F448030
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 457 | 331 | 421 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300041407|Ga0439447_013158|Ga0439447_013158_1255_2295 |
| Length | 346 |
| Sequence | MPESFPGPLAVRWRRFRAGRFSLLMEGEVIDSLSMGLFFLVRLSIAGAMQEGMMKTVKAGVLEIAYLEIGPVDGAPVVLLHGFPYDVHAYDEVARILASAGKRCLTPYLRGYGPTRFLDEQTMRSGEQAAIGADLLAFLDALKIEKALLAGYDWGGRAACIVAALWPERVSGLVSCGGYSIQNIAEAHQPASPEAEHLLWYQYYLHGSRGRAGLTSNRKDFCRLLWRMWSPTWRFTQEAFETTAAAFENDDFVDVVTHSYRHRFGLVEGDPAYRNIESRLAAQPRIAVPSLVLEGGADAVDPPAEEDPFARHFTGPYRREILEGIGHNVPQEAPGTFADGILSLGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 4 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 5 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 6 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 7 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 8 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 9 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 10 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 11 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 12 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 13 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 14 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 15 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 16 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 17 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 18 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 19 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 20 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 21 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 22 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 23 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 24 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 25 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 26 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 27 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 28 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 29 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 30 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 31 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 32 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 33 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 34 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 35 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 36 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 37 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 38 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 41 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 42 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 239 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 240 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 243 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 244 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 325 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 331 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.12 |
| Metatranscriptomes | 0 |
| Isolates | 7.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.47 |
| Nodule | 0 |
| Rhizoplane | 6.78 |
| Rhizosphere | 80.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2248537 | 2162886011 | Bacteria | 6522 |
| 2 | JGI24742J22300_10022576 | 3300002244 | Bacteria | 1079 |
| 3 | JGI25162J39368_1000081 | 3300002737 | Bacteria | 113016 |
| 4 | JGI25163J39215_1000016 | 3300002771 | Bacteria | 82638 |
| 5 | JGI25164J39214_1000060 | 3300002772 | Bacteria | 110667 |
| 6 | JGI25151J46595_10001299 | 3300003187 | Bacteria | 17505 |
| 7 | JGI25151J46595_10006332 | 3300003187 | Bacteria | 5964 |
| 8 | JGI25165J46597_1000153 | 3300003214 | Bacteria | 113016 |
| 9 | JGI25405J52794_10002968 | 3300003911 | Bacteria | 2948 |
| 10 | Ga0065714_10002262 | 3300005288 | Bacteria | 35666 |
| 11 | Ga0065714_10004999 | 3300005288 | Bacteria | 6542 |
| 12 | Ga0065712_10068085 | 3300005290 | Bacteria | 15225 |
| 13 | Ga0070658_10001588 | 3300005327 | Bacteria | 19209 |
| 14 | Ga0070676_10000290 | 3300005328 | Bacteria | 22266 |
| 15 | Ga0070683_100001772 | 3300005329 | Bacteria | 16802 |
| 16 | Ga0070690_100155005 | 3300005330 | Bacteria | 1565 |
| 17 | Ga0070670_100000416 | 3300005331 | Bacteria | 35091 |
| 18 | Ga0070670_100071138 | 3300005331 | Bacteria | 2986 |
| 19 | Ga0070677_10003248 | 3300005333 | Bacteria | 5236 |
| 20 | Ga0068869_100001632 | 3300005334 | Bacteria | 13367 |
| 21 | Ga0070680_100128895 | 3300005336 | Bacteria | 2115 |
| 22 | Ga0068868_100038076 | 3300005338 | Bacteria | 3732 |
| 23 | Ga0070660_100000052 | 3300005339 | Bacteria | 68022 |
| 24 | Ga0070689_100001678 | 3300005340 | Bacteria | 14140 |
| 25 | Ga0070687_100000134 | 3300005343 | Bacteria | 25638 |
| 26 | Ga0070661_100007867 | 3300005344 | Bacteria | 7359 |
| 27 | Ga0070661_100248960 | 3300005344 | Bacteria | 1371 |
| 28 | Ga0070692_10015776 | 3300005345 | Bacteria | 3580 |
| 29 | Ga0070669_100065038 | 3300005353 | Bacteria | 2686 |
| 30 | Ga0070675_100002647 | 3300005354 | Bacteria | 13454 |
| 31 | Ga0070671_100006839 | 3300005355 | Bacteria | 9128 |
| 32 | Ga0070674_100002955 | 3300005356 | Bacteria | 9429 |
| 33 | Ga0070688_100000725 | 3300005365 | Bacteria | 16228 |
| 34 | Ga0070659_100000813 | 3300005366 | Bacteria | 22774 |
| 35 | Ga0070667_100147225 | 3300005367 | Bacteria | 2066 |
| 36 | Ga0070714_100172911 | 3300005435 | Bacteria | 1961 |
| 37 | Ga0070713_100242713 | 3300005436 | Bacteria | 1641 |
| 38 | Ga0070710_10103857 | 3300005437 | Bacteria | 1697 |
| 39 | Ga0070701_10031866 | 3300005438 | Bacteria | 2619 |
| 40 | Ga0070711_100014026 | 3300005439 | Bacteria | 5042 |
| 41 | Ga0070711_100077928 | 3300005439 | Bacteria | 2353 |
| 42 | Ga0070705_100011223 | 3300005440 | Bacteria | 4513 |
| 43 | Ga0070708_100012168 | 3300005445 | Bacteria | 7014 |
| 44 | Ga0070663_100000805 | 3300005455 | Bacteria | 17079 |
| 45 | Ga0070663_100234191 | 3300005455 | Bacteria | 1447 |
| 46 | Ga0070678_100007114 | 3300005456 | Bacteria | 6619 |
| 47 | Ga0070662_100000701 | 3300005457 | Bacteria | 20526 |
| 48 | Ga0070685_10000949 | 3300005466 | Bacteria | 15589 |
| 49 | Ga0070706_100060343 | 3300005467 | Bacteria | 3501 |
| 50 | Ga0070706_100066157 | 3300005467 | Bacteria | 3343 |
| 51 | Ga0070707_100001008 | 3300005468 | Bacteria | 27893 |
| 52 | Ga0070707_100128149 | 3300005468 | Bacteria | 2466 |
| 53 | Ga0070707_100192068 | 3300005468 | Bacteria | 1991 |
| 54 | Ga0070698_100005483 | 3300005471 | Bacteria | 13852 |
| 55 | Ga0070698_100171866 | 3300005471 | Unclassified | 2108 |
| 56 | Ga0070684_100002455 | 3300005535 | Bacteria | 13652 |
| 57 | Ga0070697_100083531 | 3300005536 | Bacteria | 2634 |
| 58 | Ga0070697_100176231 | 3300005536 | Bacteria | 1811 |
| 59 | Ga0070697_100196606 | 3300005536 | Bacteria | 1713 |
| 60 | Ga0068853_100000288 | 3300005539 | Bacteria | 35623 |
| 61 | Ga0070672_100001812 | 3300005543 | Bacteria | 13346 |
| 62 | Ga0070686_100010839 | 3300005544 | Bacteria | 5155 |
| 63 | Ga0070695_100009656 | 3300005545 | Bacteria | 5746 |
| 64 | Ga0070696_100007067 | 3300005546 | Bacteria | 7496 |
| 65 | Ga0068855_100000202 | 3300005563 | Bacteria | 76682 |
| 66 | Ga0070664_100000880 | 3300005564 | Bacteria | 23311 |
| 67 | Ga0068857_100007319 | 3300005577 | Bacteria | 9508 |
| 68 | Ga0068857_100494925 | 3300005577 | Bacteria | 1147 |
| 69 | Ga0068854_100000406 | 3300005578 | Bacteria | 27042 |
| 70 | Ga0068854_100188563 | 3300005578 | Bacteria | 1615 |
| 71 | Ga0068856_100003305 | 3300005614 | Bacteria | 16389 |
| 72 | Ga0068852_100001778 | 3300005616 | Bacteria | 14653 |
| 73 | Ga0068859_100609995 | 3300005617 | Unclassified | 1184 |
| 74 | Ga0068866_10000446 | 3300005718 | Bacteria | 19086 |
| 75 | Ga0068861_100005061 | 3300005719 | Bacteria | 8894 |
| 76 | Ga0068851_10000065 | 3300005834 | Bacteria | 58958 |
| 77 | Ga0068870_10000197 | 3300005840 | Bacteria | 21559 |
