179815 289
81 3300006237 Ga0097621_100000918 Ga0097621_1000009188 289
82 3300006358 Ga0068871_100001441 Ga0068871_10000144112 289
83 3300009093 Ga0105240_10003064 Ga0105240_100030648 289
84 3300009098 Ga0105245_10003480 Ga0105245_1000348012 289
85 3300009101 Ga0105247_10000835 Ga0105247_1000083511 289
86 3300009148 Ga0105243_10004796 Ga0105243_100047963 289
87 3300009174 Ga0105241_10000829 Ga0105241_1000082914 289
88 3300009176 Ga0105242_10001542 Ga0105242_100015423 289
89 3300009177 Ga0105248_10014172 Ga0105248_100141726 289
90 3300009545 Ga0105237_10000190 Ga0105237_1000019061 289
91 3300009551 Ga0105238_10003095 Ga0105238_100030956 289
92 3300009553 Ga0105249_10000986 Ga0105249_1000098611 289
93 3300010375 Ga0105239_10003835 Ga0105239_100038355 289
94 3300011119 Ga0105246_10012204 Ga0105246_100122043 289
95 3300013100 Ga0157373_10006961 Ga0157373_100069613 289
96 3300013102 Ga0157371_10004934 Ga0157371_100049347 289
97 3300013105 Ga0157369_10000161 Ga0157369_1000016184 289
98 3300013296 Ga0157374_10002380 Ga0157374_100023803 289
99 3300013297 Ga0157378_10010750 Ga0157378_100107502 289
100 3300013306 Ga0163162_10007385 Ga0163162_100073857 289
101 3300013307 Ga0157372_10007592 Ga0157372_100075927 289
102 3300013308 Ga0157375_10004227 Ga0157375_1000422710 289
103 3300014325 Ga0163163_10061450 Ga0163163_100614502 289
104 3300014745 Ga0157377_10000141 Ga0157377_1000014113 289
105 3300014968 Ga0157379_10000079 Ga0157379_1000007941 289
106 3300014969 Ga0157376_10001389 Ga0157376_1000138911 289
107 3300025315 Ga0207697_10058552 Ga0207697_100585522 289
108 3300025321 Ga0207656_10001575 Ga0207656_100015752 289
109 3300025893 Ga0207682_10000319 Ga0207682_1000031917 289
110 3300025900 Ga0207710_10005587 Ga0207710_100055873 289
111 3300025901 Ga0207688_10000015 Ga0207688_1000001544 289
112 3300025903 Ga0207680_10002258 Ga0207680_100022583 289
113 3300025904 Ga0207647_10004455 Ga0207647_100044552 289
114 3300025907 Ga0207645_10000025 Ga0207645_1000002575 289
115 3300025908 Ga0207643_10000023 Ga0207643_1000002382 289
116 3300025909 Ga0207705_10019245 Ga0207705_100192453 289
117 3300025910 Ga0207684_10011436 Ga0207684_100114367 289
118 3300025911 Ga0207654_10005498 Ga0207654_100054982 289
119 3300025913 Ga0207695_10017104 Ga0207695_100171043 289
120 3300025914 Ga0207671_10045493 Ga0207671_100454933 289
121 3300025917 Ga0207660_10041423 Ga0207660_100414233 289
122 3300025918 Ga0207662_10000346 Ga0207662_1000034613 289
123 3300025919 Ga0207657_10000067 Ga0207657_1000006774 289
124 3300025920 Ga0207649_10004571 Ga0207649_100045713 289
125 3300025923 Ga0207681_10004137 Ga0207681_100041377 289
126 3300025924 Ga0207694_10003230 Ga0207694_100032309 289
127 3300025925 Ga0207650_10000147 Ga0207650_100001473 289
128 3300025926 Ga0207659_10003682 Ga0207659_100036823 289
129 3300025927 Ga0207687_10002309 Ga0207687_100023092 289
130 3300025931 Ga0207644_10001339 Ga0207644_1000133913 289
131 3300025933 Ga0207706_10000119 Ga0207706_1000011961 289
132 3300025935 Ga0207709_10019553 Ga0207709_100195532 289
