F447948

General Info

Members Datasets Scaffolds Average Seq Length
457 245 914 201

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10003360|Ga0070709_100033604
Length 224
Sequence MIGAFFDLSGLGRDCGSGGPGNQRGRWGFDGFMNDFWGPGGGPRGRGWRARAGRVFEQGDLKYVILRLLAEKPRHGYEIIKELEERLSGAYAPSPGTVYPTLTMLEDLGYARAMPEEGGRKIYEITDEGRKHLEEHSATVDDIFERIAKFVEGFFDAPMADLKRSMASLGRATFYVASRSPNDRERIGRISEILKRAAAEIERLTQEDASSAKGSPGGGESPHP

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
229 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
230 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
231 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
234 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
235 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 2.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.88
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10003360 3300005434 Bacteria 8602
2 rootH1_10015618 3300003316 Bacteria 6452
3 Ga0058863_11977253 3300004799 Bacteria 668
4 Ga0058861_11619577 3300004800 Bacteria 666
5 Ga0058861_11694814 3300004800 Bacteria 743
6 Ga0058862_10061770 3300004803 Bacteria 784
7 Ga0058862_12829968 3300004803 Bacteria 665
8 Ga0065714_10169886 3300005288 Unclassified 1009
9 Ga0065712_10084196 3300005290 Bacteria 2775
10 Ga0070676_10017825 3300005328 Bacteria 3931
11 Ga0070683_100003676 3300005329 Bacteria 12511
12 Ga0070683_100005661 3300005329 Bacteria 10432
13 Ga0070683_100013000 3300005329 Bacteria 7247
14 Ga0070683_100024958 3300005329 Bacteria 5361
15 Ga0070683_100035280 3300005329 Bacteria 4572
16 Ga0070683_100040681 3300005329 Bacteria 4274
17 Ga0070683_100064414 3300005329 Bacteria 3412
18 Ga0070683_100548817 3300005329 Unclassified 1105
19 Ga0070690_100037596 3300005330 Bacteria 3052
20 Ga0070670_100171158 3300005331 Bacteria 1884
21 Ga0070670_100714700 3300005331 Bacteria 901
22 Ga0070677_10329500 3300005333 Bacteria 785
23 Ga0068869_100095203 3300005334 Bacteria 2247
24 Ga0070666_10222398 3300005335 Bacteria 1332
25 Ga0070680_100006326 3300005336 Bacteria 8993
26 Ga0070680_100013724 3300005336 Bacteria 6319
27 Ga0070680_100055061 3300005336 Bacteria 3250
28 Ga0070680_100216648 3300005336 Bacteria 1616
29 Ga0070682_100791970 3300005337 Bacteria 769
30 Ga0070682_100804645 3300005337 Bacteria 764
31 Ga0068868_100306119 3300005338 Bacteria 1351
32 Ga0070660_100057598 3300005339 Bacteria 3010
33 Ga0070660_100065609 3300005339 Bacteria 2825
34 Ga0070691_10060280 3300005341 Bacteria 1824
35 Ga0070691_10171094 3300005341 Bacteria 1126
36 Ga0070661_100007492 3300005344 Bacteria 7531
37 Ga0070661_100100345 3300005344 Bacteria 2152
38 Ga0070668_100046641 3300005347 Bacteria 3328
39 Ga0070669_100008451 3300005353 Bacteria 7349
40 Ga0070669_101100217 3300005353 Bacteria 684
41 Ga0070675_100018210 3300005354 Bacteria 5590
42 Ga0070673_100022050 3300005364 Bacteria 4629
43 Ga0070688_100029702 3300005365 Bacteria 3275
44 Ga0070688_100372235 3300005365 Bacteria 1051
45 Ga0070659_100462431 3300005366 Bacteria 1077
46 Ga0070659_100575062 3300005366 Bacteria 966
47 Ga0070667_100188887 3300005367 Bacteria 1824
48 Ga0070709_10065611 3300005434 Bacteria 2325
49 Ga0070709_10189723 3300005434 Bacteria 1449
50 Ga0070709_10301623 3300005434 Bacteria 1170
51 Ga0070709_10386742 3300005434 Bacteria 1041
52 Ga0070714_100019872 3300005435 Bacteria 5480
53 Ga0070714_100046449 3300005435 Bacteria 3684
54 Ga0070713_100000053 3300005436 Bacteria 71704
55 Ga0070713_100001087 3300005436 Bacteria 17404
56 Ga0070713_100061280 3300005436 Bacteria 3147
57 Ga0070713_100068426 3300005436 Bacteria 2992
58 Ga0070713_100118194 3300005436 Bacteria 2321
59 Ga0070713_100141187 3300005436 Bacteria 2134
60 Ga0070710_10028888 3300005437 Bacteria 2970
61 Ga0070710_10118192 3300005437 Bacteria 1601
62 Ga0070710_10299171 3300005437 Unclassified 1050
63 Ga0070701_10145883 3300005438 Bacteria 1358
64 Ga0070711_100091099 3300005439 Bacteria 2197
65 Ga0070711_100244712 3300005439 Bacteria 1404
66 Ga0070711_100311088 3300005439 Bacteria 1256
67 Ga0070711_100433202 3300005439 Unclassified 1074
68 Ga0070711_100590210 3300005439 Bacteria 926
69 Ga0070700_100355479 3300005441 Bacteria 1087
70 Ga0070708_100000113 3300005445 Bacteria 53689
71 Ga0070708_100664850 3300005445 Unclassified 981
72 Ga0070663_100011054 3300005455 Bacteria 5651