| 78 | Ga0068863_100030495 | 3300005841 | Bacteria | 5148 |
| 79 | Ga0068858_100288631 | 3300005842 | Bacteria | 1563 |
| 80 | Ga0068860_100507068 | 3300005843 | Bacteria | 1205 |
| 81 | Ga0068862_100082740 | 3300005844 | Bacteria | 2786 |
| 82 | Ga0081455_10110772 | 3300005937 | Bacteria | 2182 |
| 83 | Ga0081538_10046818 | 3300005981 | Bacteria | 2661 |
| 84 | Ga0081540_1001798 | 3300005983 | Bacteria | 17972 |
| 85 | Ga0081539_10004590 | 3300005985 | Bacteria | 15078 |
| 86 | Ga0070717_10284254 | 3300006028 | Bacteria | 1468 |
| 87 | Ga0070717_10616999 | 3300006028 | Bacteria | 984 |
| 88 | Ga0070712_100002146 | 3300006175 | Bacteria | 12130 |
| 89 | Ga0070712_100263572 | 3300006175 | Bacteria | 1382 |
| 90 | Ga0070712_100300268 | 3300006175 | Bacteria | 1299 |
| 91 | Ga0075367_10263020 | 3300006178 | Bacteria | 1083 |
| 92 | Ga0097621_100000918 | 3300006237 | Bacteria | 20604 |
| 93 | Ga0075370_10021067 | 3300006353 | Bacteria | 3570 |
| 94 | Ga0075370_10024243 | 3300006353 | Bacteria | 3350 |
| 95 | Ga0068871_100001441 | 3300006358 | Bacteria | 15931 |
| 96 | Ga0075428_100097377 | 3300006844 | Unclassified | 3207 |
| 97 | Ga0075428_100168635 | 3300006844 | Bacteria | 2374 |
| 98 | Ga0075428_100259600 | 3300006844 | Bacteria | 1871 |
| 99 | Ga0075428_100444670 | 3300006844 | Bacteria | 1388 |
| 100 | Ga0075431_100056035 | 3300006847 | Bacteria | 4066 |
| 101 | Ga0075433_10007389 | 3300006852 | Bacteria | 8721 |
| 102 | Ga0075434_100017537 | 3300006871 | Bacteria | 6901 |
| 103 | Ga0075434_100109807 | 3300006871 | Bacteria | 2768 |
| 104 | Ga0075434_100147280 | 3300006871 | Bacteria | 2375 |
| 105 | Ga0075429_100005732 | 3300006880 | Bacteria | 10717 |
| 106 | Ga0075429_100011692 | 3300006880 | Bacteria | 7611 |
| 107 | Ga0075429_100031959 | 3300006880 | Bacteria | 4576 |
| 108 | Ga0075436_100047351 | 3300006914 | Bacteria | 2966 |
| 109 | Ga0097620_100610023 | 3300006931 | Unclassified | 1184 |
| 110 | Ga0075435_100016670 | 3300007076 | Bacteria | 5541 |
| 111 | Ga0075435_100019967 | 3300007076 | Bacteria | 5122 |
| 112 | Ga0105251_10014606 | 3300009011 | Bacteria | 4330 |
| 113 | Ga0105244_10001757 | 3300009036 | Bacteria | 17030 |
| 114 | Ga0105244_10044419 | 3300009036 | Bacteria | 2289 |
| 115 | Ga0105240_10003064 | 3300009093 | Bacteria | 26280 |
| 116 | Ga0111539_10014556 | 3300009094 | Bacteria | 9822 |
| 117 | Ga0111539_10015198 | 3300009094 | Bacteria | 9589 |
| 118 | Ga0111539_10019377 | 3300009094 | Bacteria | 8399 |
| 119 | Ga0105245_10003480 | 3300009098 | Bacteria | 14099 |
| 120 | Ga0105247_10000835 | 3300009101 | Bacteria | 23400 |
| 121 | Ga0114129_10046663 | 3300009147 | Bacteria | 6088 |
| 122 | Ga0114129_10260107 | 3300009147 | Unclassified | 2326 |
| 123 | Ga0114129_10287093 | 3300009147 | Bacteria | 2197 |
| 124 | Ga0114129_10344929 | 3300009147 | Unclassified | 1974 |
| 125 | Ga0105243_10000310 | 3300009148 | Bacteria | 53933 |
| 126 | Ga0105243_10003726 | 3300009148 | Bacteria | 12228 |
| 127 | Ga0105243_10004796 | 3300009148 | Bacteria | 10628 |
| 128 | Ga0105243_10043712 | 3300009148 | Bacteria | 3511 |
| 129 | Ga0105241_10000829 | 3300009174 | Bacteria | 23452 |
| 130 | Ga0105242_10001542 | 3300009176 | Bacteria | 18118 |
| 131 | Ga0105248_10014172 | 3300009177 | Bacteria | 8776 |
| 132 | Ga0105237_10000190 | 3300009545 | Bacteria | 87182 |
| 133 | Ga0105238_10003095 | 3300009551 | Bacteria | 16587 |
| 134 | Ga0105238_10105833 | 3300009551 | Bacteria | 2795 |
| 135 | Ga0105238_10271615 | 3300009551 | Bacteria | 1676 |
| 136 | Ga0105249_10000986 | 3300009553 | Bacteria | 25228 |
| 137 | Ga0105249_10161751 | 3300009553 | Bacteria | 2164 |
| 138 | Ga0105239_10003835 | 3300010375 | Bacteria | 18255 |
| 139 | Ga0105246_10012204 | 3300011119 | Bacteria | 5354 |
| 140 | Ga0105246_10171990 | 3300011119 | Bacteria | 1660 |
| 141 | Ga0157373_10006961 | 3300013100 | Bacteria | 8421 |
| 142 | Ga0157371_10000264 | 3300013102 | Bacteria | 71499 |
| 143 | Ga0157371_10004934 | 3300013102 | Bacteria | 11461 |
| 144 | Ga0157371_10203782 | 3300013102 | Bacteria | 1419 |
| 145 | Ga0157369_10000161 | 3300013105 | Bacteria | 94988 |
| 146 | Ga0157374_10002380 | 3300013296 | Bacteria | 15849 |
| 147 | Ga0157378_10010750 | 3300013297 | Bacteria | 8001 |
| 148 | Ga0163162_10007385 | 3300013306 | Bacteria | 10687 |
| 149 | Ga0163162_10144033 | 3300013306 | Bacteria | 2498 |
| 150 | Ga0163162_10184906 | 3300013306 | Bacteria | 2210 |
| 151 | Ga0157372_10007592 | 3300013307 | Bacteria | 11528 |
| 152 | Ga0157375_10004227 | 3300013308 | Bacteria | 12449 |
| 153 | Ga0157375_10200441 | 3300013308 | Bacteria | 2152 |
| 154 | Ga0163163_10061450 | 3300014325 | Bacteria | 3722 |
| 155 | Ga0163163_10406509 | 3300014325 | Bacteria | 1420 |
| 156 | Ga0182008_10000050 | 3300014497 | Bacteria | 103527 |
| 157 | Ga0182008_10003128 | 3300014497 | Bacteria | 10127 |
| 158 | Ga0182008_10024635 | 3300014497 | Bacteria | 3062 |
| 159 | Ga0157377_10000141 | 3300014745 | Bacteria | 45798 |
| 160 | Ga0157379_10000079 | 3300014968 | Bacteria | 63166 |
| 161 | Ga0157376_10001389 | 3300014969 | Bacteria | 15949 |
| 162 | Ga0182006_1002944 | 3300015261 | Bacteria | 9007 |
| 163 | Ga0182007_10000383 | 3300015262 | Bacteria | 27816 |
| 164 | Ga0213876_10020279 | 3300021384 | Bacteria | 3513 |
| 165 | Ga0213876_10039609 | 3300021384 | Bacteria | 2490 |
| 166 | Ga0213876_10039761 | 3300021384 | Bacteria | 2485 |
| 167 | Ga0209760_100041 | 3300025207 | Bacteria | 115995 |
| 168 | Ga0207427_100104 | 3300025231 | Bacteria | 119099 |
| 169 | Ga0209437_100348 | 3300025233 | Bacteria | 54213 |
| 170 | Ga0209148_1000377 | 3300025254 | Bacteria | 54144 |
| 171 | Ga0209129_1004420 | 3300025258 | Bacteria | 5486 |
| 172 | Ga0209233_1000202 | 3300025261 | Bacteria | 119099 |
| 173 | Ga0209455_1000299 | 3300025272 | Bacteria | 51077 |
| 174 | Ga0209025_1000244 | 3300025294 | Bacteria | 127938 |
| 175 | Ga0209025_1001083 | 3300025294 | Bacteria | 39415 |
| 176 | Ga0207426_1060307 | 3300025302 | Bacteria | 1093 |
| 177 | Ga0207697_10058552 | 3300025315 | Bacteria | 1600 |
| 178 | Ga0207656_10001575 | 3300025321 | Bacteria | 7584 |
| 179 | Ga0207655_1000285 | 3300025728 | Bacteria | 77315 |
| 180 | Ga0207655_1001301 | 3300025728 | Bacteria | 23616 |
| 181 | Ga0207655_1009652 | 3300025728 | Bacteria | 5967 |
| 182 | Ga0207713_1028623 | 3300025735 | Bacteria | 2509 |
| 183 | Ga0207682_10000319 | 3300025893 | Bacteria | 21917 |
| 184 | Ga0207710_10005587 | 3300025900 | Bacteria | 5410 |
| 185 | Ga0207688_10000015 | 3300025901 | Bacteria | 57722 |
| 186 | Ga0207680_10002258 | 3300025903 | Bacteria | 8988 |
| 187 | Ga0207647_10004455 | 3300025904 | Bacteria | 10380 |
| 188 | Ga0207699_10206421 | 3300025906 | Bacteria | 1334 |
| 189 | Ga0207645_10000025 | 3300025907 | Bacteria | 98264 |
| 190 | Ga0207643_10000023 | 3300025908 | Bacteria | 104515 |
| 191 | Ga0207705_10019245 | 3300025909 | Bacteria | 4883 |
| 192 | Ga0207684_10011436 | 3300025910 | Bacteria | 7764 |
| 193 | Ga0207684_10047516 | 3300025910 | Bacteria | 3640 |
| 194 | Ga0207654_10005498 | 3300025911 | Bacteria | 6411 |
| 195 | Ga0207695_10017104 | 3300025913 | Bacteria | 8455 |
| 196 | Ga0207671_10045493 | 3300025914 | Bacteria | 3246 |
| 197 | Ga0207693_10002609 | 3300025915 | Bacteria | 15668 |
| 198 | Ga0207693_10106776 | 3300025915 | Bacteria | 2196 |
| 199 | Ga0207693_10470289 | 3300025915 | Bacteria | 982 |
| 200 | Ga0207663_10005937 | 3300025916 | Bacteria | 6198 |
| 201 | Ga0207660_10041423 | 3300025917 | Bacteria | 3227 |
| 202 | Ga0207662_10000346 | 3300025918 | Bacteria | 20992 |
| 203 | Ga0207657_10000067 | 3300025919 | Bacteria | 97934 |
| 204 | Ga0207657_10137903 | 3300025919 | Bacteria | 1995 |
| 205 | Ga0207649_10004571 | 3300025920 | Bacteria | 7508 |
| 206 | Ga0207649_10210596 | 3300025920 | Bacteria | 1379 |
| 207 | Ga0207646_10001835 | 3300025922 | Bacteria | 25670 |
| 208 | Ga0207646_10006933 | 3300025922 | Bacteria | 11629 |