133 3300025936 Ga0207670_10000100 Ga0207670_100001003 289
134 3300025937 Ga0207669_10006044 Ga0207669_100060444 289
135 3300025938 Ga0207704_10003255 Ga0207704_100032555 289
136 3300025940 Ga0207691_10000079 Ga0207691_1000007917 289
137 3300025941 Ga0207711_10000189 Ga0207711_1000018960 289
138 3300025942 Ga0207689_10001164 Ga0207689_1000116417 289
139 3300025944 Ga0207661_10003663 Ga0207661_100036637 289
140 3300025945 Ga0207679_10001426 Ga0207679_1000142612 289
141 3300025949 Ga0207667_10113926 Ga0207667_101139263 289
142 3300025960 Ga0207651_10002161 Ga0207651_100021616 289
143 3300025961 Ga0207712_10000157 Ga0207712_1000015760 289
144 3300025972 Ga0207668_10004328 Ga0207668_100043283 289
145 3300025986 Ga0207658_10000885 Ga0207658_100008858 289
146 3300026023 Ga0207677_10000113 Ga0207677_1000011360 289
147 3300026035 Ga0207703_10002397 Ga0207703_1000239713 289
148 3300026041 Ga0207639_10095516 Ga0207639_100955162 289
149 3300026067 Ga0207678_10004616 Ga0207678_1000461610 289
150 3300026075 Ga0207708_10052922 Ga0207708_100529223 289
151 3300026078 Ga0207702_10030569 Ga0207702_100305693 289
152 3300026088 Ga0207641_10009975 Ga0207641_100099756 289
153 3300026089 Ga0207648_10000095 Ga0207648_1000009517 289
154 3300026095 Ga0207676_10005002 Ga0207676_100050023 289
155 3300026116 Ga0207674_10001904 Ga0207674_1000190417 289
156 3300026118 Ga0207675_100001269 Ga0207675_10000126917 289
157 3300026121 Ga0207683_10000050 Ga0207683_100000508 289
158 3300026142 Ga0207698_10007847 Ga0207698_100078476 289
159 3300028379 Ga0268266_10000415 Ga0268266_100004153 289
160 3300028380 Ga0268265_10005984 Ga0268265_100059846 289
161 3300028381 Ga0268264_10001060 Ga0268264_1000106011 289
162 3300048905 Ga0496102_0001170 Ga0496102_0001170_10876_11745 289
163 3300048906 Ga0496103_0115093 Ga0496103_0115093_506_1375 289
164 3300048909 Ga0496106_0005729 Ga0496106_0005729_781_1650 289
165 3300048910 Ga0496107_0014757 Ga0496107_0014757_486_1355 289
166 3300048912 Ga0496109_0087463 Ga0496109_0087463_1393_2262 289
167 3300049587 Ga0501071_0042738 Ga0501071_0042738_17_886 289
168 iso_pu_bacteria 8056131705 8056134875 289
169 3300053146 Ga0500588_0004769 Ga0500588_0004769_365_1240 290
170 iso_pu_bacteria 2600255283 2601624244 290
171 3300053103 Ga0500555_040490 Ga0500555_040490_363_1244 291
172 iso_pu_bacteria 2929189879 2929192428 291
173 3300005331 Ga0070670_100000416 Ga0070670_10000041625 292
174 3300005985 Ga0081539_10004590 Ga0081539_1000459010 292
175 3300006178 Ga0075367_10263020 Ga0075367_102630201 292
176 3300025302 Ga0207426_1060307 Ga0207426_10603072 292
177 3300025925 Ga0207650_10001599 Ga0207650_1000159914 292
178 3300050507 nmdc:mga05p37_76650_c1 nmdc:mga05p37_76650_c1_2063_2944 292
179 3300050508 nmdc:mga09592_368921_c1 nmdc:mga09592_368921_c1_296_1177 292
180 3300050510 nmdc:mga06r32_43096_c1 nmdc:mga06r32_43096_c1_1363_2244 292
181 iso_pu_bacteria 2826581358 2826585619 292
182 iso_pu_bacteria 2842815866 2842818477 292
183 iso_pu_bacteria 2842849001 2842853178 292
184 3300005471 Ga0070698_100171866 Ga0070698_1001718661 293