73 Ga0070662_100210968 3300005457 Unclassified 1545
74 Ga0070662_100342721 3300005457 Bacteria 1223
75 Ga0070681_10000907 3300005458 Bacteria 25041
76 Ga0070681_10003587 3300005458 Bacteria 14554
77 Ga0070681_10004399 3300005458 Bacteria 13422
78 Ga0070681_10456709 3300005458 Bacteria 1190
79 Ga0068867_100453991 3300005459 Bacteria 1093
80 Ga0068867_100850661 3300005459 Bacteria 817
81 Ga0070685_10027213 3300005466 Bacteria 3159
82 Ga0070707_100040533 3300005468 Bacteria 4456
83 Ga0070698_100008999 3300005471 Bacteria 10734
84 Ga0070699_100005086 3300005518 Bacteria 11578
85 Ga0070679_100000759 3300005530 Bacteria 27966
86 Ga0070679_100002807 3300005530 Bacteria 15823
87 Ga0070679_100016144 3300005530 Bacteria 7196
88 Ga0070679_100132274 3300005530 Bacteria 2476
89 Ga0070679_100181250 3300005530 Bacteria 2078
90 Ga0070679_100240535 3300005530 Unclassified 1768
91 Ga0070679_100243310 3300005530 Bacteria 1756
92 Ga0070679_100656155 3300005530 Bacteria 992
93 Ga0070679_100814179 3300005530 Bacteria 877
94 Ga0070684_100007616 3300005535 Bacteria 8440
95 Ga0070684_100015496 3300005535 Bacteria 6209
96 Ga0070684_100020969 3300005535 Bacteria 5426
97 Ga0070684_100142095 3300005535 Bacteria 2171
98 Ga0070684_100163354 3300005535 Bacteria 2021
99 Ga0070684_100337132 3300005535 Bacteria 1386
100 Ga0070684_100353817 3300005535 Unclassified 1351
101 Ga0070684_101318113 3300005535 Bacteria 680
102 Ga0070696_100006568 3300005546 Bacteria 7762
103 Ga0070693_100068906 3300005547 Bacteria 2078
104 Ga0070693_100184465 3300005547 Bacteria 1345
105 Ga0070665_100311213 3300005548 Bacteria 1579
106 Ga0070704_100405484 3300005549 Unclassified 1164
107 Ga0068855_100030450 3300005563 Bacteria 6455
108 Ga0068855_100066603 3300005563 Unclassified 4199
109 Ga0068855_100694319 3300005563 Bacteria 1089
110 Ga0070664_100622153 3300005564 Bacteria 1002
111 Ga0068857_100004919 3300005577 Bacteria 11339
112 Ga0068857_100141716 3300005577 Bacteria 2173
113 Ga0068854_100146454 3300005578 Bacteria 1817
114 Ga0068856_100032547 3300005614 Bacteria 5104
115 Ga0068856_100035169 3300005614 Bacteria 4909
116 Ga0068856_100070413 3300005614 Bacteria 3460
117 Ga0068856_100450583 3300005614 Bacteria 1308
118 Ga0068856_100871140 3300005614 Bacteria 920
119 Ga0068852_100001421 3300005616 Bacteria 16140
120 Ga0068852_100012815 3300005616 Bacteria 6389
121 Ga0068852_100076871 3300005616 Bacteria 2949
122 Ga0068852_100096962 3300005616 Bacteria 2652
123 Ga0068864_100033053 3300005618 Bacteria 4397
124 Ga0068864_100700890 3300005618 Bacteria 989
125 Ga0068870_10012143 3300005840 Bacteria 4017
126 Ga0068858_100207179 3300005842 Bacteria 1855
127 Ga0068860_100055708 3300005843 Bacteria 3759
128 Ga0068860_100303122 3300005843 Bacteria 1565
129 Ga0068862_100007973 3300005844 Bacteria 8760
130 Ga0070717_10042434 3300006028 Bacteria 3710
131 Ga0070717_10183103 3300006028 Bacteria 1827
132 Ga0070716_100206820 3300006173 Bacteria 1309
133 Ga0070712_100025940 3300006175 Bacteria 3900
134 Ga0070712_100144709 3300006175 Bacteria 1818
135 Ga0070712_100484302 3300006175 Unclassified 1035
136 Ga0097621_100168690 3300006237 Bacteria 1885
137 Ga0068871_100366497 3300006358 Bacteria 1277
138 Ga0075434_100188806 3300006871 Bacteria 2081
139 Ga0075434_100383524 3300006871 Unclassified 1426
140 Ga0068865_100196322 3300006881 Bacteria 1564
141 Ga0075436_100179932 3300006914 Bacteria 1494
142 Ga0105240_10128147 3300009093 Bacteria 3047
143 Ga0105240_10136470 3300009093 Bacteria 2937
144 Ga0105240_10218834 3300009093 Bacteria 2220
145 Ga0111539_10058837 3300009094 Bacteria 4558
146 Ga0105245_10122573 3300009098 Bacteria 2430
147 Ga0105245_10591946 3300009098 Bacteria 1135
148 Ga0105243_10558498 3300009148 Bacteria 1095
149 Ga0105241_10123180 3300009174 Bacteria 2091
150 Ga0105242_10520440 3300009176 Bacteria 1135
151 Ga0105237_10034964 3300009545 Bacteria 5085
152 Ga0105237_10056213 3300009545 Bacteria 3940
153 Ga0105237_10210352 3300009545 Bacteria 1945
154 Ga0105238_10881078 3300009551 Bacteria 913
155 Ga0105249_10000520 3300009553 Bacteria 35492
156 Ga0105246_10838937 3300011119 Bacteria 819
157 Ga0157373_10017062 3300013100 Bacteria 5287
158 Ga0157373_10087254 3300013100 Bacteria 2199
159 Ga0157371_10088581 3300013102 Bacteria 2192
160 Ga0157370_10029884 3300013104 Bacteria 5341
161 Ga0157370_10199154 3300013104 Unclassified 1858