| 209 | Ga0207646_10448973 | 3300025922 | Bacteria | 1163 |
| 210 | Ga0207681_10004137 | 3300025923 | Bacteria | 8998 |
| 211 | Ga0207694_10003230 | 3300025924 | Bacteria | 12989 |
| 212 | Ga0207650_10000147 | 3300025925 | Bacteria | 85501 |
| 213 | Ga0207650_10001599 | 3300025925 | Bacteria | 16169 |
| 214 | Ga0207659_10003682 | 3300025926 | Bacteria | 9240 |
| 215 | Ga0207687_10002309 | 3300025927 | Bacteria | 12983 |
| 216 | Ga0207644_10001339 | 3300025931 | Bacteria | 15822 |
| 217 | Ga0207706_10000119 | 3300025933 | Bacteria | 84681 |
| 218 | Ga0207709_10000280 | 3300025935 | Bacteria | 58638 |
| 219 | Ga0207709_10001108 | 3300025935 | Bacteria | 19734 |
| 220 | Ga0207709_10019553 | 3300025935 | Bacteria | 3811 |
| 221 | Ga0207709_10025878 | 3300025935 | Bacteria | 3364 |
| 222 | Ga0207670_10000100 | 3300025936 | Bacteria | 59919 |
| 223 | Ga0207669_10006044 | 3300025937 | Bacteria | 5494 |
| 224 | Ga0207704_10003255 | 3300025938 | Bacteria | 7366 |
| 225 | Ga0207665_10057232 | 3300025939 | Bacteria | 2633 |
| 226 | Ga0207691_10000079 | 3300025940 | Bacteria | 82300 |
| 227 | Ga0207711_10000189 | 3300025941 | Bacteria | 65922 |
| 228 | Ga0207689_10001164 | 3300025942 | Bacteria | 25319 |
| 229 | Ga0207661_10003663 | 3300025944 | Bacteria | 10706 |
| 230 | Ga0207679_10000531 | 3300025945 | Bacteria | 25768 |
| 231 | Ga0207679_10001426 | 3300025945 | Bacteria | 15043 |
| 232 | Ga0207667_10113926 | 3300025949 | Bacteria | 2788 |
| 233 | Ga0207651_10002161 | 3300025960 | Bacteria | 9301 |
| 234 | Ga0207651_10279801 | 3300025960 | Bacteria | 1378 |
| 235 | Ga0207712_10000157 | 3300025961 | Bacteria | 70058 |
| 236 | Ga0207712_10048663 | 3300025961 | Bacteria | 2950 |
| 237 | Ga0207668_10004328 | 3300025972 | Bacteria | 8336 |
| 238 | Ga0207658_10000885 | 3300025986 | Bacteria | 24958 |
| 239 | Ga0207677_10000113 | 3300026023 | Bacteria | 65880 |
| 240 | Ga0207703_10002397 | 3300026035 | Bacteria | 16297 |
| 241 | Ga0207639_10093313 | 3300026041 | Bacteria | 2414 |
| 242 | Ga0207639_10095516 | 3300026041 | Bacteria | 2389 |
| 243 | Ga0207678_10004616 | 3300026067 | Bacteria | 12376 |
| 244 | Ga0207678_10223987 | 3300026067 | Bacteria | 1610 |
| 245 | Ga0207708_10052922 | 3300026075 | Bacteria | 3092 |
| 246 | Ga0207702_10030569 | 3300026078 | Bacteria | 4487 |
| 247 | Ga0207641_10009975 | 3300026088 | Bacteria | 7815 |
| 248 | Ga0207648_10000095 | 3300026089 | Bacteria | 84340 |
| 249 | Ga0207676_10005002 | 3300026095 | Bacteria | 9387 |
| 250 | Ga0207674_10001904 | 3300026116 | Bacteria | 26535 |
| 251 | Ga0207674_10123837 | 3300026116 | Bacteria | 2551 |
| 252 | Ga0207675_100001269 | 3300026118 | Bacteria | 25244 |
| 253 | Ga0207683_10000050 | 3300026121 | Bacteria | 87435 |
| 254 | Ga0207698_10007847 | 3300026142 | Bacteria | 6712 |
| 255 | Ga0209970_1006384 | 3300027614 | Bacteria | 1933 |
| 256 | Ga0209983_1000121 | 3300027665 | Bacteria | 13836 |
| 257 | Ga0209971_1000070 | 3300027682 | Bacteria | 31653 |
| 258 | Ga0209966_1000042 | 3300027695 | Bacteria | 53500 |
| 259 | Ga0209998_10000127 | 3300027717 | Bacteria | 29842 |
| 260 | Ga0268266_10000415 | 3300028379 | Bacteria | 64982 |
| 261 | Ga0268266_10087294 | 3300028379 | Bacteria | 2729 |
| 262 | Ga0268265_10005984 | 3300028380 | Bacteria | 8278 |
| 263 | Ga0268265_10006904 | 3300028380 | Bacteria | 7680 |
| 264 | Ga0268264_10001060 | 3300028381 | Bacteria | 27306 |
| 265 | Ga0268264_10503256 | 3300028381 | Bacteria | 1182 |
| 266 | Ga0265338_10009743 | 3300028800 | Bacteria | 11397 |
| 267 | Ga0307405_10035526 | 3300031731 | Bacteria | 2977 |
| 268 | Ga0373955_0302225 | 3300035172 | Bacteria | 965 |
| 269 | Ga0373935_0047600 | 3300035692 | Bacteria | 2712 |
| 270 | Ga0373927_0146796 | 3300035695 | Bacteria | 1544 |
| 271 | Ga0373947_0038381 | 3300035725 | Bacteria | 2845 |
| 272 | Ga0373937_0094562 | 3300036401 | Bacteria | 2771 |
| 273 | Ga0373925_0076960 | 3300037068 | Bacteria | 2531 |
| 274 | Ga0373925_0206700 | 3300037068 | Bacteria | 1563 |
| 275 | Ga0436365_0628342 | 3300039437 | Bacteria | 21312 |
| 276 | Ga0436362_1260443 | 3300039453 | Bacteria | 1342 |
| 277 | Ga0439436_0033840 | 3300041404 | Bacteria | 1479 |
| 278 | Ga0439438_000491 | 3300041405 | Bacteria | 17909 |
| 279 | Ga0439447_013158 | 3300041407 | Bacteria | 2354 |
| 280 | Ga0439466_0020609 | 3300041411 | Bacteria | 2348 |
| 281 | Ga0439432_003095 | 3300042006 | Bacteria | 6196 |
| 282 | Ga0450889_005401 | 3300042144 | Bacteria | 1273 |
| 283 | Ga0450909_006935 | 3300042185 | Bacteria | 1634 |
| 284 | Ga0451577_0025297 | 3300042876 | Bacteria | 5388 |
| 285 | Ga0451577_0087727 | 3300042876 | Bacteria | 2775 |
| 286 | Ga0453683_0094466 | 3300044673 | Bacteria | 1875 |
| 287 | Ga0451576_0002155 | 3300045051 | Bacteria | 30466 |
| 288 | Ga0451576_0036547 | 3300045051 | Bacteria | 5205 |
| 289 | Ga0451576_0128687 | 3300045051 | Bacteria | 2639 |
| 290 | Ga0451576_0139484 | 3300045051 | Bacteria | 2529 |
| 291 | Ga0466967_0429485 | 3300045976 | Bacteria | 1289 |
| 292 | Ga0495629_0290505 | 3300046459 | Bacteria | 1121 |
| 293 | Ga0495650_0007708 | 3300046471 | Bacteria | 6414 |
| 294 | Ga0495580_0002649 | 3300046472 | Bacteria | 15549 |
| 295 | Ga0495580_0086230 | 3300046472 | Bacteria | 2187 |
| 296 | Ga0495605_0002430 | 3300046474 | Bacteria | 11518 |
| 297 | Ga0495585_0083781 | 3300046492 | Bacteria | 1725 |
| 298 | Ga0495596_0000793 | 3300046500 | Bacteria | 19224 |
| 299 | Ga0495607_0000094 | 3300046501 | Bacteria | 92515 |
| 300 | Ga0495607_0000224 | 3300046501 | Bacteria | 60214 |
| 301 | Ga0495607_0000530 | 3300046501 | Bacteria | 37462 |
| 302 | Ga0495607_0021489 | 3300046501 | Bacteria | 4060 |
| 303 | Ga0495606_0004740 | 3300046507 | Bacteria | 13395 |
| 304 | Ga0495610_0000840 | 3300046512 | Bacteria | 28602 |
| 305 | Ga0495620_0000181 | 3300046515 | Bacteria | 48918 |
| 306 | Ga0495620_0031535 | 3300046515 | Bacteria | 2428 |
| 307 | Ga0495630_0349274 | 3300046517 | Bacteria | 1132 |
| 308 | Ga0495632_0000022 | 3300046519 | Bacteria | 187045 |
| 309 | Ga0495632_0000492 | 3300046519 | Bacteria | 37278 |
| 310 | Ga0495648_0000236 | 3300046524 | Bacteria | 63182 |
| 311 | Ga0495654_0000923 | 3300046530 | Bacteria | 21856 |
| 312 | Ga0495654_0001535 | 3300046530 | Bacteria | 15672 |
| 313 | Ga0495609_0000214 | 3300046538 | Bacteria | 57759 |
| 314 | Ga0495656_0003948 | 3300046615 | Bacteria | 5035 |
| 315 | Ga0495656_0009485 | 3300046615 | Bacteria | 3500 |
| 316 | Ga0495625_0000242 | 3300046660 | Bacteria | 85764 |
| 317 | Ga0495661_0038071 | 3300046665 | Bacteria | 2999 |
| 318 | Ga0495671_0009897 | 3300046692 | Bacteria | 5305 |
| 319 | Ga0495660_0000316 | 3300046810 | Bacteria | 43536 |
| 320 | Ga0495660_0000353 | 3300046810 | Bacteria | 40596 |
| 321 | Ga0495660_0029994 | 3300046810 | Bacteria | 3065 |
| 322 | Ga0495674_0088530 | 3300047319 | Bacteria | 2648 |
| 323 | Ga0495683_0000014 | 3300047323 | Bacteria | 199398 |
| 324 | Ga0495687_040316 | 3300047443 | Bacteria | 2058 |
| 325 | Ga0495679_004826 | 3300047446 | Bacteria | 6094 |
| 326 | Ga0495681_0115295 | 3300047470 | Bacteria | 1159 |
| 327 | Ga0495684_0350920 | 3300047471 | Bacteria | 1047 |
| 328 | Ga0495626_0000010 | 3300048091 | Bacteria | 270265 |
| 329 | Ga0496100_0100141 | 3300048903 | Bacteria | 1995 |
| 330 | Ga0496102_0001170 | 3300048905 | Bacteria | 23917 |
| 331 | Ga0496102_0036346 | 3300048905 | Bacteria | 4437 |
| 332 | Ga0496103_0115093 | 3300048906 | Bacteria | 1710 |
| 333 | Ga0496106_0005729 | 3300048909 | Bacteria | 9192 |
| 334 | Ga0496106_0238036 | 3300048909 | Bacteria | 1454 |
| 335 | Ga0496106_0310864 | 3300048909 | Bacteria | 1264 |
| 336 | Ga0496107_0013880 | 3300048910 | Bacteria | 5631 |
| 337 | Ga0496107_0014757 | 3300048910 | Bacteria | 5471 |
| 338 | Ga0496108_0062730 | 3300048911 | Bacteria | 3129 |
| 339 | Ga0496109_0031366 | 3300048912 | Bacteria | 4769 |
| 340 | Ga0496109_0087463 | 3300048912 | Bacteria | 2878 |