185 3300009094 Ga0111539_10015198 Ga0111539_100151982 293
186 3300009094 Ga0111539_10019377 Ga0111539_100193775 293
187 3300025960 Ga0207651_10279801 Ga0207651_102798011 293
188 3300031731 Ga0307405_10035526 Ga0307405_100355263 293
189 3300046471 Ga0495650_0007708 Ga0495650_0007708_4994_5875 293
190 3300046474 Ga0495605_0002430 Ga0495605_0002430_6964_7845 293
191 3300046492 Ga0495585_0083781 Ga0495585_0083781_368_1249 293
192 3300046500 Ga0495596_0000793 Ga0495596_0000793_10266_11147 293
193 3300046501 Ga0495607_0021489 Ga0495607_0021489_1395_2276 293
194 3300046507 Ga0495606_0004740 Ga0495606_0004740_1904_2785 293
195 3300046512 Ga0495610_0000840 Ga0495610_0000840_5903_6784 293
196 3300046515 Ga0495620_0031535 Ga0495620_0031535_419_1300 293
197 3300046519 Ga0495632_0000492 Ga0495632_0000492_17337_18218 293
198 3300046524 Ga0495648_0000236 Ga0495648_0000236_9582_10463 293
199 3300046530 Ga0495654_0001535 Ga0495654_0001535_13971_14852 293
200 3300046538 Ga0495609_0000214 Ga0495609_0000214_473_1354 293
201 3300046660 Ga0495625_0000242 Ga0495625_0000242_2030_2911 293
202 3300046665 Ga0495661_0038071 Ga0495661_0038071_2022_2903 293
203 3300046692 Ga0495671_0009897 Ga0495671_0009897_2274_3155 293
204 3300046810 Ga0495660_0000353 Ga0495660_0000353_37592_38473 293
205 3300046810 Ga0495660_0029994 Ga0495660_0029994_341_1222 293
206 3300047443 Ga0495687_040316 Ga0495687_040316_657_1679 293
207 3300047446 Ga0495679_004826 Ga0495679_004826_3370_4251 293
208 3300048091 Ga0495626_0000010 Ga0495626_0000010_236140_237021 293
209 3300049570 Ga0501033_0167467 Ga0501033_0167467_403_1299 293
210 3300049574 Ga0501038_0325005 Ga0501038_0325005_283_1179 293
211 3300049576 Ga0501040_0046212 Ga0501040_0046212_1225_2121 293
212 3300049578 Ga0501042_0057975 Ga0501042_0057975_141_1037 293
213 3300049580 Ga0501046_0010569 Ga0501046_0010569_2995_3891 293
214 3300049582 Ga0501048_0288750 Ga0501048_0288750_67_963 293
215 3300049588 Ga0501072_0076321 Ga0501072_0076321_1375_2271 293
216 3300049591 Ga0501075_0004477 Ga0501075_0004477_1011_1907 293
217 3300049592 Ga0501076_0000949 Ga0501076_0000949_14972_15868 293
218 3300049593 Ga0501077_0002556 Ga0501077_0002556_2662_3558 293
219 3300049741 Ga0501079_0025494 Ga0501079_0025494_2369_3265 293
220 3300049742 Ga0501080_0050722 Ga0501080_0050722_2745_3641 293
221 3300049743 Ga0501081_0012354 Ga0501081_0012354_3065_3961 293
222 3300049744 Ga0501083_0056039 Ga0501083_0056039_188_1084 293
223 3300050511 nmdc:mga08y16_6961_c1 nmdc:mga08y16_6961_c1_2519_3400 293
224 3300054114 Ga0501084_0013285 Ga0501084_0013285_3436_4332 293
225 3300060353 Ga0501082_0002686 Ga0501082_0002686_13092_13988 293
226 3300061734 Ga0530510_0003767 Ga0530510_0003767_7787_8683 293
227 3300005445 Ga0070708_100012168 Ga0070708_1000121682 294
228 3300005467 Ga0070706_100066157 Ga0070706_1000661572 294
229 3300005468 Ga0070707_100192068 Ga0070707_1001920682 294
230 3300005536 Ga0070697_100176231 Ga0070697_1001762311 294
231 3300006844 Ga0075428_100168635 Ga0075428_1001686352 294
232 3300006852 Ga0075433_10007389 Ga0075433_100073895 294