162 Ga0157370_11332100 3300013104 Bacteria 647
163 Ga0157369_10084263 3300013105 Bacteria 3398
164 Ga0157369_10131627 3300013105 Bacteria 2650
165 Ga0157369_10446688 3300013105 Bacteria 1339
166 Ga0157369_10698052 3300013105 Bacteria 1045
167 Ga0157374_10289797 3300013296 Bacteria 1618
168 Ga0157374_10319333 3300013296 Bacteria 1539
169 Ga0157378_10513078 3300013297 Bacteria 1199
170 Ga0157378_11526436 3300013297 Unclassified 713
171 Ga0163162_10275753 3300013306 Bacteria 1814
172 Ga0163162_11481030 3300013306 Bacteria 773
173 Ga0157372_10017626 3300013307 Bacteria 7665
174 Ga0157372_10021490 3300013307 Bacteria 6973
175 Ga0157372_10031715 3300013307 Bacteria 5787
176 Ga0157372_10042318 3300013307 Bacteria 5038
177 Ga0157372_10177026 3300013307 Bacteria 2469
178 Ga0157372_10186555 3300013307 Bacteria 2402
179 Ga0157372_10381801 3300013307 Bacteria 1642
180 Ga0157375_10026374 3300013308 Bacteria 5413
181 Ga0157375_10104715 3300013308 Bacteria 2918
182 Ga0157375_10328415 3300013308 Bacteria 1694
183 Ga0157375_11365740 3300013308 Bacteria 834
184 Ga0163163_10418383 3300014325 Bacteria 1399
185 Ga0157380_10370934 3300014326 Bacteria 1347
186 Ga0157377_10148884 3300014745 Bacteria 1445
187 Ga0157376_10241692 3300014969 Bacteria 1682
188 Ga0182007_10113706 3300015262 Bacteria 902
189 Ga0163161_10269960 3300017792 Unclassified 1331
190 Ga0197907_10830244 3300020069 Bacteria 1452
191 Ga0206355_1332743 3300020076 Bacteria 717
192 Ga0206355_1505093 3300020076 Unclassified 692
193 Ga0206355_1608305 3300020076 Bacteria 1283
194 Ga0206350_11476450 3300020080 Bacteria 1050
195 Ga0224712_10054741 3300022467 Bacteria 1567
196 Ga0207697_10088870 3300025315 Bacteria 1308
197 Ga0207682_10134122 3300025893 Bacteria 1107
198 Ga0207692_10096452 3300025898 Bacteria 1615
199 Ga0207692_10101251 3300025898 Bacteria 1582
200 Ga0207692_10265547 3300025898 Unclassified 1033
201 Ga0207685_10148191 3300025905 Bacteria 1059
202 Ga0207699_10008933 3300025906 Bacteria 4969
203 Ga0207645_10136900 3300025907 Bacteria 1595
204 Ga0207645_10320211 3300025907 Bacteria 1034
205 Ga0207643_10012727 3300025908 Bacteria 4548
206 Ga0207643_10146428 3300025908 Unclassified 1413
207 Ga0207705_10010117 3300025909 Bacteria 6867
208 Ga0207705_10073600 3300025909 Bacteria 2479
209 Ga0207705_10160980 3300025909 Bacteria 1686
210 Ga0207707_10001270 3300025912 Bacteria 23535
211 Ga0207707_10007328 3300025912 Bacteria 9608
212 Ga0207707_10007601 3300025912 Bacteria 9445
213 Ga0207707_10020547 3300025912 Bacteria 5767
214 Ga0207695_10003339 3300025913 Bacteria 22724
215 Ga0207695_10007584 3300025913 Bacteria 13756
216 Ga0207695_10008185 3300025913 Bacteria 13135
217 Ga0207695_10041017 3300025913 Bacteria 4956
218 Ga0207695_10124424 3300025913 Bacteria 2542
219 Ga0207695_10271638 3300025913 Unclassified 1591
220 Ga0207693_10007415 3300025915 Bacteria 9019
221 Ga0207693_10007438 3300025915 Bacteria 9006
222 Ga0207693_10085042 3300025915 Bacteria 2478
223 Ga0207663_10153303 3300025916 Bacteria 1619
224 Ga0207663_10159297 3300025916 Bacteria 1591
225 Ga0207660_10000881 3300025917 Bacteria 19798
226 Ga0207660_10004492 3300025917 Bacteria 9100
227 Ga0207660_10017803 3300025917 Bacteria 4728
228 Ga0207657_10054347 3300025919 Bacteria 3463
229 Ga0207649_10257871 3300025920 Unclassified 1259
230 Ga0207649_10282986 3300025920 Bacteria 1206
231 Ga0207652_10000673 3300025921 Bacteria 33429
232 Ga0207652_10003499 3300025921 Bacteria 12946
233 Ga0207652_10053770 3300025921 Bacteria 3459
234 Ga0207652_10169077 3300025921 Bacteria 1961
235 Ga0207652_10185958 3300025921 Bacteria 1868
236 Ga0207652_10846156 3300025921 Bacteria 810
237 Ga0207646_10076800 3300025922 Bacteria 2985
238 Ga0207681_10030333 3300025923 Bacteria 3524
239 Ga0207681_10487192 3300025923 Bacteria 1008
240 Ga0207694_10999086 3300025924 Bacteria 708
241 Ga0207650_10430192 3300025925 Bacteria 1096
242 Ga0207650_10950468 3300025925 Bacteria 730
243 Ga0207687_10457883 3300025927 Bacteria 1059
244 Ga0207700_10000739 3300025928 Bacteria 18837
245 Ga0207700_10005937 3300025928 Bacteria 7347
246 Ga0207700_10006145 3300025928 Bacteria 7233
247 Ga0207700_10048213 3300025928 Bacteria 3162
248 Ga0207664_10016124 3300025929 Bacteria 5444
249 Ga0207664_10168851 3300025929 Bacteria 1871
250 Ga0207706_10166722 3300025933 Bacteria 1936