| 341 | Ga0496110_0012626 | 3300048913 | Bacteria | 6948 |
| 342 | Ga0496112_0000706 | 3300048915 | Bacteria | 23155 |
| 343 | Ga0496115_0078325 | 3300048918 | Bacteria | 2689 |
| 344 | Ga0496116_0000290 | 3300048919 | Bacteria | 85274 |
| 345 | Ga0496116_0006174 | 3300048919 | Bacteria | 10956 |
| 346 | Ga0496117_0005356 | 3300048920 | Bacteria | 13519 |
| 347 | Ga0496117_0038298 | 3300048920 | Bacteria | 3558 |
| 348 | Ga0496118_0007440 | 3300048921 | Bacteria | 11601 |
| 349 | Ga0496118_0066631 | 3300048921 | Bacteria | 2627 |
| 350 | Ga0496121_0000255 | 3300048924 | Bacteria | 113201 |
| 351 | Ga0496121_0004122 | 3300048924 | Bacteria | 19920 |
| 352 | Ga0496121_0022587 | 3300048924 | Bacteria | 6095 |
| 353 | Ga0496122_0000654 | 3300048925 | Bacteria | 69918 |
| 354 | Ga0496122_0102436 | 3300048925 | Bacteria | 1909 |
| 355 | Ga0496123_0000688 | 3300048926 | Bacteria | 55759 |
| 356 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 357 | Ga0496124_0017153 | 3300048927 | Bacteria | 6843 |
| 358 | Ga0496125_0016989 | 3300048928 | Bacteria | 6957 |
| 359 | Ga0496125_0070849 | 3300048928 | Bacteria | 2727 |
| 360 | Ga0495682_0000169 | 3300049460 | Bacteria | 55128 |
| 361 | Ga0501033_0167467 | 3300049570 | Bacteria | 1579 |
| 362 | Ga0501034_0535495 | 3300049571 | Bacteria | 1082 |
| 363 | Ga0501036_0403902 | 3300049572 | Bacteria | 1140 |
| 364 | Ga0501038_0325005 | 3300049574 | Bacteria | 1202 |
| 365 | Ga0501040_0046212 | 3300049576 | Bacteria | 2972 |
| 366 | Ga0501042_0057975 | 3300049578 | Bacteria | 2764 |
| 367 | Ga0501046_0010569 | 3300049580 | Bacteria | 7921 |
| 368 | Ga0501047_0292641 | 3300049581 | Bacteria | 1472 |
| 369 | Ga0501048_0121839 | 3300049582 | Bacteria | 1843 |
| 370 | Ga0501048_0217995 | 3300049582 | Bacteria | 1353 |
| 371 | Ga0501048_0288750 | 3300049582 | Bacteria | 1166 |
| 372 | Ga0501071_0042738 | 3300049587 | Bacteria | 3248 |
| 373 | Ga0501072_0063873 | 3300049588 | Bacteria | 2904 |
| 374 | Ga0501072_0076321 | 3300049588 | Bacteria | 2651 |
| 375 | Ga0501075_0004477 | 3300049591 | Bacteria | 9462 |
| 376 | Ga0501076_0000949 | 3300049592 | Bacteria | 18914 |
| 377 | Ga0501076_0313858 | 3300049592 | Bacteria | 1286 |
| 378 | Ga0501077_0002556 | 3300049593 | Bacteria | 10911 |
| 379 | Ga0501079_0025494 | 3300049741 | Bacteria | 4534 |
| 380 | Ga0501080_0050722 | 3300049742 | Bacteria | 3862 |
| 381 | Ga0501081_0012354 | 3300049743 | Bacteria | 5609 |
| 382 | Ga0501083_0056039 | 3300049744 | Bacteria | 2642 |
| 383 | Ga0501045_0046525 | 3300049824 | Bacteria | 3160 |
| 384 | nmdc:mga0k408_20506_c1 | 3300050493 | Bacteria | 3703 |
| 385 | nmdc:mga07m45_2016_c1 | 3300050496 | Bacteria | 7703 |
| 386 | nmdc:mga07m45_3006_c1 | 3300050496 | Bacteria | 8036 |
| 387 | nmdc:mga05p37_12706_c1 | 3300050507 | Bacteria | 10064 |
| 388 | nmdc:mga05p37_198027_c1 | 3300050507 | Unclassified | 2435 |
| 389 | nmdc:mga05p37_32968_c1 | 3300050507 | Bacteria | 6342 |
| 390 | nmdc:mga05p37_351599_c1 | 3300050507 | Bacteria | 1735 |
| 391 | nmdc:mga05p37_61662_c1 | 3300050507 | Bacteria | 4616 |
| 392 | nmdc:mga05p37_76650_c1 | 3300050507 | Bacteria | 4116 |
| 393 | nmdc:mga09592_2326_c1 | 3300050508 | Bacteria | 15337 |
| 394 | nmdc:mga09592_368921_c1 | 3300050508 | Bacteria | 1242 |
| 395 | nmdc:mga09592_86625_c1 | 3300050508 | Bacteria | 2673 |
| 396 | nmdc:mga09592_98997_c1 | 3300050508 | Bacteria | 2496 |
| 397 | nmdc:mga06r32_43096_c1 | 3300050510 | Bacteria | 4293 |
| 398 | nmdc:mga08y16_6236_c1 | 3300050511 | Bacteria | 12503 |
| 399 | nmdc:mga08y16_65497_c1 | 3300050511 | Bacteria | 3793 |
| 400 | nmdc:mga08y16_6961_c1 | 3300050511 | Bacteria | 11853 |
| 401 | nmdc:mga0n895_20267_c1 | 3300050512 | Bacteria | 6198 |
| 402 | nmdc:mga0n895_387825_c1 | 3300050512 | Bacteria | 1413 |
| 403 | nmdc:mga0n895_62203_c1 | 3300050512 | Bacteria | 3688 |
| 404 | nmdc:mga0rr50_351000_c1 | 3300050513 | Bacteria | 1241 |
| 405 | nmdc:mga0rr50_368708_c1 | 3300050513 | Unclassified | 1210 |
| 406 | nmdc:mga0rr50_37999_c1 | 3300050513 | Bacteria | 3480 |
| 407 | nmdc:mga0rr50_490839_c1 | 3300050513 | Bacteria | 1043 |
| 408 | nmdc:mga08x19_116436_c1 | 3300050514 | Bacteria | 1787 |
| 409 | nmdc:mga08x19_59413_c1 | 3300050514 | Bacteria | 2475 |
| 410 | nmdc:mga0a205_1366_c1 | 3300050515 | Bacteria | 20598 |
| 411 | nmdc:mga0a205_202625_c1 | 3300050515 | Bacteria | 1874 |
| 412 | nmdc:mga0a205_77333_c1 | 3300050515 | Bacteria | 3215 |
| 413 | Ga0500583_0003828 | 3300053092 | Bacteria | 4811 |
| 414 | Ga0500555_040490 | 3300053103 | Bacteria | 1298 |
| 415 | Ga0500588_0004769 | 3300053146 | Unclassified | 2960 |
| 416 | Ga0501084_0013285 | 3300054114 | Bacteria | 6813 |
| 417 | Ga0501082_0002686 | 3300060353 | Bacteria | 15543 |
| 418 | Ga0530510_0003767 | 3300061734 | Bacteria | 10442 |
| 419 | Ga0530510_0020627 | 3300061734 | Bacteria | 4686 |
| 420 | Ga0530510_0237610 | 3300061734 | Bacteria | 1356 |
| 421 | Ga0530510_0262991 | 3300061734 | Bacteria | 1287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_490839_c1 | nmdc:mga0rr50_490839_c1_30_767 | 244 |
| 2 | 3300006175 | Ga0070712_100263572 | Ga0070712_1002635722 | 268 |
| 3 | 3300025915 | Ga0207693_10106776 | Ga0207693_101067762 | 268 |
| 4 | 3300039453 | Ga0436362_1260443 | Ga0436362_1260443_186_1061 | 268 |
| 5 | 3300005435 | Ga0070714_100172911 | Ga0070714_1001729112 | 269 |
| 6 | 3300005439 | Ga0070711_100077928 | Ga0070711_1000779284 | 269 |
| 7 | 3300006028 | Ga0070717_10284254 | Ga0070717_102842541 | 269 |
| 8 | 3300006175 | Ga0070712_100002146 | Ga0070712_1000021462 | 269 |
| 9 | 3300025906 | Ga0207699_10206421 | Ga0207699_102064212 | 269 |
| 10 | 3300025915 | Ga0207693_10002609 | Ga0207693_100026092 | 269 |
| 11 | 3300005437 | Ga0070710_10103857 | Ga0070710_101038571 | 270 |
| 12 | 3300005536 | Ga0070697_100196606 | Ga0070697_1001966062 | 273 |
| 13 | 3300006175 | Ga0070712_100300268 | Ga0070712_1003002682 | 273 |
| 14 | 3300025915 | Ga0207693_10470289 | Ga0207693_104702892 | 273 |
| 15 | 3300007076 | Ga0075435_100016670 | Ga0075435_1000166706 | 279 |
| 16 | 3300050513 | nmdc:mga0rr50_368708_c1 | nmdc:mga0rr50_368708_c1_52_1047 | 279 |
| 17 | 3300042144 | Ga0450889_005401 | Ga0450889_005401_396_1244 | 281 |
| 18 | 3300042006 | Ga0439432_003095 | Ga0439432_003095_1548_2573 | 285 |
| 19 | 3300046459 | Ga0495629_0290505 | Ga0495629_0290505_33_896 | 287 |
| 20 | 3300046517 | Ga0495630_0349274 | Ga0495630_0349274_121_984 | 287 |
| 21 | iso_pu_bacteria | 2643221605 | 2644039498 | 287 |
| 22 | 3300049582 | Ga0501048_0121839 | Ga0501048_0121839_535_1404 | 288 |
| 23 | 3300049824 | Ga0501045_0046525 | Ga0501045_0046525_181_1050 | 288 |
| 24 | 3300061734 | Ga0530510_0237610 | Ga0530510_0237610_247_1116 | 288 |
| 25 | iso_pu_bacteria | 2582581307 | 2585270862 | 288 |
| 26 | iso_pu_bacteria | 2585427531 | 2585558586 | 288 |
| 27 | iso_pu_bacteria | 2595698237 | 2596374109 | 288 |
| 28 | iso_pu_bacteria | 2902405164 | 2902411860 | 288 |
| 29 | iso_pu_bacteria | 2928125067 | 2928129693 | 288 |
| 30 | iso_pu_bacteria | 2939657138 | 2939658851 | 288 |
| 31 | 3300002244 | JGI24742J22300_10022576 | JGI24742J22300_100225762 | 289 |
| 32 | 3300005327 | Ga0070658_10001588 | Ga0070658_100015884 | 289 |
| 33 | 3300005328 | Ga0070676_10000290 | Ga0070676_100002908 | 289 |
| 34 | 3300005329 | Ga0070683_100001772 | Ga0070683_1000017727 | 289 |
| 35 | 3300005330 | Ga0070690_100155005 | Ga0070690_1001550052 | 289 |
| 36 | 3300005331 | Ga0070670_100071138 | Ga0070670_1000711382 | 289 |
| 37 | 3300005333 | Ga0070677_10003248 | Ga0070677_100032483 | 289 |
| 38 | 3300005334 | Ga0068869_100001632 | Ga0068869_1000016321 | 289 |
| 39 | 3300005336 | Ga0070680_100128895 | Ga0070680_1001288953 | 289 |
| 40 | 3300005338 | Ga0068868_100038076 | Ga0068868_1000380764 | 289 |
| 41 | 3300005339 | Ga0070660_100000052 | Ga0070660_1000000521 | 289 |
| 42 | 3300005340 | Ga0070689_100001678 | Ga0070689_1000016787 | 289 |