233 3300006871 Ga0075434_100017537 Ga0075434_1000175375 294
234 3300006880 Ga0075429_100005732 Ga0075429_1000057328 294
235 3300006880 Ga0075429_100031959 Ga0075429_1000319596 294
236 3300006914 Ga0075436_100047351 Ga0075436_1000473512 294
237 3300007076 Ga0075435_100019967 Ga0075435_1000199674 294
238 3300009094 Ga0111539_10014556 Ga0111539_1001455612 294
239 3300009147 Ga0114129_10046663 Ga0114129_100466632 294
240 3300009553 Ga0105249_10161751 Ga0105249_101617512 294
241 3300025254 Ga0209148_1000377 Ga0209148_100037718 294
242 3300025272 Ga0209455_1000299 Ga0209455_100029942 294
243 3300025728 Ga0207655_1001301 Ga0207655_100130122 294
244 3300025910 Ga0207684_10047516 Ga0207684_100475161 294
245 3300025922 Ga0207646_10448973 Ga0207646_104489731 294
246 3300025961 Ga0207712_10048663 Ga0207712_100486631 294
247 3300028800 Ga0265338_10009743 Ga0265338_100097435 294
248 3300035172 Ga0373955_0302225 Ga0373955_0302225_39_929 294
249 3300035692 Ga0373935_0047600 Ga0373935_0047600_111_1001 294
250 3300035695 Ga0373927_0146796 Ga0373927_0146796_72_962 294
251 3300035725 Ga0373947_0038381 Ga0373947_0038381_1815_2705 294
252 3300036401 Ga0373937_0094562 Ga0373937_0094562_499_1389 294
253 3300037068 Ga0373925_0076960 Ga0373925_0076960_1549_2439 294
254 3300041405 Ga0439438_000491 Ga0439438_000491_13480_14418 294
255 3300041407 Ga0439447_013158 Ga0439447_013158_1255_2295 294
256 3300041411 Ga0439466_0020609 Ga0439466_0020609_1385_2323 294
257 3300042185 Ga0450909_006935 Ga0450909_006935_521_1444 294
258 3300045051 Ga0451576_0128687 Ga0451576_0128687_1456_2340 294
259 3300046472 Ga0495580_0002649 Ga0495580_0002649_1933_2823 294
260 3300046501 Ga0495607_0000224 Ga0495607_0000224_49471_50358 294
261 3300046615 Ga0495656_0009485 Ga0495656_0009485_1085_1975 294
262 3300047319 Ga0495674_0088530 Ga0495674_0088530_1060_1950 294
263 3300047323 Ga0495683_0000014 Ga0495683_0000014_150519_151550 294
264 3300047471 Ga0495684_0350920 Ga0495684_0350920_86_976 294
265 3300050507 nmdc:mga05p37_32968_c1 nmdc:mga05p37_32968_c1_2340_3254 294
266 3300050508 nmdc:mga09592_2326_c1 nmdc:mga09592_2326_c1_1229_2143 294
267 3300050511 nmdc:mga08y16_6236_c1 nmdc:mga08y16_6236_c1_2793_3683 294
268 3300050511 nmdc:mga08y16_65497_c1 nmdc:mga08y16_65497_c1_2232_3122 294
269 3300050512 nmdc:mga0n895_20267_c1 nmdc:mga0n895_20267_c1_1374_2285 294
270 3300050513 nmdc:mga0rr50_351000_c1 nmdc:mga0rr50_351000_c1_336_1226 294
271 3300050513 nmdc:mga0rr50_37999_c1 nmdc:mga0rr50_37999_c1_2308_3222 294
272 3300050514 nmdc:mga08x19_59413_c1 nmdc:mga08x19_59413_c1_616_1527 294
273 3300050515 nmdc:mga0a205_1366_c1 nmdc:mga0a205_1366_c1_17234_18148 294
274 3300050515 nmdc:mga0a205_77333_c1 nmdc:mga0a205_77333_c1_1435_2349 294
275 3300053092 Ga0500583_0003828 Ga0500583_0003828_907_1791 294
276 3300005288 Ga0065714_10002262 Ga0065714_1000226235 295
277 3300005288 Ga0065714_10004999 Ga0065714_100049992 295
278 3300005455 Ga0070663_100234191 Ga0070663_1002341912 295
279 3300005468 Ga0070707_100128149 Ga0070707_1001281493 295
280 3300005471 Ga0070698_100005483 Ga0070698_1000054836 295