251 Ga0207706_10227466 3300025933 Unclassified 1632
252 Ga0207709_10281764 3300025935 Bacteria 1228
253 Ga0207665_10047638 3300025939 Bacteria 2874
254 Ga0207665_10146307 3300025939 Bacteria 1689
255 Ga0207691_10053871 3300025940 Bacteria 3671
256 Ga0207691_10137559 3300025940 Bacteria 2154
257 Ga0207689_10059262 3300025942 Bacteria 3149
258 Ga0207661_10003780 3300025944 Bacteria 10554
259 Ga0207661_10005876 3300025944 Bacteria 8661
260 Ga0207661_10022790 3300025944 Bacteria 4722
261 Ga0207661_10069477 3300025944 Bacteria 2872
262 Ga0207661_10102586 3300025944 Bacteria 2405
263 Ga0207661_10133033 3300025944 Bacteria 2133
264 Ga0207661_10199460 3300025944 Bacteria 1758
265 Ga0207661_10236134 3300025944 Unclassified 1621
266 Ga0207661_10319028 3300025944 Bacteria 1396
267 Ga0207661_10404995 3300025944 Bacteria 1237
268 Ga0207661_10450599 3300025944 Unclassified 1172
269 Ga0207661_10452938 3300025944 Bacteria 1169
270 Ga0207667_10030611 3300025949 Bacteria 5819
271 Ga0207667_10042400 3300025949 Bacteria 4837
272 Ga0207667_10099253 3300025949 Bacteria 3004
273 Ga0207667_10601675 3300025949 Bacteria 1109
274 Ga0207651_10054486 3300025960 Bacteria 2741
275 Ga0207712_10129543 3300025961 Unclassified 1920
276 Ga0207668_10236994 3300025972 Unclassified 1474
277 Ga0207640_10007518 3300025981 Bacteria 6016
278 Ga0207640_10008380 3300025981 Bacteria 5746
279 Ga0207677_10983655 3300026023 Bacteria 764
280 Ga0207703_10122405 3300026035 Bacteria 2235
281 Ga0207678_10001372 3300026067 Bacteria 22433
282 Ga0207708_10390507 3300026075 Unclassified 1149
283 Ga0207708_10463581 3300026075 Bacteria 1057
284 Ga0207702_10011410 3300026078 Bacteria 7406
285 Ga0207702_10020894 3300026078 Bacteria 5417
286 Ga0207702_10610229 3300026078 Bacteria 1071
287 Ga0207648_10195655 3300026089 Bacteria 1793
288 Ga0207676_10103807 3300026095 Bacteria 2363
289 Ga0207676_10770059 3300026095 Bacteria 937
290 Ga0207674_10033944 3300026116 Bacteria 5337
291 Ga0207683_10060970 3300026121 Bacteria 3318
292 Ga0207698_10077228 3300026142 Bacteria 2669
293 Ga0207698_10318875 3300026142 Bacteria 1455
294 Ga0268266_10715180 3300028379 Bacteria 966
295 Ga0268265_10038395 3300028380 Bacteria 3522
296 Ga0268264_10552571 3300028381 Bacteria 1129
297 Ga0307408_100495949 3300031548 Bacteria 1068
298 Ga0307408_101098842 3300031548 Bacteria 737
299 Ga0307405_10254622 3300031731 Bacteria 1308
300 Ga0307405_10462068 3300031731 Bacteria 1009
301 Ga0307405_10784857 3300031731 Bacteria 797
302 Ga0307413_10526108 3300031824 Bacteria 954
303 Ga0307410_10022408 3300031852 Bacteria 3904
304 Ga0307406_10442622 3300031901 Bacteria 1040
305 Ga0307407_10210651 3300031903 Bacteria 1308
306 Ga0307407_10482207 3300031903 Bacteria 906
307 Ga0307407_10977351 3300031903 Bacteria 653
308 Ga0307412_10677849 3300031911 Bacteria 882
309 Ga0307416_100797078 3300032002 Bacteria 1040
310 Ga0307416_101298787 3300032002 Bacteria 833
311 Ga0307414_10119033 3300032004 Bacteria 2027
312 Ga0307415_100821651 3300032126 Bacteria 850
313 Ga0373926_0025337 3300035083 Bacteria 2069
314 Ga0373934_0000804 3300035086 Bacteria 11307
315 Ga0373934_0001522 3300035086 Bacteria 8503
316 Ga0373944_0018841 3300035089 Bacteria 1975
317 Ga0373945_0010861 3300035116 Bacteria 3002
318 Ga0373953_0000442 3300035117 Bacteria 11371
319 Ga0373954_0061751 3300035118 Bacteria 1769
320 Ga0373956_0000206 3300035119 Bacteria 22898
321 Ga0373956_0023665 3300035119 Bacteria 2638
322 Ga0373956_0083441 3300035119 Bacteria 1468
323 Ga0373943_0006275 3300035170 Bacteria 5339
324 Ga0373946_0003240 3300035171 Bacteria 5781
325 Ga0373955_0006629 3300035172 Bacteria 5282
326 Ga0373955_0030070 3300035172 Bacteria 2832
327 Ga0373924_0004742 3300035410 Bacteria 4773
328 Ga0373935_0002361 3300035692 Bacteria 10784
329 Ga0373935_0135810 3300035692 Bacteria 1657
330 Ga0373935_0212832 3300035692 Unclassified 1340
331 Ga0373927_0003942 3300035695 Bacteria 10516
332 Ga0373927_0050175 3300035695 Bacteria 2698
333 Ga0373927_0053041 3300035695 Bacteria 2622
334 Ga0373927_0185651 3300035695 Bacteria 1364
335 Ga0373933_0001163 3300035724 Bacteria 15595
336 Ga0373933_0007827 3300035724 Bacteria 5838
337 Ga0373947_0006423 3300035725 Bacteria 6830
338 Ga0373947_0670482 3300035725 Unclassified 707
339 Ga0373937_0000392 3300036401 Bacteria 40806
340 Ga0373937_0001427 3300036401 Bacteria 19971