| 43 | 3300005343 | Ga0070687_100000134 | Ga0070687_1000001344 | 289 |
| 44 | 3300005344 | Ga0070661_100007867 | Ga0070661_1000078671 | 289 |
| 45 | 3300005345 | Ga0070692_10015776 | Ga0070692_100157763 | 289 |
| 46 | 3300005353 | Ga0070669_100065038 | Ga0070669_1000650383 | 289 |
| 47 | 3300005354 | Ga0070675_100002647 | Ga0070675_1000026476 | 289 |
| 48 | 3300005355 | Ga0070671_100006839 | Ga0070671_1000068398 | 289 |
| 49 | 3300005356 | Ga0070674_100002955 | Ga0070674_1000029558 | 289 |
| 50 | 3300005365 | Ga0070688_100000725 | Ga0070688_1000007253 | 289 |
| 51 | 3300005366 | Ga0070659_100000813 | Ga0070659_10000081319 | 289 |
| 52 | 3300005367 | Ga0070667_100147225 | Ga0070667_1001472251 | 289 |
| 53 | 3300005436 | Ga0070713_100242713 | Ga0070713_1002427132 | 289 |
| 54 | 3300005438 | Ga0070701_10031866 | Ga0070701_100318661 | 289 |
| 55 | 3300005440 | Ga0070705_100011223 | Ga0070705_1000112232 | 289 |
| 56 | 3300005455 | Ga0070663_100000805 | Ga0070663_1000008058 | 289 |
| 57 | 3300005456 | Ga0070678_100007114 | Ga0070678_1000071144 | 289 |
| 58 | 3300005457 | Ga0070662_100000701 | Ga0070662_10000070120 | 289 |
| 59 | 3300005466 | Ga0070685_10000949 | Ga0070685_1000094913 | 289 |
| 60 | 3300005467 | Ga0070706_100060343 | Ga0070706_1000603432 | 289 |
| 61 | 3300005535 | Ga0070684_100002455 | Ga0070684_10000245511 | 289 |
| 62 | 3300005539 | Ga0068853_100000288 | Ga0068853_10000028826 | 289 |
| 63 | 3300005543 | Ga0070672_100001812 | Ga0070672_1000018122 | 289 |
| 64 | 3300005544 | Ga0070686_100010839 | Ga0070686_1000108393 | 289 |
| 65 | 3300005545 | Ga0070695_100009656 | Ga0070695_1000096564 | 289 |
| 66 | 3300005546 | Ga0070696_100007067 | Ga0070696_1000070676 | 289 |
| 67 | 3300005563 | Ga0068855_100000202 | Ga0068855_1000002028 | 289 |
| 68 | 3300005564 | Ga0070664_100000880 | Ga0070664_1000008807 | 289 |
| 69 | 3300005577 | Ga0068857_100007319 | Ga0068857_1000073197 | 289 |
| 70 | 3300005578 | Ga0068854_100000406 | Ga0068854_10000040617 | 289 |
| 71 | 3300005614 | Ga0068856_100003305 | Ga0068856_1000033058 | 289 |
| 72 | 3300005616 | Ga0068852_100001778 | Ga0068852_10000177812 | 289 |
| 73 | 3300005718 | Ga0068866_10000446 | Ga0068866_1000044612 | 289 |
| 74 | 3300005719 | Ga0068861_100005061 | Ga0068861_1000050613 | 289 |
| 75 | 3300005834 | Ga0068851_10000065 | Ga0068851_1000006512 | 289 |
| 76 | 3300005840 | Ga0068870_10000197 | Ga0068870_1000019713 | 289 |
| 77 | 3300005841 | Ga0068863_100030495 | Ga0068863_1000304954 | 289 |
| 78 | 3300005842 | Ga0068858_100288631 | Ga0068858_1002886311 | 289 |
| 79 | 3300005844 | Ga0068862_100082740 | Ga0068862_1000827402 | 289 |
| 80 | 3300005983 | Ga0081540_1001798 | Ga0081540_100179815 | 289 |
| 81 | 3300006237 | Ga0097621_100000918 | Ga0097621_1000009188 | 289 |
| 82 | 3300006358 | Ga0068871_100001441 | Ga0068871_10000144112 | 289 |
| 83 | 3300009093 | Ga0105240_10003064 | Ga0105240_100030648 | 289 |
| 84 | 3300009098 | Ga0105245_10003480 | Ga0105245_1000348012 | 289 |
| 85 | 3300009101 | Ga0105247_10000835 | Ga0105247_1000083511 | 289 |
| 86 | 3300009148 | Ga0105243_10004796 | Ga0105243_100047963 | 289 |
| 87 | 3300009174 | Ga0105241_10000829 | Ga0105241_1000082914 | 289 |
| 88 | 3300009176 | Ga0105242_10001542 | Ga0105242_100015423 | 289 |
| 89 | 3300009177 | Ga0105248_10014172 | Ga0105248_100141726 | 289 |
| 90 | 3300009545 | Ga0105237_10000190 | Ga0105237_1000019061 | 289 |
| 91 | 3300009551 | Ga0105238_10003095 | Ga0105238_100030956 | 289 |
| 92 | 3300009553 | Ga0105249_10000986 | Ga0105249_1000098611 | 289 |
| 93 | 3300010375 | Ga0105239_10003835 | Ga0105239_100038355 | 289 |
| 94 | 3300011119 | Ga0105246_10012204 | Ga0105246_100122043 | 289 |
| 95 | 3300013100 | Ga0157373_10006961 | Ga0157373_100069613 | 289 |
| 96 | 3300013102 | Ga0157371_10004934 | Ga0157371_100049347 | 289 |
| 97 | 3300013105 | Ga0157369_10000161 | Ga0157369_1000016184 | 289 |
| 98 | 3300013296 | Ga0157374_10002380 | Ga0157374_100023803 | 289 |
| 99 | 3300013297 | Ga0157378_10010750 | Ga0157378_100107502 | 289 |
| 100 | 3300013306 | Ga0163162_10007385 | Ga0163162_100073857 | 289 |
| 101 | 3300013307 | Ga0157372_10007592 | Ga0157372_100075927 | 289 |
| 102 | 3300013308 | Ga0157375_10004227 | Ga0157375_1000422710 | 289 |
| 103 | 3300014325 | Ga0163163_10061450 | Ga0163163_100614502 | 289 |
| 104 | 3300014745 | Ga0157377_10000141 | Ga0157377_1000014113 | 289 |
| 105 | 3300014968 | Ga0157379_10000079 | Ga0157379_1000007941 | 289 |
| 106 | 3300014969 | Ga0157376_10001389 | Ga0157376_1000138911 | 289 |
| 107 | 3300025315 | Ga0207697_10058552 | Ga0207697_100585522 | 289 |
| 108 | 3300025321 | Ga0207656_10001575 | Ga0207656_100015752 | 289 |
| 109 | 3300025893 | Ga0207682_10000319 | Ga0207682_1000031917 | 289 |
| 110 | 3300025900 | Ga0207710_10005587 | Ga0207710_100055873 | 289 |
| 111 | 3300025901 | Ga0207688_10000015 | Ga0207688_1000001544 | 289 |
| 112 | 3300025903 | Ga0207680_10002258 | Ga0207680_100022583 | 289 |
| 113 | 3300025904 | Ga0207647_10004455 | Ga0207647_100044552 | 289 |
| 114 | 3300025907 | Ga0207645_10000025 | Ga0207645_1000002575 | 289 |
| 115 | 3300025908 | Ga0207643_10000023 | Ga0207643_1000002382 | 289 |
| 116 | 3300025909 | Ga0207705_10019245 | Ga0207705_100192453 | 289 |
| 117 | 3300025910 | Ga0207684_10011436 | Ga0207684_100114367 | 289 |
| 118 | 3300025911 | Ga0207654_10005498 | Ga0207654_100054982 | 289 |
| 119 | 3300025913 | Ga0207695_10017104 | Ga0207695_100171043 | 289 |
| 120 | 3300025914 | Ga0207671_10045493 | Ga0207671_100454933 | 289 |
| 121 | 3300025917 | Ga0207660_10041423 | Ga0207660_100414233 | 289 |
| 122 | 3300025918 | Ga0207662_10000346 | Ga0207662_1000034613 | 289 |
| 123 | 3300025919 | Ga0207657_10000067 | Ga0207657_1000006774 | 289 |
| 124 | 3300025920 | Ga0207649_10004571 | Ga0207649_100045713 | 289 |
| 125 | 3300025923 | Ga0207681_10004137 | Ga0207681_100041377 | 289 |
| 126 | 3300025924 | Ga0207694_10003230 | Ga0207694_100032309 | 289 |
| 127 | 3300025925 | Ga0207650_10000147 | Ga0207650_100001473 | 289 |
| 128 | 3300025926 | Ga0207659_10003682 | Ga0207659_100036823 | 289 |
| 129 | 3300025927 | Ga0207687_10002309 | Ga0207687_100023092 | 289 |
| 130 | 3300025931 | Ga0207644_10001339 | Ga0207644_1000133913 | 289 |
| 131 | 3300025933 | Ga0207706_10000119 | Ga0207706_1000011961 | 289 |
| 132 | 3300025935 | Ga0207709_10019553 | Ga0207709_100195532 | 289 |
| 133 | 3300025936 | Ga0207670_10000100 | Ga0207670_100001003 | 289 |
| 134 | 3300025937 | Ga0207669_10006044 | Ga0207669_100060444 | 289 |
| 135 | 3300025938 | Ga0207704_10003255 | Ga0207704_100032555 | 289 |
| 136 | 3300025940 | Ga0207691_10000079 | Ga0207691_1000007917 | 289 |
| 137 | 3300025941 | Ga0207711_10000189 | Ga0207711_1000018960 | 289 |
| 138 | 3300025942 | Ga0207689_10001164 | Ga0207689_1000116417 | 289 |
| 139 | 3300025944 | Ga0207661_10003663 | Ga0207661_100036637 | 289 |
| 140 | 3300025945 | Ga0207679_10001426 | Ga0207679_1000142612 | 289 |
| 141 | 3300025949 | Ga0207667_10113926 | Ga0207667_101139263 | 289 |
| 142 | 3300025960 | Ga0207651_10002161 | Ga0207651_100021616 | 289 |
| 143 | 3300025961 | Ga0207712_10000157 | Ga0207712_1000015760 | 289 |
| 144 | 3300025972 | Ga0207668_10004328 | Ga0207668_100043283 | 289 |
| 145 | 3300025986 | Ga0207658_10000885 | Ga0207658_100008858 | 289 |
| 146 | 3300026023 | Ga0207677_10000113 | Ga0207677_1000011360 | 289 |
| 147 | 3300026035 | Ga0207703_10002397 | Ga0207703_1000239713 | 289 |
| 148 | 3300026041 | Ga0207639_10095516 | Ga0207639_100955162 | 289 |
| 149 | 3300026067 | Ga0207678_10004616 | Ga0207678_1000461610 | 289 |
| 150 | 3300026075 | Ga0207708_10052922 | Ga0207708_100529223 | 289 |
| 151 | 3300026078 | Ga0207702_10030569 | Ga0207702_100305693 | 289 |
| 152 | 3300026088 | Ga0207641_10009975 | Ga0207641_100099756 | 289 |
| 153 | 3300026089 | Ga0207648_10000095 | Ga0207648_1000009517 | 289 |
| 154 | 3300026095 | Ga0207676_10005002 | Ga0207676_100050023 | 289 |
| 155 | 3300026116 | Ga0207674_10001904 | Ga0207674_1000190417 | 289 |