281 3300005536 Ga0070697_100083531 Ga0070697_1000835311 295
282 3300005617 Ga0068859_100609995 Ga0068859_1006099951 295
283 3300006028 Ga0070717_10616999 Ga0070717_106169991 295
284 3300006844 Ga0075428_100097377 Ga0075428_1000973773 295
285 3300006871 Ga0075434_100147280 Ga0075434_1001472802 295
286 3300006931 Ga0097620_100610023 Ga0097620_1006100231 295
287 3300009011 Ga0105251_10014606 Ga0105251_100146065 295
288 3300009036 Ga0105244_10044419 Ga0105244_100444191 295
289 3300009147 Ga0114129_10344929 Ga0114129_103449292 295
290 3300013102 Ga0157371_10203782 Ga0157371_102037821 295
291 3300014325 Ga0163163_10406509 Ga0163163_104065092 295
292 3300014497 Ga0182008_10024635 Ga0182008_100246352 295
293 3300021384 Ga0213876_10020279 Ga0213876_100202793 295
294 3300021384 Ga0213876_10039609 Ga0213876_100396093 295
295 3300021384 Ga0213876_10039761 Ga0213876_100397612 295
296 3300025728 Ga0207655_1000285 Ga0207655_100028583 295
297 3300025735 Ga0207713_1028623 Ga0207713_10286231 295
298 3300025922 Ga0207646_10001835 Ga0207646_100018353 295
299 3300025939 Ga0207665_10057232 Ga0207665_100572322 295
300 3300027614 Ga0209970_1006384 Ga0209970_10063842 295
301 3300027665 Ga0209983_1000121 Ga0209983_10001214 295
302 3300027682 Ga0209971_1000070 Ga0209971_100007028 295
303 3300027695 Ga0209966_1000042 Ga0209966_10000428 295
304 3300027717 Ga0209998_10000127 Ga0209998_100001272 295
305 3300028380 Ga0268265_10006904 Ga0268265_100069047 295
306 3300037068 Ga0373925_0206700 Ga0373925_0206700_11_913 295
307 3300039437 Ga0436365_0628342 Ga0436365_0628342_7894_8784 295
308 3300042876 Ga0451577_0025297 Ga0451577_0025297_3056_3946 295
309 3300042876 Ga0451577_0087727 Ga0451577_0087727_181_1083 295
310 3300044673 Ga0453683_0094466 Ga0453683_0094466_806_1696 295
311 3300045051 Ga0451576_0002155 Ga0451576_0002155_17338_18240 295
312 3300045051 Ga0451576_0036547 Ga0451576_0036547_1338_2240 295
313 3300045051 Ga0451576_0139484 Ga0451576_0139484_120_1010 295
314 3300045976 Ga0466967_0429485 Ga0466967_0429485_117_1007 295
315 3300046472 Ga0495580_0086230 Ga0495580_0086230_803_1693 295
316 3300046501 Ga0495607_0000094 Ga0495607_0000094_79729_80625 295
317 3300046501 Ga0495607_0000530 Ga0495607_0000530_21904_22800 295
318 3300046515 Ga0495620_0000181 Ga0495620_0000181_820_1716 295
319 3300046519 Ga0495632_0000022 Ga0495632_0000022_63616_64542 295
320 3300048909 Ga0496106_0238036 Ga0496106_0238036_244_1164 295
321 3300048910 Ga0496107_0013880 Ga0496107_0013880_2517_3437 295
322 3300048911 Ga0496108_0062730 Ga0496108_0062730_61_981 295
323 3300048912 Ga0496109_0031366 Ga0496109_0031366_945_1865 295
324 3300048913 Ga0496110_0012626 Ga0496110_0012626_2062_2982 295
325 3300048915 Ga0496112_0000706 Ga0496112_0000706_19077_19997 295
326 3300048918 Ga0496115_0078325 Ga0496115_0078325_988_1908 295
327 3300048924 Ga0496121_0004122 Ga0496121_0004122_2984_3877 295
328 3300049460 Ga0495682_0000169 Ga0495682_0000169_6772_7668 295
329 3300049571 Ga0501034_0535495 Ga0501034_0535495_79_969 295
330 3300049581 Ga0501047_0292641 Ga0501047_0292641_464_1354 295