341 Ga0373937_0410030 3300036401 Bacteria 1286
342 Ga0373937_0448682 3300036401 Bacteria 1225
343 Ga0373937_0478705 3300036401 Bacteria 1182
344 Ga0373925_0022343 3300037068 Bacteria 4613
345 Ga0373925_0790231 3300037068 Bacteria 782
346 Ga0436365_0115051 3300039437 Bacteria 3209
347 Ga0466963_0556889 3300044694 Bacteria 810
348 Ga0466971_0173708 3300044719 Bacteria 1012
349 Ga0466959_0137560 3300045049 Bacteria 1728
350 Ga0466959_0727306 3300045049 Unclassified 665
351 Ga0495592_0002086 3300046454 Bacteria 14085
352 Ga0495592_0445445 3300046454 Unclassified 812
353 Ga0495603_0014617 3300046455 Bacteria 4746
354 Ga0495629_0002394 3300046459 Bacteria 14422
355 Ga0495629_0080459 3300046459 Bacteria 2275
356 Ga0495629_0602669 3300046459 Bacteria 734
357 Ga0495651_0000063 3300046462 Bacteria 78974
358 Ga0495651_0075455 3300046462 Bacteria 2556
359 Ga0495653_0000136 3300046463 Bacteria 60956
360 Ga0495580_0038641 3300046472 Bacteria 3417
361 Ga0495580_0142618 3300046472 Bacteria 1660
362 Ga0495580_0179929 3300046472 Bacteria 1460
363 Ga0495639_0037836 3300046475 Bacteria 2164
364 Ga0495664_0115252 3300046477 Bacteria 1624
365 Ga0495594_0004553 3300046499 Bacteria 7132
366 Ga0495594_0214639 3300046499 Bacteria 1097
367 Ga0495594_0254058 3300046499 Bacteria 1001
368 Ga0495608_0000059 3300046511 Bacteria 89203
369 Ga0495608_0095352 3300046511 Bacteria 1922
370 Ga0495628_0000089 3300046516 Bacteria 72154
371 Ga0495630_0001176 3300046517 Bacteria 18040
372 Ga0495630_0002077 3300046517 Bacteria 13924
373 Ga0495666_0114317 3300046526 Bacteria 1266
374 Ga0495652_0002861 3300046529 Bacteria 17404
375 Ga0495652_0365149 3300046529 Bacteria 1030
376 Ga0495665_0001767 3300046531 Bacteria 11640
377 Ga0495665_0004227 3300046531 Bacteria 7751
378 Ga0495665_0051706 3300046531 Bacteria 2176
379 Ga0495640_0081106 3300046533 Bacteria 2157
380 Ga0495586_0065912 3300046535 Bacteria 1974
381 Ga0495586_0263070 3300046535 Unclassified 985
382 Ga0495587_0010456 3300046536 Bacteria 5905
383 Ga0495587_0020483 3300046536 Bacteria 4082
384 Ga0495645_0000403 3300046543 Bacteria 29779
385 Ga0495645_0001488 3300046543 Bacteria 15874
386 Ga0495667_0000315 3300046559 Bacteria 30752
387 Ga0495667_0000452 3300046559 Bacteria 26227
388 Ga0495667_0097567 3300046559 Bacteria 1903
389 Ga0495634_0186806 3300046642 Bacteria 1295
390 Ga0495635_0000099 3300046663 Bacteria 51232
391 Ga0495588_0000407 3300046674 Bacteria 24010
392 Ga0495657_0000264 3300046675 Bacteria 47805
393 Ga0495657_0073021 3300046675 Bacteria 2236
394 Ga0495599_0004272 3300046678 Bacteria 8442
395 Ga0495599_0050038 3300046678 Bacteria 2619
396 Ga0495623_0027569 3300046679 Bacteria 3655
397 Ga0495646_0000340 3300046680 Bacteria 23878
398 Ga0495658_0000491 3300046683 Bacteria 21675
399 Ga0495658_0030698 3300046683 Bacteria 2921
400 Ga0495613_0086817 3300046689 Bacteria 2268
401 Ga0495581_0003168 3300047315 Bacteria 9420
402 Ga0495604_0001582 3300047317 Bacteria 18768
403 Ga0495636_0215502 3300047318 Bacteria 880
404 Ga0495674_0019388 3300047319 Bacteria 6312
405 Ga0495672_0004038 3300047320 Bacteria 12262
406 Ga0495680_0001807 3300047322 Bacteria 22598
407 Ga0495675_0025274 3300047444 Bacteria 3787
408 Ga0495675_0030193 3300047444 Bacteria 3458
409 Ga0495675_0077937 3300047444 Bacteria 2088
410 Ga0495675_0339272 3300047444 Unclassified 886
411 Ga0495684_0000616 3300047471 Bacteria 28627
412 Ga0495684_0480077 3300047471 Bacteria 858
413 Ga0495593_0028466 3300047673 Bacteria 3068
414 Ga0495593_0114722 3300047673 Bacteria 1374
415 Ga0495602_0131640 3300048088 Bacteria 1994
416 Ga0495614_0000226 3300048089 Bacteria 21863
417 Ga0496108_0246239 3300048911 Bacteria 1555
418 Ga0496112_0048092 3300048915 Bacteria 4183
419 Ga0496113_0039643 3300048916 Bacteria 3468
420 Ga0496115_0471414 3300048918 Bacteria 1012
421 Ga0501291_030948 3300049514 Bacteria 902
422 Ga0501292_036642 3300049515 Unclassified 838
423 Ga0501032_0190151 3300049569 Bacteria 1342
424 Ga0501033_0025914 3300049570 Bacteria 4415
425 Ga0501037_0178991 3300049573 Bacteria 1505
426 Ga0501038_0157120 3300049574 Bacteria 1851
427 Ga0501042_0423312 3300049578 Bacteria 965
428 Ga0501047_0075095 3300049581 Bacteria 3253
429 Ga0501047_0411427 3300049581 Bacteria 1185
430 Ga0501073_0036002 3300049589 Bacteria 3518
431 Ga0501073_0202379 3300049589 Bacteria 1373