| 156 | 3300026118 | Ga0207675_100001269 | Ga0207675_10000126917 | 289 |
| 157 | 3300026121 | Ga0207683_10000050 | Ga0207683_100000508 | 289 |
| 158 | 3300026142 | Ga0207698_10007847 | Ga0207698_100078476 | 289 |
| 159 | 3300028379 | Ga0268266_10000415 | Ga0268266_100004153 | 289 |
| 160 | 3300028380 | Ga0268265_10005984 | Ga0268265_100059846 | 289 |
| 161 | 3300028381 | Ga0268264_10001060 | Ga0268264_1000106011 | 289 |
| 162 | 3300048905 | Ga0496102_0001170 | Ga0496102_0001170_10876_11745 | 289 |
| 163 | 3300048906 | Ga0496103_0115093 | Ga0496103_0115093_506_1375 | 289 |
| 164 | 3300048909 | Ga0496106_0005729 | Ga0496106_0005729_781_1650 | 289 |
| 165 | 3300048910 | Ga0496107_0014757 | Ga0496107_0014757_486_1355 | 289 |
| 166 | 3300048912 | Ga0496109_0087463 | Ga0496109_0087463_1393_2262 | 289 |
| 167 | 3300049587 | Ga0501071_0042738 | Ga0501071_0042738_17_886 | 289 |
| 168 | iso_pu_bacteria | 8056131705 | 8056134875 | 289 |
| 169 | 3300053146 | Ga0500588_0004769 | Ga0500588_0004769_365_1240 | 290 |
| 170 | iso_pu_bacteria | 2600255283 | 2601624244 | 290 |
| 171 | 3300053103 | Ga0500555_040490 | Ga0500555_040490_363_1244 | 291 |
| 172 | iso_pu_bacteria | 2929189879 | 2929192428 | 291 |
| 173 | 3300005331 | Ga0070670_100000416 | Ga0070670_10000041625 | 292 |
| 174 | 3300005985 | Ga0081539_10004590 | Ga0081539_1000459010 | 292 |
| 175 | 3300006178 | Ga0075367_10263020 | Ga0075367_102630201 | 292 |
| 176 | 3300025302 | Ga0207426_1060307 | Ga0207426_10603072 | 292 |
| 177 | 3300025925 | Ga0207650_10001599 | Ga0207650_1000159914 | 292 |
| 178 | 3300050507 | nmdc:mga05p37_76650_c1 | nmdc:mga05p37_76650_c1_2063_2944 | 292 |
| 179 | 3300050508 | nmdc:mga09592_368921_c1 | nmdc:mga09592_368921_c1_296_1177 | 292 |
| 180 | 3300050510 | nmdc:mga06r32_43096_c1 | nmdc:mga06r32_43096_c1_1363_2244 | 292 |
| 181 | iso_pu_bacteria | 2826581358 | 2826585619 | 292 |
| 182 | iso_pu_bacteria | 2842815866 | 2842818477 | 292 |
| 183 | iso_pu_bacteria | 2842849001 | 2842853178 | 292 |
| 184 | 3300005471 | Ga0070698_100171866 | Ga0070698_1001718661 | 293 |
| 185 | 3300009094 | Ga0111539_10015198 | Ga0111539_100151982 | 293 |
| 186 | 3300009094 | Ga0111539_10019377 | Ga0111539_100193775 | 293 |
| 187 | 3300025960 | Ga0207651_10279801 | Ga0207651_102798011 | 293 |
| 188 | 3300031731 | Ga0307405_10035526 | Ga0307405_100355263 | 293 |
| 189 | 3300046471 | Ga0495650_0007708 | Ga0495650_0007708_4994_5875 | 293 |
| 190 | 3300046474 | Ga0495605_0002430 | Ga0495605_0002430_6964_7845 | 293 |
| 191 | 3300046492 | Ga0495585_0083781 | Ga0495585_0083781_368_1249 | 293 |
| 192 | 3300046500 | Ga0495596_0000793 | Ga0495596_0000793_10266_11147 | 293 |
| 193 | 3300046501 | Ga0495607_0021489 | Ga0495607_0021489_1395_2276 | 293 |
| 194 | 3300046507 | Ga0495606_0004740 | Ga0495606_0004740_1904_2785 | 293 |
| 195 | 3300046512 | Ga0495610_0000840 | Ga0495610_0000840_5903_6784 | 293 |
| 196 | 3300046515 | Ga0495620_0031535 | Ga0495620_0031535_419_1300 | 293 |
| 197 | 3300046519 | Ga0495632_0000492 | Ga0495632_0000492_17337_18218 | 293 |
| 198 | 3300046524 | Ga0495648_0000236 | Ga0495648_0000236_9582_10463 | 293 |
| 199 | 3300046530 | Ga0495654_0001535 | Ga0495654_0001535_13971_14852 | 293 |
| 200 | 3300046538 | Ga0495609_0000214 | Ga0495609_0000214_473_1354 | 293 |
| 201 | 3300046660 | Ga0495625_0000242 | Ga0495625_0000242_2030_2911 | 293 |
| 202 | 3300046665 | Ga0495661_0038071 | Ga0495661_0038071_2022_2903 | 293 |
| 203 | 3300046692 | Ga0495671_0009897 | Ga0495671_0009897_2274_3155 | 293 |
| 204 | 3300046810 | Ga0495660_0000353 | Ga0495660_0000353_37592_38473 | 293 |
| 205 | 3300046810 | Ga0495660_0029994 | Ga0495660_0029994_341_1222 | 293 |
| 206 | 3300047443 | Ga0495687_040316 | Ga0495687_040316_657_1679 | 293 |
| 207 | 3300047446 | Ga0495679_004826 | Ga0495679_004826_3370_4251 | 293 |
| 208 | 3300048091 | Ga0495626_0000010 | Ga0495626_0000010_236140_237021 | 293 |
| 209 | 3300049570 | Ga0501033_0167467 | Ga0501033_0167467_403_1299 | 293 |
| 210 | 3300049574 | Ga0501038_0325005 | Ga0501038_0325005_283_1179 | 293 |
| 211 | 3300049576 | Ga0501040_0046212 | Ga0501040_0046212_1225_2121 | 293 |
| 212 | 3300049578 | Ga0501042_0057975 | Ga0501042_0057975_141_1037 | 293 |
| 213 | 3300049580 | Ga0501046_0010569 | Ga0501046_0010569_2995_3891 | 293 |
| 214 | 3300049582 | Ga0501048_0288750 | Ga0501048_0288750_67_963 | 293 |
| 215 | 3300049588 | Ga0501072_0076321 | Ga0501072_0076321_1375_2271 | 293 |
| 216 | 3300049591 | Ga0501075_0004477 | Ga0501075_0004477_1011_1907 | 293 |
| 217 | 3300049592 | Ga0501076_0000949 | Ga0501076_0000949_14972_15868 | 293 |
| 218 | 3300049593 | Ga0501077_0002556 | Ga0501077_0002556_2662_3558 | 293 |
| 219 | 3300049741 | Ga0501079_0025494 | Ga0501079_0025494_2369_3265 | 293 |
| 220 | 3300049742 | Ga0501080_0050722 | Ga0501080_0050722_2745_3641 | 293 |
| 221 | 3300049743 | Ga0501081_0012354 | Ga0501081_0012354_3065_3961 | 293 |
| 222 | 3300049744 | Ga0501083_0056039 | Ga0501083_0056039_188_1084 | 293 |
| 223 | 3300050511 | nmdc:mga08y16_6961_c1 | nmdc:mga08y16_6961_c1_2519_3400 | 293 |
| 224 | 3300054114 | Ga0501084_0013285 | Ga0501084_0013285_3436_4332 | 293 |
| 225 | 3300060353 | Ga0501082_0002686 | Ga0501082_0002686_13092_13988 | 293 |
| 226 | 3300061734 | Ga0530510_0003767 | Ga0530510_0003767_7787_8683 | 293 |
| 227 | 3300005445 | Ga0070708_100012168 | Ga0070708_1000121682 | 294 |
| 228 | 3300005467 | Ga0070706_100066157 | Ga0070706_1000661572 | 294 |
| 229 | 3300005468 | Ga0070707_100192068 | Ga0070707_1001920682 | 294 |
| 230 | 3300005536 | Ga0070697_100176231 | Ga0070697_1001762311 | 294 |
| 231 | 3300006844 | Ga0075428_100168635 | Ga0075428_1001686352 | 294 |
| 232 | 3300006852 | Ga0075433_10007389 | Ga0075433_100073895 | 294 |
| 233 | 3300006871 | Ga0075434_100017537 | Ga0075434_1000175375 | 294 |
| 234 | 3300006880 | Ga0075429_100005732 | Ga0075429_1000057328 | 294 |
| 235 | 3300006880 | Ga0075429_100031959 | Ga0075429_1000319596 | 294 |
| 236 | 3300006914 | Ga0075436_100047351 | Ga0075436_1000473512 | 294 |
| 237 | 3300007076 | Ga0075435_100019967 | Ga0075435_1000199674 | 294 |
| 238 | 3300009094 | Ga0111539_10014556 | Ga0111539_1001455612 | 294 |
| 239 | 3300009147 | Ga0114129_10046663 | Ga0114129_100466632 | 294 |
| 240 | 3300009553 | Ga0105249_10161751 | Ga0105249_101617512 | 294 |
| 241 | 3300025254 | Ga0209148_1000377 | Ga0209148_100037718 | 294 |
| 242 | 3300025272 | Ga0209455_1000299 | Ga0209455_100029942 | 294 |
| 243 | 3300025728 | Ga0207655_1001301 | Ga0207655_100130122 | 294 |
| 244 | 3300025910 | Ga0207684_10047516 | Ga0207684_100475161 | 294 |
| 245 | 3300025922 | Ga0207646_10448973 | Ga0207646_104489731 | 294 |
| 246 | 3300025961 | Ga0207712_10048663 | Ga0207712_100486631 | 294 |
| 247 | 3300028800 | Ga0265338_10009743 | Ga0265338_100097435 | 294 |
| 248 | 3300035172 | Ga0373955_0302225 | Ga0373955_0302225_39_929 | 294 |
| 249 | 3300035692 | Ga0373935_0047600 | Ga0373935_0047600_111_1001 | 294 |
| 250 | 3300035695 | Ga0373927_0146796 | Ga0373927_0146796_72_962 | 294 |
| 251 | 3300035725 | Ga0373947_0038381 | Ga0373947_0038381_1815_2705 | 294 |
| 252 | 3300036401 | Ga0373937_0094562 | Ga0373937_0094562_499_1389 | 294 |
| 253 | 3300037068 | Ga0373925_0076960 | Ga0373925_0076960_1549_2439 | 294 |
| 254 | 3300041405 | Ga0439438_000491 | Ga0439438_000491_13480_14418 | 294 |
| 255 | 3300041407 | Ga0439447_013158 | Ga0439447_013158_1255_2295 | 294 |
| 256 | 3300041411 | Ga0439466_0020609 | Ga0439466_0020609_1385_2323 | 294 |
| 257 | 3300042185 | Ga0450909_006935 | Ga0450909_006935_521_1444 | 294 |
| 258 | 3300045051 | Ga0451576_0128687 | Ga0451576_0128687_1456_2340 | 294 |
| 259 | 3300046472 | Ga0495580_0002649 | Ga0495580_0002649_1933_2823 | 294 |
| 260 | 3300046501 | Ga0495607_0000224 | Ga0495607_0000224_49471_50358 | 294 |
| 261 | 3300046615 | Ga0495656_0009485 | Ga0495656_0009485_1085_1975 | 294 |
| 262 | 3300047319 | Ga0495674_0088530 | Ga0495674_0088530_1060_1950 | 294 |