331 3300050514 nmdc:mga08x19_116436_c1 nmdc:mga08x19_116436_c1_35_922 295
332 iso_pu_bacteria 2554235341 2555671107 295
333 iso_pu_bacteria 2599185160 2599358406 295
334 iso_pu_bacteria 2599185161 2599364724 295
335 iso_pu_bacteria 2599185162 2599371045 295
336 iso_pu_bacteria 2599185163 2599377444 295
337 iso_pu_bacteria 2599185164 2599383751 295
338 iso_pu_bacteria 2599185165 2599390018 295
339 iso_pu_bacteria 2599185166 2599396298 295
340 iso_pu_bacteria 2599185168 2599408485 295
341 iso_pu_bacteria 2599185181 2599465400 295
342 iso_pu_bacteria 2599185182 2599471707 295
343 iso_pu_bacteria 2599185186 2599494244 295
344 iso_pu_bacteria 2599185356 2600211634 295
345 iso_pu_bacteria 2600255313 2601771770 295
346 iso_pu_bacteria 2667528171 2671100924 295
347 iso_pu_bacteria 2818991464 2819705933 295
348 iso_pu_bacteria 2844665904 2844671657 295
349 iso_pu_bacteria 2917070673 2917074967 295
350 iso_pu_bacteria 2935353572 2935355045 295
351 iso_pu_bacteria 637000220 637321441 295
352 2162886011 MRS1b_contig_2248537 MRS1b_0876.00002390 296
353 3300002737 JGI25162J39368_1000081 JGI25162J39368_100008144 296
354 3300002771 JGI25163J39215_1000016 JGI25163J39215_100001627 296
355 3300002772 JGI25164J39214_1000060 JGI25164J39214_100006039 296
356 3300003187 JGI25151J46595_10001299 JGI25151J46595_1000129913 296
357 3300003187 JGI25151J46595_10006332 JGI25151J46595_100063322 296
358 3300003214 JGI25165J46597_1000153 JGI25165J46597_100015339 296
359 3300003911 JGI25405J52794_10002968 JGI25405J52794_100029682 296
360 3300005290 Ga0065712_10068085 Ga0065712_100680859 296
361 3300005344 Ga0070661_100248960 Ga0070661_1002489602 296
362 3300005439 Ga0070711_100014026 Ga0070711_1000140264 296
363 3300005468 Ga0070707_100001008 Ga0070707_10000100829 296
364 3300005577 Ga0068857_100494925 Ga0068857_1004949251 296
365 3300005578 Ga0068854_100188563 Ga0068854_1001885632 296
366 3300005843 Ga0068860_100507068 Ga0068860_1005070681 296
367 3300005937 Ga0081455_10110772 Ga0081455_101107722 296
368 3300005981 Ga0081538_10046818 Ga0081538_100468182 296
369 3300006353 Ga0075370_10021067 Ga0075370_100210675 296
370 3300006353 Ga0075370_10024243 Ga0075370_100242434 296
371 3300006844 Ga0075428_100259600 Ga0075428_1002596002 296
372 3300006844 Ga0075428_100444670 Ga0075428_1004446701 296
373 3300006847 Ga0075431_100056035 Ga0075431_1000560355 296
374 3300006871 Ga0075434_100109807 Ga0075434_1001098072 296
375 3300006880 Ga0075429_100011692 Ga0075429_1000116928 296
376 3300009036 Ga0105244_10001757 Ga0105244_1000175715 296
377 3300009147 Ga0114129_10260107 Ga0114129_102601072 296
378 3300009147 Ga0114129_10287093 Ga0114129_102870932 296
379 3300009148 Ga0105243_10000310 Ga0105243_1000031011 296
380 3300009148 Ga0105243_10003726 Ga0105243_1000372611 296
381 3300009148 Ga0105243_10043712 Ga0105243_100437122 296
382 3300009551 Ga0105238_10105833 Ga0105238_101058332 296
383 3300009551 Ga0105238_10271615 Ga0105238_102716153 296
384 3300011119 Ga0105246_10171990 Ga0105246_101719902 296
385 3300013102 Ga0157371_10000264 Ga0157371_1000026440 296