432 Ga0501216_021795 3300049660 Bacteria 1129
433 Ga0501217_131929 3300049661 Unclassified 733
434 Ga0501227_080006 3300049665 Bacteria 856
435 Ga0501233_089601 3300049668 Unclassified 802
436 Ga0501249_085584 3300049679 Bacteria 744
437 Ga0501250_033251 3300049680 Bacteria 726
438 Ga0501257_080084 3300049686 Bacteria 841
439 Ga0501229_017013 3300049706 Unclassified 947
440 Ga0501035_0006707 3300049822 Bacteria 10760
441 Ga0501035_0033384 3300049822 Bacteria 4681
442 Ga0501044_0011147 3300049823 Bacteria 9748
443 Ga0501044_0054587 3300049823 Bacteria 4106
444 Ga0501044_0294049 3300049823 Bacteria 1555
445 nmdc:mga0qj67_2558_c1 3300050509 Bacteria 12999
446 nmdc:mga08y16_208693_c1 3300050511 Bacteria 2023
447 nmdc:mga0n895_141653_c1 3300050512 Unclassified 2433
448 nmdc:mga0n895_205609_c1 3300050512 Bacteria 1999
449 nmdc:mga08x19_55556_c1 3300050514 Bacteria 2552
450 Ga0495601_0001365 3300053077 Bacteria 13422
451 Ga0495601_0114655 3300053077 Unclassified 1747
452 Ga0495601_0244182 3300053077 Bacteria 1172
453 Ga0495612_0000239 3300053078 Bacteria 23019
454 Ga0495595_0013176 3300053084 Bacteria 3489
455 Ga0495595_0139733 3300053084 Unclassified 1188
456 Ga0495619_0000524 3300053085 Bacteria 25395
457 Ga0495619_0165602 3300053085 Bacteria 1528
458 Ga0070709_10003360
459 rootH1_10015618
460 Ga0058863_11977253
461 Ga0058861_11619577
462 Ga0058861_11694814
463 Ga0058862_10061770
464 Ga0058862_12829968
465 Ga0065714_10169886
466 Ga0065712_10084196
467 Ga0070676_10017825
468 Ga0070683_100003676
469 Ga0070683_100005661
470 Ga0070683_100013000
471 Ga0070683_100024958
472 Ga0070683_100035280
473 Ga0070683_100040681
474 Ga0070683_100064414
475 Ga0070683_100548817
476 Ga0070690_100037596
477 Ga0070670_100171158
478 Ga0070670_100714700
479 Ga0070677_10329500
480 Ga0068869_100095203
481 Ga0070666_10222398
482 Ga0070680_100006326
483 Ga0070680_100013724
484 Ga0070680_100055061
485 Ga0070680_100216648
486 Ga0070682_100791970
487 Ga0070682_100804645
488 Ga0068868_100306119
489 Ga0070660_100057598
490 Ga0070660_100065609
491 Ga0070691_10060280
492 Ga0070691_10171094
493 Ga0070661_100007492
494 Ga0070661_100100345
495 Ga0070668_100046641
496 Ga0070669_100008451
497 Ga0070669_101100217
498 Ga0070675_100018210
499 Ga0070673_100022050
500 Ga0070688_100029702
501 Ga0070688_100372235
502 Ga0070659_100462431
503 Ga0070659_100575062
504 Ga0070667_100188887
505 Ga0070709_10065611
506 Ga0070709_10189723
507 Ga0070709_10301623
508 Ga0070709_10386742
509 Ga0070714_100019872
510 Ga0070714_100046449
511 Ga0070713_100000053
512 Ga0070713_100001087
513 Ga0070713_100061280
514 Ga0070713_100068426
515 Ga0070713_100118194
516 Ga0070713_100141187
517 Ga0070710_10028888
518 Ga0070710_10118192
519 Ga0070710_10299171
520 Ga0070701_10145883
521 Ga0070711_100091099
522 Ga0070711_100244712
523 Ga0070711_100311088
524 Ga0070711_100433202
525 Ga0070711_100590210
526 Ga0070700_100355479
527 Ga0070708_100000113
528 Ga0070708_100664850
529 Ga0070663_100011054
530 Ga0070662_100210968
531 Ga0070662_100342721
532 Ga0070681_10000907
533 Ga0070681_10003587
534 Ga0070681_10004399
535 Ga0070681_10456709
536 Ga0068867_100453991
537 Ga0068867_100850661
538 Ga0070685_10027213
539 Ga0070707_100040533
540 Ga0070698_100008999
541 Ga0070699_100005086
542 Ga0070679_100000759
543 Ga0070679_100002807
544 Ga0070679_100016144
545 Ga0070679_100132274
546 Ga0070679_100181250
547 Ga0070679_100240535
548 Ga0070679_100243310
549 Ga0070679_100656155
550 Ga0070679_100814179
551 Ga0070684_100007616
552 Ga0070684_100015496
553 Ga0070684_100020969
554 Ga0070684_100142095
555 Ga0070684_100163354
556 Ga0070684_100337132
557 Ga0070684_100353817
558 Ga0070684_101318113
559 Ga0070696_100006568
560 Ga0070693_100068906
561 Ga0070693_100184465
562 Ga0070665_100311213
563 Ga0070704_100405484
564 Ga0068855_100030450
565 Ga0068855_100066603
566 Ga0068855_100694319
567 Ga0070664_100622153
568 Ga0068857_100004919
569 Ga0068857_100141716
570 Ga0068854_100146454
571 Ga0068856_100032547
572 Ga0068856_100035169
573 Ga0068856_100070413
574 Ga0068856_100450583
575 Ga0068856_100871140
576 Ga0068852_100001421
577 Ga0068852_100012815
578 Ga0068852_100076871
579 Ga0068852_100096962
580 Ga0068864_100033053
581 Ga0068864_100700890
582 Ga0068870_10012143
583 Ga0068858_100207179
584 Ga0068860_100055708
585 Ga0068860_100303122
586 Ga0068862_100007973
587 Ga0070717_10042434
588 Ga0070717_10183103
589 Ga0070716_100206820
590 Ga0070712_100025940
591 Ga0070712_100144709
592 Ga0070712_100484302
593 Ga0097621_100168690
594 Ga0068871_100366497
595 Ga0075434_100188806
596 Ga0075434_100383524
597 Ga0068865_100196322
598 Ga0075436_100179932
599 Ga0105240_10128147
600 Ga0105240_10136470
601 Ga0105240_10218834
602 Ga0111539_10058837
603 Ga0105245_10122573
604 Ga0105245_10591946
605 Ga0105243_10558498
606 Ga0105241_10123180
607 Ga0105242_10520440
608 Ga0105237_10034964
609 Ga0105237_10056213
610 Ga0105237_10210352
611 Ga0105238_10881078
612 Ga0105249_10000520
613 Ga0105246_10838937
614 Ga0157373_10017062
615 Ga0157373_10087254
616 Ga0157371_10088581
617 Ga0157370_10029884
618 Ga0157370_10199154
619 Ga0157370_11332100
620 Ga0157369_10084263
621 Ga0157369_10131627
622 Ga0157369_10446688
623 Ga0157369_10698052
624 Ga0157374_10289797
625 Ga0157374_10319333
626 Ga0157378_10513078
627 Ga0157378_11526436
628 Ga0163162_10275753
629 Ga0163162_11481030
630 Ga0157372_10017626
631 Ga0157372_10021490
632 Ga0157372_10031715
633 Ga0157372_10042318
634 Ga0157372_10177026
635 Ga0157372_10186555
636 Ga0157372_10381801
637 Ga0157375_10026374
638 Ga0157375_10104715
639 Ga0157375_10328415
640 Ga0157375_11365740
641 Ga0163163_10418383
642 Ga0157380_10370934
643 Ga0157377_10148884
644 Ga0157376_10241692
645 Ga0182007_10113706
646 Ga0163161_10269960
647 Ga0197907_10830244
648 Ga0206355_1332743
649 Ga0206355_1505093
650 Ga0206355_1608305
651 Ga0206350_11476450
652 Ga0224712_10054741
653 Ga0207697_10088870
654 Ga0207682_10134122
655 Ga0207692_10096452
656 Ga0207692_10101251
657 Ga0207692_10265547
658 Ga0207685_10148191
659 Ga0207699_10008933
660 Ga0207645_10136900
661 Ga0207645_10320211
662 Ga0207643_10012727
663 Ga0207643_10146428
664 Ga0207705_10010117
665 Ga0207705_10073600
666 Ga0207705_10160980
667 Ga0207707_10001270
668 Ga0207707_10007328
669 Ga0207707_10007601
670 Ga0207707_10020547
671 Ga0207695_10003339
672 Ga0207695_10007584
673 Ga0207695_10008185
674 Ga0207695_10041017
675 Ga0207695_10124424
676 Ga0207695_10271638
677 Ga0207693_10007415
678 Ga0207693_10007438
679 Ga0207693_10085042
680 Ga0207663_10153303
681 Ga0207663_10159297
682 Ga0207660_10000881
683 Ga0207660_10004492
684 Ga0207660_10017803
685 Ga0207657_10054347
686 Ga0207649_10257871
687 Ga0207649_10282986
688 Ga0207652_10000673
689 Ga0207652_10003499
690 Ga0207652_10053770
691 Ga0207652_10169077
692 Ga0207652_10185958
693 Ga0207652_10846156
694 Ga0207646_10076800
695 Ga0207681_10030333
696 Ga0207681_10487192
697 Ga0207694_10999086
698 Ga0207650_10430192
699 Ga0207650_10950468
700 Ga0207687_10457883
701 Ga0207700_10000739
702 Ga0207700_10005937
703 Ga0207700_10006145
704 Ga0207700_10048213
705 Ga0207664_10016124
706 Ga0207664_10168851
707 Ga0207706_10166722
708 Ga0207706_10227466
709 Ga0207709_10281764
710 Ga0207665_10047638
711 Ga0207665_10146307
712 Ga0207691_10053871
713 Ga0207691_10137559
714 Ga0207689_10059262
715 Ga0207661_10003780
716 Ga0207661_10005876
717 Ga0207661_10022790
718 Ga0207661_10069477
719 Ga0207661_10102586
720 Ga0207661_10133033
721 Ga0207661_10199460
722 Ga0207661_10236134
723 Ga0207661_10319028
724 Ga0207661_10404995
725 Ga0207661_10450599
726 Ga0207661_10452938
727 Ga0207667_10030611
728 Ga0207667_10042400
729 Ga0207667_10099253
730 Ga0207667_10601675
731 Ga0207651_10054486
732 Ga0207712_10129543
733 Ga0207668_10236994
734 Ga0207640_10007518
735 Ga0207640_10008380
736 Ga0207677_10983655
737 Ga0207703_10122405
738 Ga0207678_10001372
739 Ga0207708_10390507
740 Ga0207708_10463581
741 Ga0207702_10011410
742 Ga0207702_10020894
743 Ga0207702_10610229
744 Ga0207648_10195655
745 Ga0207676_10103807
746 Ga0207676_10770059
747 Ga0207674_10033944
748 Ga0207683_10060970
749 Ga0207698_10077228
750 Ga0207698_10318875
751 Ga0268266_10715180
752 Ga0268265_10038395
753 Ga0268264_10552571
754 Ga0307408_100495949
755 Ga0307408_101098842
756 Ga0307405_10254622
757 Ga0307405_10462068
758 Ga0307405_10784857
759 Ga0307413_10526108
760 Ga0307410_10022408
761 Ga0307406_10442622
762 Ga0307407_10210651
763 Ga0307407_10482207
764 Ga0307407_10977351
765 Ga0307412_10677849
766 Ga0307416_100797078
767 Ga0307416_101298787
768 Ga0307414_10119033
769 Ga0307415_100821651
770 Ga0373926_0025337
771 Ga0373934_0000804
772 Ga0373934_0001522
773 Ga0373944_0018841
774 Ga0373945_0010861
775 Ga0373953_0000442
776 Ga0373954_0061751
777 Ga0373956_0000206
778 Ga0373956_0023665
779 Ga0373956_0083441
780 Ga0373943_0006275
781 Ga0373946_0003240
782 Ga0373955_0006629
783 Ga0373955_0030070
784 Ga0373924_0004742
785 Ga0373935_0002361
786 Ga0373935_0135810
787 Ga0373935_0212832
788 Ga0373927_0003942
789 Ga0373927_0050175
790 Ga0373927_0053041
791 Ga0373927_0185651
792 Ga0373933_0001163
793 Ga0373933_0007827
794 Ga0373947_0006423
795 Ga0373947_0670482
796 Ga0373937_0000392
797 Ga0373937_0001427
798 Ga0373937_0410030
799 Ga0373937_0448682
800 Ga0373937_0478705
801 Ga0373925_0022343
802 Ga0373925_0790231
803 Ga0436365_0115051
804 Ga0466963_0556889
805 Ga0466971_0173708
806 Ga0466959_0137560
807 Ga0466959_0727306
808 Ga0495592_0002086
809 Ga0495592_0445445
810 Ga0495603_0014617
811 Ga0495629_0002394
812 Ga0495629_0080459
813 Ga0495629_0602669
814 Ga0495651_0000063
815 Ga0495651_0075455
816 Ga0495653_0000136
817 Ga0495580_0038641
818 Ga0495580_0142618
819 Ga0495580_0179929
820 Ga0495639_0037836
821 Ga0495664_0115252
822 Ga0495594_0004553
823 Ga0495594_0214639
824 Ga0495594_0254058
825 Ga0495608_0000059
826 Ga0495608_0095352
827 Ga0495628_0000089
828 Ga0495630_0001176
829 Ga0495630_0002077
830 Ga0495666_0114317
831 Ga0495652_0002861
832 Ga0495652_0365149
833 Ga0495665_0001767
834 Ga0495665_0004227
835 Ga0495665_0051706
836 Ga0495640_0081106
837 Ga0495586_0065912
838 Ga0495586_0263070
839 Ga0495587_0010456
840 Ga0495587_0020483
841 Ga0495645_0000403
842 Ga0495645_0001488
843 Ga0495667_0000315
844 Ga0495667_0000452
845 Ga0495667_0097567
846 Ga0495634_0186806
847 Ga0495635_0000099
848 Ga0495588_0000407
849 Ga0495657_0000264
850 Ga0495657_0073021
851 Ga0495599_0004272
852 Ga0495599_0050038
853 Ga0495623_0027569
854 Ga0495646_0000340
855 Ga0495658_0000491
856 Ga0495658_0030698
857 Ga0495613_0086817
858 Ga0495581_0003168
859 Ga0495604_0001582
860 Ga0495636_0215502
861 Ga0495674_0019388
862 Ga0495672_0004038
863 Ga0495680_0001807
864 Ga0495675_0025274
865 Ga0495675_0030193
866 Ga0495675_0077937
867 Ga0495675_0339272
868 Ga0495684_0000616
869 Ga0495684_0480077
870 Ga0495593_0028466
871 Ga0495593_0114722
872 Ga0495602_0131640
873 Ga0495614_0000226
874 Ga0496108_0246239
875 Ga0496112_0048092
876 Ga0496113_0039643
877 Ga0496115_0471414
878 Ga0501291_030948
879 Ga0501292_036642
880 Ga0501032_0190151
881 Ga0501033_0025914
882 Ga0501037_0178991
883 Ga0501038_0157120
884 Ga0501042_0423312
885 Ga0501047_0075095
886 Ga0501047_0411427
887 Ga0501073_0036002
888 Ga0501073_0202379
889 Ga0501216_021795
890 Ga0501217_131929
891 Ga0501227_080006
892 Ga0501233_089601
893 Ga0501249_085584
894 Ga0501250_033251
895 Ga0501257_080084
896 Ga0501229_017013
897 Ga0501035_0006707
898 Ga0501035_0033384
899 Ga0501044_0011147
900 Ga0501044_0054587
901 Ga0501044_0294049
902 nmdc:mga0qj67_2558_c1
903 nmdc:mga08y16_208693_c1
904 nmdc:mga0n895_141653_c1
905 nmdc:mga0n895_205609_c1
906 nmdc:mga08x19_55556_c1
907 Ga0495601_0001365
908 Ga0495601_0114655
909 Ga0495601_0244182
910 Ga0495612_0000239
911 Ga0495595_0013176
912 Ga0495595_0139733
913 Ga0495619_0000524
914 Ga0495619_0165602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

65

135

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9106 43 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9037 43 125
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8974 42 109
5x11-assembly4.cif.gz_G crystal structure of bacillus subtilis padr in complex with operator dna 0.8896 45 119
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8747 43 125
ID Description Score Start End Superfamily
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9575 41 135 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 45 124 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9106 43 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9048 45 119 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8974 42 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A536KU35-F1-model_v4 PadR family transcriptional regulator 0.9613 43 133
AF-A0A6G3XNT8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.948 41 134
AF-A0A662R1P3-F1-model_v4 PadR family transcriptional regulator 0.9389 42 125
AF-A0A538IKH6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9348 46 119
AF-A0A7W6QPN8-F1-model_v4 deleted 0.9283 40 140

Map