| 263 | 3300047323 | Ga0495683_0000014 | Ga0495683_0000014_150519_151550 | 294 |
| 264 | 3300047471 | Ga0495684_0350920 | Ga0495684_0350920_86_976 | 294 |
| 265 | 3300050507 | nmdc:mga05p37_32968_c1 | nmdc:mga05p37_32968_c1_2340_3254 | 294 |
| 266 | 3300050508 | nmdc:mga09592_2326_c1 | nmdc:mga09592_2326_c1_1229_2143 | 294 |
| 267 | 3300050511 | nmdc:mga08y16_6236_c1 | nmdc:mga08y16_6236_c1_2793_3683 | 294 |
| 268 | 3300050511 | nmdc:mga08y16_65497_c1 | nmdc:mga08y16_65497_c1_2232_3122 | 294 |
| 269 | 3300050512 | nmdc:mga0n895_20267_c1 | nmdc:mga0n895_20267_c1_1374_2285 | 294 |
| 270 | 3300050513 | nmdc:mga0rr50_351000_c1 | nmdc:mga0rr50_351000_c1_336_1226 | 294 |
| 271 | 3300050513 | nmdc:mga0rr50_37999_c1 | nmdc:mga0rr50_37999_c1_2308_3222 | 294 |
| 272 | 3300050514 | nmdc:mga08x19_59413_c1 | nmdc:mga08x19_59413_c1_616_1527 | 294 |
| 273 | 3300050515 | nmdc:mga0a205_1366_c1 | nmdc:mga0a205_1366_c1_17234_18148 | 294 |
| 274 | 3300050515 | nmdc:mga0a205_77333_c1 | nmdc:mga0a205_77333_c1_1435_2349 | 294 |
| 275 | 3300053092 | Ga0500583_0003828 | Ga0500583_0003828_907_1791 | 294 |
| 276 | 3300005288 | Ga0065714_10002262 | Ga0065714_1000226235 | 295 |
| 277 | 3300005288 | Ga0065714_10004999 | Ga0065714_100049992 | 295 |
| 278 | 3300005455 | Ga0070663_100234191 | Ga0070663_1002341912 | 295 |
| 279 | 3300005468 | Ga0070707_100128149 | Ga0070707_1001281493 | 295 |
| 280 | 3300005471 | Ga0070698_100005483 | Ga0070698_1000054836 | 295 |
| 281 | 3300005536 | Ga0070697_100083531 | Ga0070697_1000835311 | 295 |
| 282 | 3300005617 | Ga0068859_100609995 | Ga0068859_1006099951 | 295 |
| 283 | 3300006028 | Ga0070717_10616999 | Ga0070717_106169991 | 295 |
| 284 | 3300006844 | Ga0075428_100097377 | Ga0075428_1000973773 | 295 |
| 285 | 3300006871 | Ga0075434_100147280 | Ga0075434_1001472802 | 295 |
| 286 | 3300006931 | Ga0097620_100610023 | Ga0097620_1006100231 | 295 |
| 287 | 3300009011 | Ga0105251_10014606 | Ga0105251_100146065 | 295 |
| 288 | 3300009036 | Ga0105244_10044419 | Ga0105244_100444191 | 295 |
| 289 | 3300009147 | Ga0114129_10344929 | Ga0114129_103449292 | 295 |
| 290 | 3300013102 | Ga0157371_10203782 | Ga0157371_102037821 | 295 |
| 291 | 3300014325 | Ga0163163_10406509 | Ga0163163_104065092 | 295 |
| 292 | 3300014497 | Ga0182008_10024635 | Ga0182008_100246352 | 295 |
| 293 | 3300021384 | Ga0213876_10020279 | Ga0213876_100202793 | 295 |
| 294 | 3300021384 | Ga0213876_10039609 | Ga0213876_100396093 | 295 |
| 295 | 3300021384 | Ga0213876_10039761 | Ga0213876_100397612 | 295 |
| 296 | 3300025728 | Ga0207655_1000285 | Ga0207655_100028583 | 295 |
| 297 | 3300025735 | Ga0207713_1028623 | Ga0207713_10286231 | 295 |
| 298 | 3300025922 | Ga0207646_10001835 | Ga0207646_100018353 | 295 |
| 299 | 3300025939 | Ga0207665_10057232 | Ga0207665_100572322 | 295 |
| 300 | 3300027614 | Ga0209970_1006384 | Ga0209970_10063842 | 295 |
| 301 | 3300027665 | Ga0209983_1000121 | Ga0209983_10001214 | 295 |
| 302 | 3300027682 | Ga0209971_1000070 | Ga0209971_100007028 | 295 |
| 303 | 3300027695 | Ga0209966_1000042 | Ga0209966_10000428 | 295 |
| 304 | 3300027717 | Ga0209998_10000127 | Ga0209998_100001272 | 295 |
| 305 | 3300028380 | Ga0268265_10006904 | Ga0268265_100069047 | 295 |
| 306 | 3300037068 | Ga0373925_0206700 | Ga0373925_0206700_11_913 | 295 |
| 307 | 3300039437 | Ga0436365_0628342 | Ga0436365_0628342_7894_8784 | 295 |
| 308 | 3300042876 | Ga0451577_0025297 | Ga0451577_0025297_3056_3946 | 295 |
| 309 | 3300042876 | Ga0451577_0087727 | Ga0451577_0087727_181_1083 | 295 |
| 310 | 3300044673 | Ga0453683_0094466 | Ga0453683_0094466_806_1696 | 295 |
| 311 | 3300045051 | Ga0451576_0002155 | Ga0451576_0002155_17338_18240 | 295 |
| 312 | 3300045051 | Ga0451576_0036547 | Ga0451576_0036547_1338_2240 | 295 |
| 313 | 3300045051 | Ga0451576_0139484 | Ga0451576_0139484_120_1010 | 295 |
| 314 | 3300045976 | Ga0466967_0429485 | Ga0466967_0429485_117_1007 | 295 |
| 315 | 3300046472 | Ga0495580_0086230 | Ga0495580_0086230_803_1693 | 295 |
| 316 | 3300046501 | Ga0495607_0000094 | Ga0495607_0000094_79729_80625 | 295 |
| 317 | 3300046501 | Ga0495607_0000530 | Ga0495607_0000530_21904_22800 | 295 |
| 318 | 3300046515 | Ga0495620_0000181 | Ga0495620_0000181_820_1716 | 295 |
| 319 | 3300046519 | Ga0495632_0000022 | Ga0495632_0000022_63616_64542 | 295 |
| 320 | 3300048909 | Ga0496106_0238036 | Ga0496106_0238036_244_1164 | 295 |
| 321 | 3300048910 | Ga0496107_0013880 | Ga0496107_0013880_2517_3437 | 295 |
| 322 | 3300048911 | Ga0496108_0062730 | Ga0496108_0062730_61_981 | 295 |
| 323 | 3300048912 | Ga0496109_0031366 | Ga0496109_0031366_945_1865 | 295 |
| 324 | 3300048913 | Ga0496110_0012626 | Ga0496110_0012626_2062_2982 | 295 |
| 325 | 3300048915 | Ga0496112_0000706 | Ga0496112_0000706_19077_19997 | 295 |
| 326 | 3300048918 | Ga0496115_0078325 | Ga0496115_0078325_988_1908 | 295 |
| 327 | 3300048924 | Ga0496121_0004122 | Ga0496121_0004122_2984_3877 | 295 |
| 328 | 3300049460 | Ga0495682_0000169 | Ga0495682_0000169_6772_7668 | 295 |
| 329 | 3300049571 | Ga0501034_0535495 | Ga0501034_0535495_79_969 | 295 |
| 330 | 3300049581 | Ga0501047_0292641 | Ga0501047_0292641_464_1354 | 295 |
| 331 | 3300050514 | nmdc:mga08x19_116436_c1 | nmdc:mga08x19_116436_c1_35_922 | 295 |
| 332 | iso_pu_bacteria | 2554235341 | 2555671107 | 295 |
| 333 | iso_pu_bacteria | 2599185160 | 2599358406 | 295 |
| 334 | iso_pu_bacteria | 2599185161 | 2599364724 | 295 |
| 335 | iso_pu_bacteria | 2599185162 | 2599371045 | 295 |
| 336 | iso_pu_bacteria | 2599185163 | 2599377444 | 295 |
| 337 | iso_pu_bacteria | 2599185164 | 2599383751 | 295 |
| 338 | iso_pu_bacteria | 2599185165 | 2599390018 | 295 |
| 339 | iso_pu_bacteria | 2599185166 | 2599396298 | 295 |
| 340 | iso_pu_bacteria | 2599185168 | 2599408485 | 295 |
| 341 | iso_pu_bacteria | 2599185181 | 2599465400 | 295 |
| 342 | iso_pu_bacteria | 2599185182 | 2599471707 | 295 |
| 343 | iso_pu_bacteria | 2599185186 | 2599494244 | 295 |
| 344 | iso_pu_bacteria | 2599185356 | 2600211634 | 295 |
| 345 | iso_pu_bacteria | 2600255313 | 2601771770 | 295 |
| 346 | iso_pu_bacteria | 2667528171 | 2671100924 | 295 |
| 347 | iso_pu_bacteria | 2818991464 | 2819705933 | 295 |
| 348 | iso_pu_bacteria | 2844665904 | 2844671657 | 295 |
| 349 | iso_pu_bacteria | 2917070673 | 2917074967 | 295 |
| 350 | iso_pu_bacteria | 2935353572 | 2935355045 | 295 |
| 351 | iso_pu_bacteria | 637000220 | 637321441 | 295 |
| 352 | 2162886011 | MRS1b_contig_2248537 | MRS1b_0876.00002390 | 296 |
| 353 | 3300002737 | JGI25162J39368_1000081 | JGI25162J39368_100008144 | 296 |
| 354 | 3300002771 | JGI25163J39215_1000016 | JGI25163J39215_100001627 | 296 |
| 355 | 3300002772 | JGI25164J39214_1000060 | JGI25164J39214_100006039 | 296 |
| 356 | 3300003187 | JGI25151J46595_10001299 | JGI25151J46595_1000129913 | 296 |
| 357 | 3300003187 | JGI25151J46595_10006332 | JGI25151J46595_100063322 | 296 |
| 358 | 3300003214 | JGI25165J46597_1000153 | JGI25165J46597_100015339 | 296 |
| 359 | 3300003911 | JGI25405J52794_10002968 | JGI25405J52794_100029682 | 296 |
| 360 | 3300005290 | Ga0065712_10068085 | Ga0065712_100680859 | 296 |
| 361 | 3300005344 | Ga0070661_100248960 | Ga0070661_1002489602 | 296 |
| 362 | 3300005439 | Ga0070711_100014026 | Ga0070711_1000140264 | 296 |
| 363 | 3300005468 | Ga0070707_100001008 | Ga0070707_10000100829 | 296 |
| 364 | 3300005577 | Ga0068857_100494925 | Ga0068857_1004949251 | 296 |
| 365 | 3300005578 | Ga0068854_100188563 | Ga0068854_1001885632 | 296 |
| 366 | 3300005843 | Ga0068860_100507068 | Ga0068860_1005070681 | 296 |
| 367 | 3300005937 | Ga0081455_10110772 | Ga0081455_101107722 | 296 |
| 368 | 3300005981 | Ga0081538_10046818 | Ga0081538_100468182 | 296 |
| 369 | 3300006353 | Ga0075370_10021067 | Ga0075370_100210675 | 296 |
| 370 | 3300006353 | Ga0075370_10024243 | Ga0075370_100242434 | 296 |
| 371 | 3300006844 | Ga0075428_100259600 | Ga0075428_1002596002 | 296 |
| 372 | 3300006844 | Ga0075428_100444670 | Ga0075428_1004446701 | 296 |