386 3300013306 Ga0163162_10144033 Ga0163162_101440332 296
387 3300013306 Ga0163162_10184906 Ga0163162_101849065 296
388 3300013308 Ga0157375_10200441 Ga0157375_102004411 296
389 3300014497 Ga0182008_10000050 Ga0182008_1000005039 296
390 3300014497 Ga0182008_10003128 Ga0182008_100031282 296
391 3300015261 Ga0182006_1002944 Ga0182006_10029442 296
392 3300015262 Ga0182007_10000383 Ga0182007_100003832 296
393 3300025207 Ga0209760_100041 Ga0209760_10004139 296
394 3300025231 Ga0207427_100104 Ga0207427_10010447 296
395 3300025233 Ga0209437_100348 Ga0209437_10034810 296
396 3300025258 Ga0209129_1004420 Ga0209129_10044202 296
397 3300025261 Ga0209233_1000202 Ga0209233_100020247 296
398 3300025294 Ga0209025_1000244 Ga0209025_10002442 296
399 3300025294 Ga0209025_1001083 Ga0209025_100108334 296
400 3300025728 Ga0207655_1009652 Ga0207655_10096522 296
401 3300025916 Ga0207663_10005937 Ga0207663_100059375 296
402 3300025919 Ga0207657_10137903 Ga0207657_101379032 296
403 3300025920 Ga0207649_10210596 Ga0207649_102105962 296
404 3300025922 Ga0207646_10006933 Ga0207646_100069334 296
405 3300025935 Ga0207709_10000280 Ga0207709_1000028033 296
406 3300025935 Ga0207709_10001108 Ga0207709_1000110823 296
407 3300025935 Ga0207709_10025878 Ga0207709_100258785 296
408 3300025945 Ga0207679_10000531 Ga0207679_1000053129 296
409 3300026041 Ga0207639_10093313 Ga0207639_100933132 296
410 3300026067 Ga0207678_10223987 Ga0207678_102239871 296
411 3300026116 Ga0207674_10123837 Ga0207674_101238372 296
412 3300028379 Ga0268266_10087294 Ga0268266_100872943 296
413 3300028381 Ga0268264_10503256 Ga0268264_105032561 296
414 3300041404 Ga0439436_0033840 Ga0439436_0033840_541_1440 296
415 3300046530 Ga0495654_0000923 Ga0495654_0000923_12070_12960 296
416 3300046615 Ga0495656_0003948 Ga0495656_0003948_3512_4414 296
417 3300046810 Ga0495660_0000316 Ga0495660_0000316_34484_35374 296
418 3300047470 Ga0495681_0115295 Ga0495681_0115295_175_1077 296
419 3300048903 Ga0496100_0100141 Ga0496100_0100141_429_1436 296
420 3300048905 Ga0496102_0036346 Ga0496102_0036346_56_979 296
421 3300048909 Ga0496106_0310864 Ga0496106_0310864_77_1084 296
422 3300048919 Ga0496116_0000290 Ga0496116_0000290_39309_40214 296
423 3300048919 Ga0496116_0006174 Ga0496116_0006174_4351_5274 296
424 3300048920 Ga0496117_0005356 Ga0496117_0005356_5526_6431 296
425 3300048920 Ga0496117_0038298 Ga0496117_0038298_361_1284 296
426 3300048921 Ga0496118_0007440 Ga0496118_0007440_7283_8206 296
427 3300048921 Ga0496118_0066631 Ga0496118_0066631_1462_2367 296
428 3300048924 Ga0496121_0000255 Ga0496121_0000255_45318_46223 296
429 3300048924 Ga0496121_0022587 Ga0496121_0022587_3432_4325 296
430 3300048925 Ga0496122_0000654 Ga0496122_0000654_25597_26502 296
431 3300048925 Ga0496122_0102436 Ga0496122_0102436_721_1644 296
432 3300048926 Ga0496123_0000688 Ga0496123_0000688_41251_42156 296
433 3300048927 Ga0496124_0000004 Ga0496124_0000004_551366_552259 296
434 3300048927 Ga0496124_0017153 Ga0496124_0017153_5251_6174 296
435 3300048928 Ga0496125_0016989 Ga0496125_0016989_5555_6478 296
436 3300048928 Ga0496125_0070849 Ga0496125_0070849_545_1450 296
437 3300049572 Ga0501036_0403902 Ga0501036_0403902_207_1106 296
438 3300049582 Ga0501048_0217995 Ga0501048_0217995_335_1234 296
439 3300049588 Ga0501072_0063873 Ga0501072_0063873_1948_2853 296
440 3300049592 Ga0501076_0313858 Ga0501076_0313858_80_979 296
441 3300050493 nmdc:mga0k408_20506_c1 nmdc:mga0k408_20506_c1_2481_3392 296
442 3300050496 nmdc:mga07m45_2016_c1 nmdc:mga07m45_2016_c1_4603_5514 296
443 3300050496 nmdc:mga07m45_3006_c1 nmdc:mga07m45_3006_c1_512_1435 296
444 3300050507 nmdc:mga05p37_12706_c1 nmdc:mga05p37_12706_c1_6833_7753 296
445 3300050507 nmdc:mga05p37_198027_c1 nmdc:mga05p37_198027_c1_830_1729 296
446 3300050507 nmdc:mga05p37_351599_c1 nmdc:mga05p37_351599_c1_523_1425 296
447 3300050507 nmdc:mga05p37_61662_c1 nmdc:mga05p37_61662_c1_2380_3279 296
448 3300050508 nmdc:mga09592_86625_c1 nmdc:mga09592_86625_c1_250_1149 296
449 3300050508 nmdc:mga09592_98997_c1 nmdc:mga09592_98997_c1_1017_1937 296
450 3300050512 nmdc:mga0n895_387825_c1 nmdc:mga0n895_387825_c1_317_1216 296
451 3300050512 nmdc:mga0n895_62203_c1 nmdc:mga0n895_62203_c1_2362_3261 296
452 3300050515 nmdc:mga0a205_202625_c1 nmdc:mga0a205_202625_c1_895_1794 296
453 3300061734 Ga0530510_0020627 Ga0530510_0020627_2188_3093 296
454 3300061734 Ga0530510_0262991 Ga0530510_0262991_315_1214 296
455 iso_pu_bacteria 2513020051 2513230012 296
456 iso_pu_bacteria 2904541872 2904544094 296
457 iso_pu_bacteria 2929160207 2929162346 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

75

334

0.85

PF12146

Hydrolase_4

Serine aminopeptidase, S33

73

334

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

77

340

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9657 2 290
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.94 2 290
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8877 1 123
4bat-assembly1.cif.gz_A-2 structure of a putative epoxide hydrolase t131d mutant from pseudomonas aeruginosa. 0.8578 1 292
4b9a-assembly1.cif.gz_A structure of a putative epoxide hydrolase from pseudomonas aeruginosa. 0.8552 1 292
ID Description Score Start End Superfamily
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.965 2 290 3.40.50.1820
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.933 2 290 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8744 10 123 3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8734 1 91 3.40.50.12270
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8466 1 296 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1H3G878-F1-model_v4 Alpha/beta hydrolase fold 1.002 3 99 GO:0016787
AF-A0A352SAJ5-F1-model_v4 Alpha/beta hydrolase 0.9954 1 115 GO:0016020
GO:0046464
GO:0047372
AF-A0A563EMW7-F1-model_v4 Alpha/beta hydrolase 0.9905 1 97 GO:0016787
AF-A0A520HLZ4-F1-model_v4 Alpha/beta hydrolase 0.9904 1 226 GO:0016020
GO:0016787
AF-A0A366KLG2-F1-model_v4 Alpha/beta hydrolase 0.99 1 290 GO:0016020
GO:0046464
GO:0047372

Feature Viewer

pLDDT pTM Quality
96.44 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map