| 373 | 3300006847 | Ga0075431_100056035 | Ga0075431_1000560355 | 296 |
| 374 | 3300006871 | Ga0075434_100109807 | Ga0075434_1001098072 | 296 |
| 375 | 3300006880 | Ga0075429_100011692 | Ga0075429_1000116928 | 296 |
| 376 | 3300009036 | Ga0105244_10001757 | Ga0105244_1000175715 | 296 |
| 377 | 3300009147 | Ga0114129_10260107 | Ga0114129_102601072 | 296 |
| 378 | 3300009147 | Ga0114129_10287093 | Ga0114129_102870932 | 296 |
| 379 | 3300009148 | Ga0105243_10000310 | Ga0105243_1000031011 | 296 |
| 380 | 3300009148 | Ga0105243_10003726 | Ga0105243_1000372611 | 296 |
| 381 | 3300009148 | Ga0105243_10043712 | Ga0105243_100437122 | 296 |
| 382 | 3300009551 | Ga0105238_10105833 | Ga0105238_101058332 | 296 |
| 383 | 3300009551 | Ga0105238_10271615 | Ga0105238_102716153 | 296 |
| 384 | 3300011119 | Ga0105246_10171990 | Ga0105246_101719902 | 296 |
| 385 | 3300013102 | Ga0157371_10000264 | Ga0157371_1000026440 | 296 |
| 386 | 3300013306 | Ga0163162_10144033 | Ga0163162_101440332 | 296 |
| 387 | 3300013306 | Ga0163162_10184906 | Ga0163162_101849065 | 296 |
| 388 | 3300013308 | Ga0157375_10200441 | Ga0157375_102004411 | 296 |
| 389 | 3300014497 | Ga0182008_10000050 | Ga0182008_1000005039 | 296 |
| 390 | 3300014497 | Ga0182008_10003128 | Ga0182008_100031282 | 296 |
| 391 | 3300015261 | Ga0182006_1002944 | Ga0182006_10029442 | 296 |
| 392 | 3300015262 | Ga0182007_10000383 | Ga0182007_100003832 | 296 |
| 393 | 3300025207 | Ga0209760_100041 | Ga0209760_10004139 | 296 |
| 394 | 3300025231 | Ga0207427_100104 | Ga0207427_10010447 | 296 |
| 395 | 3300025233 | Ga0209437_100348 | Ga0209437_10034810 | 296 |
| 396 | 3300025258 | Ga0209129_1004420 | Ga0209129_10044202 | 296 |
| 397 | 3300025261 | Ga0209233_1000202 | Ga0209233_100020247 | 296 |
| 398 | 3300025294 | Ga0209025_1000244 | Ga0209025_10002442 | 296 |
| 399 | 3300025294 | Ga0209025_1001083 | Ga0209025_100108334 | 296 |
| 400 | 3300025728 | Ga0207655_1009652 | Ga0207655_10096522 | 296 |
| 401 | 3300025916 | Ga0207663_10005937 | Ga0207663_100059375 | 296 |
| 402 | 3300025919 | Ga0207657_10137903 | Ga0207657_101379032 | 296 |
| 403 | 3300025920 | Ga0207649_10210596 | Ga0207649_102105962 | 296 |
| 404 | 3300025922 | Ga0207646_10006933 | Ga0207646_100069334 | 296 |
| 405 | 3300025935 | Ga0207709_10000280 | Ga0207709_1000028033 | 296 |
| 406 | 3300025935 | Ga0207709_10001108 | Ga0207709_1000110823 | 296 |
| 407 | 3300025935 | Ga0207709_10025878 | Ga0207709_100258785 | 296 |
| 408 | 3300025945 | Ga0207679_10000531 | Ga0207679_1000053129 | 296 |
| 409 | 3300026041 | Ga0207639_10093313 | Ga0207639_100933132 | 296 |
| 410 | 3300026067 | Ga0207678_10223987 | Ga0207678_102239871 | 296 |
| 411 | 3300026116 | Ga0207674_10123837 | Ga0207674_101238372 | 296 |
| 412 | 3300028379 | Ga0268266_10087294 | Ga0268266_100872943 | 296 |
| 413 | 3300028381 | Ga0268264_10503256 | Ga0268264_105032561 | 296 |
| 414 | 3300041404 | Ga0439436_0033840 | Ga0439436_0033840_541_1440 | 296 |
| 415 | 3300046530 | Ga0495654_0000923 | Ga0495654_0000923_12070_12960 | 296 |
| 416 | 3300046615 | Ga0495656_0003948 | Ga0495656_0003948_3512_4414 | 296 |
| 417 | 3300046810 | Ga0495660_0000316 | Ga0495660_0000316_34484_35374 | 296 |
| 418 | 3300047470 | Ga0495681_0115295 | Ga0495681_0115295_175_1077 | 296 |
| 419 | 3300048903 | Ga0496100_0100141 | Ga0496100_0100141_429_1436 | 296 |
| 420 | 3300048905 | Ga0496102_0036346 | Ga0496102_0036346_56_979 | 296 |
| 421 | 3300048909 | Ga0496106_0310864 | Ga0496106_0310864_77_1084 | 296 |
| 422 | 3300048919 | Ga0496116_0000290 | Ga0496116_0000290_39309_40214 | 296 |
| 423 | 3300048919 | Ga0496116_0006174 | Ga0496116_0006174_4351_5274 | 296 |
| 424 | 3300048920 | Ga0496117_0005356 | Ga0496117_0005356_5526_6431 | 296 |
| 425 | 3300048920 | Ga0496117_0038298 | Ga0496117_0038298_361_1284 | 296 |
| 426 | 3300048921 | Ga0496118_0007440 | Ga0496118_0007440_7283_8206 | 296 |
| 427 | 3300048921 | Ga0496118_0066631 | Ga0496118_0066631_1462_2367 | 296 |
| 428 | 3300048924 | Ga0496121_0000255 | Ga0496121_0000255_45318_46223 | 296 |
| 429 | 3300048924 | Ga0496121_0022587 | Ga0496121_0022587_3432_4325 | 296 |
| 430 | 3300048925 | Ga0496122_0000654 | Ga0496122_0000654_25597_26502 | 296 |
| 431 | 3300048925 | Ga0496122_0102436 | Ga0496122_0102436_721_1644 | 296 |
| 432 | 3300048926 | Ga0496123_0000688 | Ga0496123_0000688_41251_42156 | 296 |
| 433 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_551366_552259 | 296 |
| 434 | 3300048927 | Ga0496124_0017153 | Ga0496124_0017153_5251_6174 | 296 |
| 435 | 3300048928 | Ga0496125_0016989 | Ga0496125_0016989_5555_6478 | 296 |
| 436 | 3300048928 | Ga0496125_0070849 | Ga0496125_0070849_545_1450 | 296 |
| 437 | 3300049572 | Ga0501036_0403902 | Ga0501036_0403902_207_1106 | 296 |
| 438 | 3300049582 | Ga0501048_0217995 | Ga0501048_0217995_335_1234 | 296 |
| 439 | 3300049588 | Ga0501072_0063873 | Ga0501072_0063873_1948_2853 | 296 |
| 440 | 3300049592 | Ga0501076_0313858 | Ga0501076_0313858_80_979 | 296 |
| 441 | 3300050493 | nmdc:mga0k408_20506_c1 | nmdc:mga0k408_20506_c1_2481_3392 | 296 |
| 442 | 3300050496 | nmdc:mga07m45_2016_c1 | nmdc:mga07m45_2016_c1_4603_5514 | 296 |
| 443 | 3300050496 | nmdc:mga07m45_3006_c1 | nmdc:mga07m45_3006_c1_512_1435 | 296 |
| 444 | 3300050507 | nmdc:mga05p37_12706_c1 | nmdc:mga05p37_12706_c1_6833_7753 | 296 |
| 445 | 3300050507 | nmdc:mga05p37_198027_c1 | nmdc:mga05p37_198027_c1_830_1729 | 296 |
| 446 | 3300050507 | nmdc:mga05p37_351599_c1 | nmdc:mga05p37_351599_c1_523_1425 | 296 |
| 447 | 3300050507 | nmdc:mga05p37_61662_c1 | nmdc:mga05p37_61662_c1_2380_3279 | 296 |
| 448 | 3300050508 | nmdc:mga09592_86625_c1 | nmdc:mga09592_86625_c1_250_1149 | 296 |
| 449 | 3300050508 | nmdc:mga09592_98997_c1 | nmdc:mga09592_98997_c1_1017_1937 | 296 |
| 450 | 3300050512 | nmdc:mga0n895_387825_c1 | nmdc:mga0n895_387825_c1_317_1216 | 296 |
| 451 | 3300050512 | nmdc:mga0n895_62203_c1 | nmdc:mga0n895_62203_c1_2362_3261 | 296 |
| 452 | 3300050515 | nmdc:mga0a205_202625_c1 | nmdc:mga0a205_202625_c1_895_1794 | 296 |
| 453 | 3300061734 | Ga0530510_0020627 | Ga0530510_0020627_2188_3093 | 296 |
| 454 | 3300061734 | Ga0530510_0262991 | Ga0530510_0262991_315_1214 | 296 |
| 455 | iso_pu_bacteria | 2513020051 | 2513230012 | 296 |
| 456 | iso_pu_bacteria | 2904541872 | 2904544094 | 296 |
| 457 | iso_pu_bacteria | 2929160207 | 2929162346 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bov-assembly2.cif.gz_B | crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution | 0.9657 | 2 | 290 |
| 5bov-assembly2.cif.gz_B | crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution | 0.94 | 2 | 290 |
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8877 | 1 | 123 |
| 4bat-assembly1.cif.gz_A-2 | structure of a putative epoxide hydrolase t131d mutant from pseudomonas aeruginosa. | 0.8578 | 1 | 292 |
| 4b9a-assembly1.cif.gz_A | structure of a putative epoxide hydrolase from pseudomonas aeruginosa. | 0.8552 | 1 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.965 | 2 | 290 | 3.40.50.1820 |
| 5bovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.933 | 2 | 290 | 3.40.50.1820 |
| af_Q4CQ94_14_186_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8744 | 10 | 123 | 3.40.50.12270 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8734 | 1 | 91 | 3.40.50.12270 |
| 5ng7B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8466 | 1 | 296 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H3G878-F1-model_v4 | Alpha/beta hydrolase fold | 1.002 | 3 | 99 |
GO:0016787
|
| AF-A0A352SAJ5-F1-model_v4 | Alpha/beta hydrolase | 0.9954 | 1 | 115 |
GO:0016020
GO:0046464 GO:0047372 |
| AF-A0A563EMW7-F1-model_v4 | Alpha/beta hydrolase | 0.9905 | 1 | 97 |
GO:0016787
|
| AF-A0A520HLZ4-F1-model_v4 | Alpha/beta hydrolase | 0.9904 | 1 | 226 |
GO:0016020
GO:0016787 |
| AF-A0A366KLG2-F1-model_v4 | Alpha/beta hydrolase | 0.99 | 1 | 290 |
GO:0016020
GO:0046464 GO:0047372 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar