metagRoot

F447374

General Info

Members	Datasets	Scaffolds	Average Seq Length
454	250	448	252

Family's Representative Sequence

Representative Sequence	3300009176\|Ga0105242_10005862\|Ga0105242_100058625
Length	269
Sequence	VAAVHFSTAWNSGSLVAARIMPLRLEAFEQLPKHARRCVFWEVDPSTLQADDHLSDPEFEKEAWLSMVMLEWGSCGQIAVHCHDGAAAVGDADPAMPLGLGDDPCLGYAFYAPPGAVPRARRFPTGPVSADAVLLTSLGVEPGHDADGLSRHLIASVVGDLVRRGVRALEAFGHTAEVTELQDPRLVSPELRPVVEVLGDCSVDQCVLDADLLQDAGFVVVTHHRYFPRLRLELEQGLGWKADVEAALERLLESAQLQQPVGAGAGPCV

Samples

	Sample ID	Description	Type	Environment
1	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
2	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
3	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
4	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
5	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
6	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
7	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
8	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
9	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
10	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
11	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
12	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
13	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
19	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
20	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
21	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
27	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
28	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
29	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
32	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
33	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
34	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
35	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
36	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
37	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
38	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
47	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
48	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
49	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
50	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
51	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
60	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
61	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
64	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
65	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
70	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
76	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
78	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
79	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
80	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
81	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
96	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
97	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
98	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
99	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
100	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
101	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
102	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
103	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
104	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
107	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
108	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
157	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
158	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
159	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
160	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
161	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
162	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
163	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
164	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
165	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
166	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
167	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
168	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
169	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
170	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
171	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
172	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
173	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
174	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
175	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
176	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
177	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
178	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
179	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
180	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
181	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
182	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
183	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
184	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
185	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
186	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
187	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
188	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
189	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
190	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
191	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
192	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
193	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
194	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
195	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
196	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
197	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
198	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
199	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
200	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
201	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
202	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
203	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
204	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
205	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
206	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
207	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
208	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
209	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
210	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
211	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
212	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
213	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
214	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
215	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
216	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
217	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
218	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
219	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
220	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
221	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
222	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
223	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
224	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
225	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
226	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
227	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
228	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
229	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
230	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
232	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
233	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
234	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
235	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
236	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
237	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
238	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
239	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
240	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
241	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
242	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
243	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
244	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
245	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
246	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
247	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
248	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
249	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
250	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.68
Metatranscriptomes	0
Isolates	1.32

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.76
Nodule	0.22
Rhizoplane	12.11
Rhizosphere	69.16
Stem	0
Stem Tuber	0
Unclassified	3.74

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1004683	3300001977	Bacteria	2151
2	JGI24744J21845_10000568	3300002077	Bacteria	6665
3	JGI24744J21845_10004392	3300002077	Bacteria	2914
4	JGI24744J21845_10006279	3300002077	Bacteria	2468
5	JGI24034J26672_10009979	3300002239	Bacteria	1407
6	JGI24742J22300_10014677	3300002244	Bacteria	1316
7	Ga0070676_10019956	3300005328	Bacteria	3735
8	Ga0070683_100411563	3300005329	Bacteria	1290
9	Ga0070690_100005958	3300005330	Bacteria	6883
10	Ga0068869_100006256	3300005334	Bacteria	7541
11	Ga0068869_100029943	3300005334	Bacteria	3818
12	Ga0070666_10155305	3300005335	Bacteria	1598
13	Ga0070666_10339083	3300005335	Bacteria	1074
14	Ga0070682_100157245	3300005337	Bacteria	1566
15	Ga0068868_100000374	3300005338	Bacteria	30518
16	Ga0068868_100090444	3300005338	Bacteria	2465
17	Ga0070660_100528538	3300005339	Bacteria	983
18	Ga0070689_100002806	3300005340	Bacteria	11452
19	Ga0070691_10006168	3300005341	Bacteria	5470
20	Ga0070692_10039925	3300005345	Bacteria	2398
21	Ga0070668_100000344	3300005347	Bacteria	30716
22	Ga0070668_100010905	3300005347	Bacteria	6762
23	Ga0070668_100077002	3300005347	Bacteria	2607
24	Ga0070668_100133888	3300005347	Bacteria	1991
25	Ga0070669_100011727	3300005353	Bacteria	6217
26	Ga0070675_100195792	3300005354	Bacteria	1753
27	Ga0070671_100002457	3300005355	Bacteria	14328
28	Ga0070674_100002532	3300005356	Bacteria	10122
29	Ga0070673_100074522	3300005364	Bacteria	2735
30	Ga0070688_100003217	3300005365	Bacteria	8372
31	Ga0070659_100023888	3300005366	Bacteria	4683
32	Ga0070667_100013056	3300005367	Bacteria	6866
33	Ga0070667_100157008	3300005367	Bacteria	2001
34	Ga0070709_10015671	3300005434	Bacteria	4317
35	Ga0070714_100117205	3300005435	Bacteria	2365
36	Ga0070710_10000616	3300005437	Bacteria	16947
37	Ga0070701_10002338	3300005438	Bacteria	7274
38	Ga0070701_10138877	3300005438	Bacteria	1387
39	Ga0070711_100001704	3300005439	Bacteria	12183
40	Ga0070711_100445023	3300005439	Bacteria	1060
41	Ga0070705_100023931	3300005440	Bacteria	3288
42	Ga0070700_100001450	3300005441	Bacteria	11795
43	Ga0070700_100225477	3300005441	Bacteria	1330
44	Ga0070694_100018759	3300005444	Bacteria	4395
45	Ga0070663_100090891	3300005455	Bacteria	2261
46	Ga0070678_100000071	3300005456	Bacteria	37677
47	Ga0070662_100006383	3300005457	Bacteria	7596
48	Ga0070662_100193855	3300005457	Bacteria	1609
49	Ga0068867_100064029	3300005459	Bacteria	2733
50	Ga0070685_10044733	3300005466	Bacteria	2536
51	Ga0070706_100357571	3300005467	Bacteria	1361
52	Ga0070684_100092288	3300005535	Bacteria	2694
53	Ga0068853_100003320	3300005539	Bacteria	12314
54	Ga0070672_100124704	3300005543	Bacteria	2111
55	Ga0070686_100077421	3300005544	Bacteria	2193
56	Ga0070695_100011954	3300005545	Bacteria	5198
57	Ga0070695_100288588	3300005545	Bacteria	1208
58	Ga0070696_100001427	3300005546	Bacteria	15632
59	Ga0070693_100031371	3300005547	Bacteria	2911
60	Ga0070665_100002637	3300005548	Bacteria	19537
61	Ga0070665_100021813	3300005548	Bacteria	6439
62	Ga0070665_100402499	3300005548	Bacteria	1377
63	Ga0070704_100000466	3300005549	Bacteria	19063
64	Ga0070704_100036495	3300005549	Bacteria	3350
65	Ga0068854_100000231	3300005578	Bacteria	37887
66	Ga0068854_100054711	3300005578	Bacteria	2871
67	Ga0068856_100294149	3300005614	Bacteria	1641
68	Ga0068856_100558460	3300005614	Bacteria	1166
69	Ga0070702_100012114	3300005615	Bacteria	4308
70	Ga0068859_100044097	3300005617	Bacteria	4482
71	Ga0068864_100079291	3300005618	Bacteria	2875
72	Ga0068864_100144686	3300005618	Bacteria	2148
73	Ga0068866_10000141	3300005718	Bacteria	32353
74	Ga0068866_10089180	3300005718	Bacteria	1675
75	Ga0068861_100000275	3300005719	Bacteria	28838
76	Ga0068851_10186648	3300005834	Bacteria	1151
77	Ga0068858_100000584	3300005842	Bacteria	38255
78	Ga0068858_100586224	3300005842	Bacteria	1081
79	Ga0068860_100003733	3300005843	Bacteria	15665
80	Ga0068862_100008481	3300005844	Bacteria	8500
81	Ga0068862_100304588	3300005844	Bacteria	1467
82	Ga0081455_10021191	3300005937	Bacteria	6104
83	Ga0081455_10069729	3300005937	Bacteria	2922
84	Ga0075365_10012089	3300006038	Bacteria	5109
85	Ga0075365_10018503	3300006038	Bacteria	4285
86	Ga0075365_10082651	3300006038	Bacteria	2178
87	Ga0075365_10254714	3300006038	Bacteria	1234
88	Ga0075368_10002283	3300006042	Bacteria	6230
89	Ga0075363_100002905	3300006048	Bacteria	7141
90	Ga0075363_100008021	3300006048	Bacteria	4894
91	Ga0075363_100009646	3300006048	Bacteria	4545
92	Ga0075363_100010984	3300006048	Bacteria	4322
93	Ga0075363_100068564	3300006048	Bacteria	1924
94	Ga0075363_100335576	3300006048	Bacteria	881
95	Ga0075364_10000797	3300006051	Bacteria	16635
96	Ga0075364_10006566	3300006051	Bacteria	6844
97	Ga0075364_10049842	3300006051	Bacteria	2732
98	Ga0075364_10068805	3300006051	Bacteria	2329
99	Ga0075364_10178929	3300006051	Bacteria	1434
100	Ga0075364_10208777	3300006051	Bacteria	1324
101	Ga0070715_10018033	3300006163	Bacteria	2683
102	Ga0070716_100012697	3300006173	Bacteria	4275
103	Ga0070712_100001124	3300006175	Bacteria	16097
104	Ga0075362_10007725	3300006177	Bacteria	4085
105	Ga0075362_10039602	3300006177	Bacteria	2073
106	Ga0075362_10145170	3300006177	Bacteria	1136
107	Ga0075367_10002406	3300006178	Bacteria	8544
108	Ga0075369_10000468	3300006186	Bacteria	12412
109	Ga0075369_10005734	3300006186	Bacteria	4660
110	Ga0075369_10012506	3300006186	Bacteria	3354
111	Ga0075369_10029796	3300006186	Bacteria	2295
112	Ga0075369_10093875	3300006186	Bacteria	1341
113	Ga0097621_100032241	3300006237	Bacteria	4164
114	Ga0097621_100207534	3300006237	Bacteria	1703
115	Ga0075370_10005141	3300006353	Bacteria	6456
116	Ga0075370_10024989	3300006353	Bacteria	3302
117	Ga0075370_10025257	3300006353	Bacteria	3285
118	Ga0075370_10027513	3300006353	Bacteria	3156
119	Ga0075370_10052461	3300006353	Bacteria	2314
120	Ga0075428_100005428	3300006844	Bacteria	14163
121	Ga0075430_100010682	3300006846	Bacteria	7780
122	Ga0075431_100191953	3300006847	Bacteria	2093
123	Ga0068865_100000173	3300006881	Bacteria	35759
124	Ga0068865_100017932	3300006881	Bacteria	4561
125	Ga0068865_100114845	3300006881	Bacteria	1992
126	Ga0097620_100044095	3300006931	Bacteria	4482
127	Ga0105250_10046529	3300009092	Bacteria	1740
128	Ga0105250_10052247	3300009092	Bacteria	1640
129	Ga0105245_10000930	3300009098	Bacteria	26598
130	Ga0105245_10081391	3300009098	Bacteria	2960
131	Ga0105247_10001839	3300009101	Bacteria	14839
132	Ga0105247_10043113	3300009101	Bacteria	2764
133	Ga0105247_10165316	3300009101	Bacteria	1468
134	Ga0114129_10018613	3300009147	Bacteria	9887
135	Ga0105243_10000071	3300009148	Bacteria	118865
136	Ga0105243_10000506	3300009148	Bacteria	39770
137	Ga0105241_10036523	3300009174	Bacteria	3698
138	Ga0105241_10622314	3300009174	Bacteria	977
139	Ga0105242_10005862	3300009176	Bacteria	9469
140	Ga0105242_10558199	3300009176	Bacteria	1099
141	Ga0105248_10002906	3300009177	Bacteria	19012
142	Ga0105248_10178199	3300009177	Bacteria	2395
143	Ga0105248_10479527	3300009177	Bacteria	1402
144	Ga0105237_10005411	3300009545	Bacteria	14418
145	Ga0105238_10047032	3300009551	Bacteria	4351
146	Ga0105238_10180747	3300009551	Bacteria	2086
147	Ga0105249_10004819	3300009553	Bacteria	11641
148	Ga0105249_10011185	3300009553	Bacteria	7882
149	Ga0105249_10866536	3300009553	Bacteria	969
150	Ga0105239_10024997	3300010375	Bacteria	6579
151	Ga0105239_10041945	3300010375	Bacteria	5014
152	Ga0105246_10013016	3300011119	Bacteria	5204
153	Ga0105246_10072358	3300011119	Bacteria	2430
154	Ga0105246_10290829	3300011119	Bacteria	1315
155	Ga0157369_10777728	3300013105	Bacteria	984
156	Ga0157374_10005644	3300013296	Bacteria	10550
157	Ga0157374_10121169	3300013296	Bacteria	2525
158	Ga0157378_10000789	3300013297	Bacteria	29409
159	Ga0157378_10109587	3300013297	Bacteria	2529
160	Ga0163162_10086388	3300013306	Bacteria	3215
161	Ga0163162_10604005	3300013306	Bacteria	1223
162	Ga0163162_11155680	3300013306	Bacteria	878
163	Ga0157372_10006182	3300013307	Bacteria	12732
164	Ga0157372_10202250	3300013307	Bacteria	2301
165	Ga0157372_10208809	3300013307	Bacteria	2263
166	Ga0157375_10082546	3300013308	Bacteria	3256
167	Ga0163163_10116953	3300014325	Bacteria	2698
168	Ga0157380_10002911	3300014326	Bacteria	11641
169	Ga0157380_10046709	3300014326	Bacteria	3403
170	Ga0157380_10102671	3300014326	Bacteria	2384
171	Ga0157377_10014604	3300014745	Bacteria	3998
172	Ga0157379_10003998	3300014968	Bacteria	12573
173	Ga0157379_10040476	3300014968	Bacteria	4160
174	Ga0163161_10005518	3300017792	Bacteria	8764
175	Ga0163161_10027396	3300017792	Bacteria	4042
176	Ga0163161_10123061	3300017792	Bacteria	1951
177	Ga0213875_10046483	3300021388	Bacteria	2037
178	Ga0207653_10081899	3300025885	Bacteria	1119
179	Ga0207692_10019742	3300025898	Bacteria	3051
180	Ga0207692_10295531	3300025898	Bacteria	984
181	Ga0207642_10000110	3300025899	Bacteria	22139
182	Ga0207710_10001641	3300025900	Bacteria	10919
183	Ga0207710_10050348	3300025900	Bacteria	1869
184	Ga0207688_10000851	3300025901	Bacteria	15377
185	Ga0207688_10005366	3300025901	Bacteria	6961
186	Ga0207680_10094376	3300025903	Bacteria	1910
187	Ga0207647_10024570	3300025904	Bacteria	3972
188	Ga0207685_10001807	3300025905	Bacteria	4661
189	Ga0207699_10020268	3300025906	Bacteria	3560
190	Ga0207699_10039937	3300025906	Bacteria	2700
191	Ga0207645_10004740	3300025907	Bacteria	10010
192	Ga0207643_10106889	3300025908	Bacteria	1645
193	Ga0207654_10309897	3300025911	Bacteria	1076
194	Ga0207671_10016932	3300025914	Bacteria	5642
195	Ga0207671_10636093	3300025914	Bacteria	850
196	Ga0207693_10000700	3300025915	Bacteria	30108
197	Ga0207693_10000722	3300025915	Bacteria	29774
198	Ga0207663_10033898	3300025916	Bacteria	3047
199	Ga0207662_10062405	3300025918	Bacteria	2239
200	Ga0207681_10070568	3300025923	Bacteria	2433
201	Ga0207687_10000624	3300025927	Bacteria	23891
202	Ga0207687_10021991	3300025927	Bacteria	4241
203	Ga0207644_10002196	3300025931	Bacteria	12655
204	Ga0207690_10106121	3300025932	Bacteria	2015
205	Ga0207706_10018131	3300025933	Bacteria	6334
206	Ga0207706_10072823	3300025933	Bacteria	3021
207	Ga0207686_10004217	3300025934	Bacteria	7709
208	Ga0207686_10358292	3300025934	Bacteria	1100
209	Ga0207709_10000967	3300025935	Bacteria	21449
210	Ga0207709_10007511	3300025935	Bacteria	6067
211	Ga0207669_10000732	3300025937	Bacteria	14229
212	Ga0207704_10000669	3300025938	Bacteria	15186
213	Ga0207665_10005059	3300025939	Bacteria	8800
214	Ga0207691_10131374	3300025940	Bacteria	2212
215	Ga0207711_10003239	3300025941	Bacteria	14186
216	Ga0207711_10052982	3300025941	Bacteria	3479
217	Ga0207711_10329625	3300025941	Bacteria	1412
218	Ga0207689_10011382	3300025942	Bacteria	7623
219	Ga0207689_10026364	3300025942	Bacteria	4866
220	Ga0207661_10293011	3300025944	Bacteria	1457
221	Ga0207651_10031318	3300025960	Bacteria	3398
222	Ga0207712_10000899	3300025961	Bacteria	21571
223	Ga0207712_10043000	3300025961	Bacteria	3114
224	Ga0207668_10002090	3300025972	Bacteria	11650
225	Ga0207668_10006512	3300025972	Bacteria	6900
226	Ga0207668_10073041	3300025972	Bacteria	2457
227	Ga0207668_10242700	3300025972	Bacteria	1458
228	Ga0207668_10404419	3300025972	Bacteria	1155
229	Ga0207658_10015597	3300025986	Bacteria	5213
230	Ga0207658_10249279	3300025986	Bacteria	1508
231	Ga0207677_10000773	3300026023	Bacteria	18379
232	Ga0207677_10103450	3300026023	Bacteria	2102
233	Ga0207703_10009155	3300026035	Bacteria	7795
234	Ga0207703_10483501	3300026035	Bacteria	1160
235	Ga0207639_10021117	3300026041	Bacteria	4672
236	Ga0207639_10373215	3300026041	Bacteria	1279
237	Ga0207678_10002508	3300026067	Bacteria	16709
238	Ga0207678_10020484	3300026067	Bacteria	5798
239	Ga0207678_10021626	3300026067	Bacteria	5640
240	Ga0207708_10003247	3300026075	Bacteria	11979
241	Ga0207708_10012655	3300026075	Bacteria	6291
242	Ga0207702_10522182	3300026078	Bacteria	1159
243	Ga0207641_10034306	3300026088	Bacteria	4220
244	Ga0207648_10003262	3300026089	Bacteria	17055
245	Ga0207648_10223871	3300026089	Bacteria	1672
246	Ga0207676_10106806	3300026095	Bacteria	2333
247	Ga0207676_10616241	3300026095	Bacteria	1044
248	Ga0207675_100000479	3300026118	Bacteria	38868
249	Ga0207675_100052426	3300026118	Bacteria	3806
250	Ga0207675_100313438	3300026118	Bacteria	1530
251	Ga0207683_10000398	3300026121	Bacteria	39849
252	Ga0207683_10025875	3300026121	Bacteria	5064
253	Ga0207683_10191575	3300026121	Bacteria	1857
254	Ga0207683_10282967	3300026121	Bacteria	1515
255	Ga0268266_10007847	3300028379	Bacteria	9562
256	Ga0268266_10021258	3300028379	Bacteria	5528
257	Ga0268266_10045677	3300028379	Bacteria	3747
258	Ga0268266_10352217	3300028379	Bacteria	1384
259	Ga0268265_10140953	3300028380	Bacteria	2018
260	Ga0268264_10018503	3300028381	Bacteria	5698
261	Ga0265327_10000340	3300031251	Bacteria	88806
262	Ga0265327_10009957	3300031251	Bacteria	6771
263	Ga0307413_10013909	3300031824	Bacteria	4069
264	Ga0307410_10013840	3300031852	Bacteria	4723
265	Ga0307407_10058139	3300031903	Bacteria	2247
266	Ga0307407_10202260	3300031903	Bacteria	1332
267	Ga0307412_10378773	3300031911	Bacteria	1145
268	Ga0307409_100119019	3300031995	Bacteria	2232
269	Ga0307411_10019524	3300032005	Bacteria	3917
270	Ga0307411_10321496	3300032005	Bacteria	1250
271	Ga0373952_0023694	3300035092	Bacteria	1313
272	Ga0373939_0052071	3300035114	Bacteria	1275
273	Ga0373945_0126140	3300035116	Bacteria	1022
274	Ga0373931_0013011	3300035691	Bacteria	4043
275	Ga0373931_0020164	3300035691	Bacteria	3333
276	Ga0436364_1346334	3300037853	Bacteria	2197
277	Ga0439461_0003664	3300041410	Bacteria	2534
278	Ga0439466_0006484	3300041411	Bacteria	4447
279	Ga0439466_0007324	3300041411	Bacteria	4180
280	Ga0439465_0001121	3300041413	Bacteria	8583
281	Ga0439465_0007378	3300041413	Bacteria	3494
282	Ga0451833_0760296	3300041491	Bacteria	905
283	Ga0439431_0017149	3300041997	Bacteria	1700
284	Ga0439431_0059866	3300041997	Bacteria	1000
285	Ga0439442_011327	3300042002	Bacteria	1814
286	Ga0439434_0021807	3300042435	Bacteria	1925
287	Ga0439435_0024643	3300042436	Bacteria	1589
288	Ga0466972_0008478	3300044658	Bacteria	5155
289	Ga0466972_0020076	3300044658	Bacteria	3341
290	Ga0466972_0063212	3300044658	Bacteria	1773
291	Ga0466965_0005838	3300044683	Bacteria	5553
292	Ga0466965_0027725	3300044683	Bacteria	2750
293	Ga0466965_0270591	3300044683	Bacteria	915
294	Ga0466966_0000907	3300044684	Bacteria	18839
295	Ga0466966_0022566	3300044684	Bacteria	4129
296	Ga0466966_0056472	3300044684	Bacteria	2483
297	Ga0466966_0299520	3300044684	Bacteria	966
298	Ga0466961_0004854	3300044693	Bacteria	8459
299	Ga0466961_0011399	3300044693	Bacteria	5686
300	Ga0466963_0066058	3300044694	Bacteria	2426
301	Ga0466963_0119364	3300044694	Bacteria	1814
302	Ga0466963_0247482	3300044694	Bacteria	1251
303	Ga0466964_0013013	3300044706	Bacteria	3152
304	Ga0466971_0005038	3300044719	Bacteria	5720
305	Ga0466968_0004709	3300044735	Bacteria	5112
306	Ga0466968_0008967	3300044735	Bacteria	3843
307	Ga0466968_0038088	3300044735	Bacteria	2020
308	Ga0466968_0052101	3300044735	Bacteria	1750
309	Ga0466970_0015936	3300044765	Bacteria	3869
310	Ga0466957_0007058	3300044842	Bacteria	6350
311	Ga0466957_0048167	3300044842	Bacteria	2590
312	Ga0466957_0284283	3300044842	Bacteria	1108
313	Ga0466960_0001318	3300044901	Bacteria	9004
314	Ga0466960_0014837	3300044901	Bacteria	3347
315	Ga0466960_0030352	3300044901	Bacteria	2487
316	Ga0466959_0011410	3300045049	Bacteria	6384
317	Ga0466959_0011600	3300045049	Bacteria	6334
318	Ga0466959_0033820	3300045049	Bacteria	3780
319	Ga0466959_0073820	3300045049	Bacteria	2467
320	Ga0466958_0003917	3300045836	Bacteria	7799
321	Ga0466958_0034856	3300045836	Bacteria	3004
322	Ga0466967_0192092	3300045976	Bacteria	1930
323	Ga0466967_0274459	3300045976	Bacteria	1616
324	Ga0466967_0283795	3300045976	Bacteria	1589
325	Ga0495629_0006984	3300046459	Bacteria	8324
326	Ga0495638_0001579	3300046460	Bacteria	20430
327	Ga0495641_0020366	3300046461	Bacteria	3365
328	Ga0495582_0220323	3300046473	Bacteria	1085
329	Ga0495594_0181776	3300046499	Bacteria	1197
330	Ga0495606_0045562	3300046507	Bacteria	2905
331	Ga0495654_0037947	3300046530	Bacteria	2412
332	Ga0495665_0026118	3300046531	Bacteria	3137
333	Ga0495640_0065502	3300046533	Bacteria	2453
334	Ga0495668_0163525	3300046616	Bacteria	1219
335	Ga0495649_0028986	3300046694	Bacteria	3067
336	Ga0495674_0027043	3300047319	Bacteria	5247
337	Ga0495672_0081576	3300047320	Bacteria	1800
338	Ga0495672_0165043	3300047320	Bacteria	1135
339	Ga0495676_0027822	3300047321	Bacteria	4844
340	Ga0495673_0001107	3300047469	Bacteria	23216
341	Ga0496100_0001304	3300048903	Bacteria	12174
342	Ga0496100_0003476	3300048903	Bacteria	8219
343	Ga0496100_0004449	3300048903	Bacteria	7435
344	Ga0496100_0433587	3300048903	Bacteria	1005
345	Ga0496101_0000026	3300048904	Bacteria	199963
346	Ga0496101_0000283	3300048904	Bacteria	35765
347	Ga0496101_0001234	3300048904	Bacteria	15288
348	Ga0496101_0076662	3300048904	Bacteria	2463
349	Ga0496101_0115800	3300048904	Bacteria	2022
350	Ga0496101_0126078	3300048904	Bacteria	1940
351	Ga0496102_0000031	3300048905	Bacteria	217389
352	Ga0496102_0004692	3300048905	Bacteria	11562
353	Ga0496102_0012602	3300048905	Bacteria	7324
354	Ga0496102_0084996	3300048905	Bacteria	2921
355	Ga0496102_0091884	3300048905	Bacteria	2810
356	Ga0496102_0349304	3300048905	Bacteria	1392
357	Ga0496102_0393255	3300048905	Bacteria	1304
358	Ga0496102_0628348	3300048905	Bacteria	997
359	Ga0496103_0000025	3300048906	Bacteria	221144
360	Ga0496103_0012375	3300048906	Bacteria	5060
361	Ga0496104_0003815	3300048907	Bacteria	13041
362	Ga0496104_0048490	3300048907	Bacteria	4004
363	Ga0496104_0221735	3300048907	Bacteria	1803
364	Ga0496104_0300687	3300048907	Bacteria	1517
365	Ga0496105_0009245	3300048908	Bacteria	7699
366	Ga0496105_0216638	3300048908	Bacteria	1559
367	Ga0496106_0003800	3300048909	Bacteria	11249
368	Ga0496106_0018509	3300048909	Bacteria	5151
369	Ga0496106_0041092	3300048909	Bacteria	3465
370	Ga0496106_0044496	3300048909	Bacteria	3332
371	Ga0496106_0131437	3300048909	Bacteria	1964
372	Ga0496107_0000295	3300048910	Bacteria	26561
373	Ga0496107_0021577	3300048910	Bacteria	4552
374	Ga0496107_0138540	3300048910	Bacteria	1798
375	Ga0496107_0518345	3300048910	Bacteria	884
376	Ga0496108_0000123	3300048911	Bacteria	76931
377	Ga0496108_0005014	3300048911	Bacteria	10696
378	Ga0496109_0004086	3300048912	Bacteria	12202
379	Ga0496109_0020465	3300048912	Bacteria	5844
380	Ga0496110_0212193	3300048913	Bacteria	1760
381	Ga0496110_0284843	3300048913	Bacteria	1505
382	Ga0496111_0158475	3300048914	Bacteria	1680
383	Ga0496111_0361637	3300048914	Bacteria	1074
384	Ga0496112_0015772	3300048915	Bacteria	7060
385	Ga0496112_0059675	3300048915	Bacteria	3759
386	Ga0496112_0083015	3300048915	Bacteria	3168
387	Ga0496112_0111661	3300048915	Bacteria	2703
388	Ga0496112_0274399	3300048915	Bacteria	1634
389	Ga0496113_0155433	3300048916	Bacteria	1806
390	Ga0496113_0197094	3300048916	Bacteria	1600
391	Ga0496114_0001535	3300048917	Bacteria	17491
392	Ga0496114_0278279	3300048917	Bacteria	1475
393	Ga0496115_0007420	3300048918	Bacteria	8067
394	Ga0496115_0008390	3300048918	Bacteria	7646
395	Ga0496115_0642766	3300048918	Bacteria	839
396	Ga0496116_0000084	3300048919	Bacteria	219579
397	Ga0496117_0000018	3300048920	Bacteria	479613
398	Ga0496118_0000013	3300048921	Bacteria	574008
399	Ga0496118_0195203	3300048921	Bacteria	1206
400	Ga0496119_0001181	3300048922	Bacteria	32736
401	Ga0496120_0000418	3300048923	Bacteria	67915
402	Ga0496120_0076429	3300048923	Bacteria	1825
403	Ga0496121_0000056	3300048924	Bacteria	296250
404	Ga0496122_0028332	3300048925	Bacteria	4756
405	Ga0496123_0012568	3300048926	Bacteria	7205
406	Ga0496126_0000089	3300048929	Bacteria	211348
407	Ga0496126_0002245	3300048929	Bacteria	26662
408	Ga0501034_0051376	3300049571	Bacteria	4157
409	Ga0501070_0165761	3300049586	Bacteria	1821
410	nmdc:mga03683_41389_c1	3300050489	Bacteria	1892
411	nmdc:mga03683_42439_c1	3300050489	Bacteria	1871
412	nmdc:mga03683_64809_c1	3300050489	Bacteria	1551
413	nmdc:mga03n38_319_c1	3300050490	Bacteria	11627
414	nmdc:mga03n38_3646_c1	3300050490	Bacteria	4978
415	nmdc:mga03n38_455_c1	3300050490	Bacteria	10261
416	nmdc:mga03n38_9046_c1	3300050490	Bacteria	3603
417	nmdc:mga00v17_1082_c1	3300050491	Bacteria	14354
418	nmdc:mga00v17_14456_c1	3300050491	Bacteria	4405
419	nmdc:mga00v17_21136_c1	3300050491	Bacteria	3738
420	nmdc:mga00v17_326663_c1	3300050491	Bacteria	997
421	nmdc:mga00v17_380411_c1	3300050491	Bacteria	918
422	nmdc:mga0yw44_186188_c1	3300050492	Bacteria	1368
423	nmdc:mga0yw44_36364_c1	3300050492	Bacteria	2901
424	nmdc:mga0yw44_76184_c1	3300050492	Bacteria	2093
425	nmdc:mga0k408_102477_c1	3300050493	Bacteria	1688
426	nmdc:mga06z11_22622_c1	3300050494	Bacteria	2939
427	nmdc:mga06z11_23199_c1	3300050494	Bacteria	2911
428	nmdc:mga06z11_32401_c1	3300050494	Bacteria	2548
429	nmdc:mga07m45_11319_c1	3300050496	Bacteria	4684
430	nmdc:mga07m45_120880_c1	3300050496	Bacteria	1512
431	nmdc:mga07m45_1894_c1	3300050496	Bacteria	9651
432	nmdc:mga07m45_45684_c1	3300050496	Bacteria	2459
433	nmdc:mga07m45_9495_c2	3300050496	Bacteria	3498
434	nmdc:mga05p37_90529_c1	3300050507	Bacteria	3770
435	nmdc:mga0qj67_7733_c1	3300050509	Bacteria	7943
436	nmdc:mga06r32_30031_c1	3300050510	Bacteria	2130
437	nmdc:mga0sz30_18408_c1	3300050516	Bacteria	2795
438	nmdc:mga0sz30_21409_c1	3300050516	Bacteria	2616
439	nmdc:mga0sz30_40659_c1	3300050516	Bacteria	1662
440	nmdc:mga0sz30_42942_c1	3300050516	Bacteria	1903
441	Ga0500610_0018021	3300053079	Bacteria	3403
442	Ga0500643_001060	3300053087	Bacteria	16648
443	Ga0500641_0034616	3300053096	Bacteria	2012
444	Ga0500556_0043434	3300053104	Bacteria	1595
445	Ga0500562_000536	3300053108	Bacteria	9214
446	Ga0500642_0086675	3300053130	Bacteria	1444
447	Ga0500568_0061402	3300053139	Bacteria	1454
448	Ga0500616_0004398	3300053153	Bacteria	10067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2738543011	2739236082	215
2	iso_pu_bacteria	2889300758	2889304450	215
3	iso_pu_bacteria	2939743619	2939745152	215
4	3300009148	Ga0105243_10000071	Ga0105243_1000007133	217
5	3300050489	nmdc:mga03683_42439_c1	nmdc:mga03683_42439_c1_90_761	217
6	3300025935	Ga0207709_10007511	Ga0207709_100075114	219
7	3300006186	Ga0075369_10000468	Ga0075369_100004689	222
8	3300009098	Ga0105245_10081391	Ga0105245_100813913	224
9	3300009174	Ga0105241_10622314	Ga0105241_106223141	224
10	3300011119	Ga0105246_10072358	Ga0105246_100723581	224
11	3300048914	Ga0496111_0361637	Ga0496111_0361637_20_715	224
12	3300009101	Ga0105247_10043113	Ga0105247_100431132	225
13	3300009177	Ga0105248_10178199	Ga0105248_101781992	225
14	3300011119	Ga0105246_10290829	Ga0105246_102908291	225
15	3300013308	Ga0157375_10082546	Ga0157375_100825462	225
16	3300014326	Ga0157380_10102671	Ga0157380_101026712	225
17	3300048903	Ga0496100_0001304	Ga0496100_0001304_8566_9243	225
18	3300048904	Ga0496101_0000283	Ga0496101_0000283_19703_20380	225
19	3300048905	Ga0496102_0091884	Ga0496102_0091884_1659_2336	225
20	3300048907	Ga0496104_0003815	Ga0496104_0003815_4388_5065	225
21	3300048908	Ga0496105_0009245	Ga0496105_0009245_334_1011	225
22	3300048909	Ga0496106_0044496	Ga0496106_0044496_389_1066	225
23	3300048918	Ga0496115_0007420	Ga0496115_0007420_4372_5049	225
24	3300026121	Ga0207683_10282967	Ga0207683_102829671	226
25	3300035092	Ga0373952_0023694	Ga0373952_0023694_597_1292	231
26	3300013307	Ga0157372_10202250	Ga0157372_102022503	232
27	3300041997	Ga0439431_0059866	Ga0439431_0059866_31_735	232
28	3300048905	Ga0496102_0393255	Ga0496102_0393255_216_914	232
29	iso_pu_bacteria	2902792274	2902792393	233
30	3300013306	Ga0163162_10086388	Ga0163162_100863884	236
31	3300031251	Ga0265327_10000340	Ga0265327_1000034056	236
32	3300031251	Ga0265327_10009957	Ga0265327_100099576	236
33	3300048905	Ga0496102_0084996	Ga0496102_0084996_1369_2142	236
34	3300048909	Ga0496106_0131437	Ga0496106_0131437_1127_1900	236
35	3300050490	nmdc:mga03n38_3646_c1	nmdc:mga03n38_3646_c1_804_1547	236
36	3300009545	Ga0105237_10005411	Ga0105237_1000541110	237
37	3300010375	Ga0105239_10024997	Ga0105239_100249974	237
38	3300025914	Ga0207671_10016932	Ga0207671_100169326	237
39	3300046507	Ga0495606_0045562	Ga0495606_0045562_1011_1724	237
40	3300046530	Ga0495654_0037947	Ga0495654_0037947_564_1277	237
41	3300046616	Ga0495668_0163525	Ga0495668_0163525_484_1197	237
42	3300047320	Ga0495672_0081576	Ga0495672_0081576_159_872	237
43	3300047469	Ga0495673_0001107	Ga0495673_0001107_7285_7998	237
44	3300048903	Ga0496100_0004449	Ga0496100_0004449_2777_3490	237
45	3300048904	Ga0496101_0000026	Ga0496101_0000026_145470_146183	237
46	3300048905	Ga0496102_0000031	Ga0496102_0000031_165474_166187	237
47	3300048906	Ga0496103_0000025	Ga0496103_0000025_164282_164995	237
48	3300048909	Ga0496106_0041092	Ga0496106_0041092_2589_3302	237
49	3300048910	Ga0496107_0138540	Ga0496107_0138540_515_1228	237
50	3300048919	Ga0496116_0000084	Ga0496116_0000084_53416_54129	237
51	3300048920	Ga0496117_0000018	Ga0496117_0000018_55412_56125	237
52	3300048921	Ga0496118_0000013	Ga0496118_0000013_423489_424202	237
53	3300048922	Ga0496119_0001181	Ga0496119_0001181_11630_12343	237
54	3300048923	Ga0496120_0000418	Ga0496120_0000418_9251_9964	237
55	3300048924	Ga0496121_0000056	Ga0496121_0000056_145511_146224	237
56	3300048929	Ga0496126_0000089	Ga0496126_0000089_30003_30716	237
57	3300053087	Ga0500643_001060	Ga0500643_001060_1234_1947	237
58	iso_pu_bacteria	2842134933	2842135767	238
59	3300050489	nmdc:mga03683_41389_c1	nmdc:mga03683_41389_c1_51_782	239
60	3300050490	nmdc:mga03n38_455_c1	nmdc:mga03n38_455_c1_4874_5605	239
61	3300050491	nmdc:mga00v17_14456_c1	nmdc:mga00v17_14456_c1_3105_3836	239
62	3300050491	nmdc:mga00v17_326663_c1	nmdc:mga00v17_326663_c1_13_735	239
63	3300050491	nmdc:mga00v17_380411_c1	nmdc:mga00v17_380411_c1_144_866	239
64	3300050492	nmdc:mga0yw44_186188_c1	nmdc:mga0yw44_186188_c1_364_1095	239
65	3300050492	nmdc:mga0yw44_36364_c1	nmdc:mga0yw44_36364_c1_1236_1967	239
66	3300050493	nmdc:mga0k408_102477_c1	nmdc:mga0k408_102477_c1_254_985	239
67	3300050494	nmdc:mga06z11_22622_c1	nmdc:mga06z11_22622_c1_269_1000	239
68	3300050494	nmdc:mga06z11_23199_c1	nmdc:mga06z11_23199_c1_1255_1986	239
69	3300050496	nmdc:mga07m45_11319_c1	nmdc:mga07m45_11319_c1_700_1431	239
70	3300050496	nmdc:mga07m45_9495_c2	nmdc:mga07m45_9495_c2_2116_2847	239
71	3300050516	nmdc:mga0sz30_40659_c1	nmdc:mga0sz30_40659_c1_901_1623	239
72	3300050489	nmdc:mga03683_64809_c1	nmdc:mga03683_64809_c1_54_788	240
73	3300050490	nmdc:mga03n38_319_c1	nmdc:mga03n38_319_c1_7736_8470	240
74	3300050491	nmdc:mga00v17_21136_c1	nmdc:mga00v17_21136_c1_2597_3331	240
75	3300050496	nmdc:mga07m45_1894_c1	nmdc:mga07m45_1894_c1_7624_8358	240
76	3300053153	Ga0500616_0004398	Ga0500616_0004398_6218_6940	240
77	3300005937	Ga0081455_10069729	Ga0081455_100697292	241
78	3300006353	Ga0075370_10025257	Ga0075370_100252572	241
79	3300044684	Ga0466966_0000907	Ga0466966_0000907_944_1672	241
80	3300044693	Ga0466961_0011399	Ga0466961_0011399_3173_3901	241
81	3300044694	Ga0466963_0119364	Ga0466963_0119364_641_1369	241
82	3300044735	Ga0466968_0008967	Ga0466968_0008967_2982_3710	241
83	3300044901	Ga0466960_0014837	Ga0466960_0014837_1679_2407	241
84	3300045049	Ga0466959_0011410	Ga0466959_0011410_1982_2710	241
85	3300045836	Ga0466958_0003917	Ga0466958_0003917_2322_3050	241
86	3300053130	Ga0500642_0086675	Ga0500642_0086675_46_828	241
87	3300009551	Ga0105238_10180747	Ga0105238_101807472	242
88	3300009553	Ga0105249_10866536	Ga0105249_108665361	242
89	3300021388	Ga0213875_10046483	Ga0213875_100464832	242
90	3300037853	Ga0436364_1346334	Ga0436364_1346334_934_1665	242
91	3300044684	Ga0466966_0022566	Ga0466966_0022566_2602_3333	242
92	3300044684	Ga0466966_0299520	Ga0466966_0299520_165_896	242
93	3300044693	Ga0466961_0004854	Ga0466961_0004854_768_1499	242
94	3300044694	Ga0466963_0247482	Ga0466963_0247482_371_1102	242
95	3300044735	Ga0466968_0052101	Ga0466968_0052101_1003_1734	242
96	3300045049	Ga0466959_0073820	Ga0466959_0073820_1392_2123	242
97	3300045836	Ga0466958_0034856	Ga0466958_0034856_2226_2957	242
98	3300013306	Ga0163162_10604005	Ga0163162_106040052	243
99	3300046694	Ga0495649_0028986	Ga0495649_0028986_1600_2358	243
100	iso_pu_bacteria	2939582691	2939583422	243
101	3300044658	Ga0466972_0008478	Ga0466972_0008478_671_1405	244
102	3300044683	Ga0466965_0027725	Ga0466965_0027725_271_1005	244
103	3300044684	Ga0466966_0056472	Ga0466966_0056472_179_913	244
104	3300044719	Ga0466971_0005038	Ga0466971_0005038_2042_2776	244
105	3300044765	Ga0466970_0015936	Ga0466970_0015936_1496_2230	244
106	3300044842	Ga0466957_0048167	Ga0466957_0048167_1573_2307	244
107	3300045049	Ga0466959_0011600	Ga0466959_0011600_2530_3264	244
108	3300041411	Ga0439466_0006484	Ga0439466_0006484_892_1629	245
109	3300041413	Ga0439465_0001121	Ga0439465_0001121_1544_2281	245
110	3300041491	Ga0451833_0760296	Ga0451833_0760296_155_892	245
111	3300041997	Ga0439431_0017149	Ga0439431_0017149_80_817	245
112	3300044683	Ga0466965_0270591	Ga0466965_0270591_97_834	245
113	3300044694	Ga0466963_0066058	Ga0466963_0066058_1369_2106	245
114	3300044901	Ga0466960_0030352	Ga0466960_0030352_143_880	245
115	3300045976	Ga0466967_0192092	Ga0466967_0192092_1124_1861	245
116	3300048923	Ga0496120_0076429	Ga0496120_0076429_245_1003	245
117	3300006038	Ga0075365_10018503	Ga0075365_100185033	246
118	3300006038	Ga0075365_10254714	Ga0075365_102547142	246
119	3300006042	Ga0075368_10002283	Ga0075368_100022833	246
120	3300006048	Ga0075363_100008021	Ga0075363_1000080214	246
121	3300006048	Ga0075363_100010984	Ga0075363_1000109842	246
122	3300006051	Ga0075364_10006566	Ga0075364_100065663	246
123	3300006051	Ga0075364_10049842	Ga0075364_100498422	246
124	3300006051	Ga0075364_10208777	Ga0075364_102087772	246
125	3300006177	Ga0075362_10039602	Ga0075362_100396021	246
126	3300006178	Ga0075367_10002406	Ga0075367_100024067	246
127	3300006186	Ga0075369_10093875	Ga0075369_100938752	246
128	3300006353	Ga0075370_10024989	Ga0075370_100249892	246
129	3300006353	Ga0075370_10052461	Ga0075370_100524612	246
130	3300031824	Ga0307413_10013909	Ga0307413_100139093	246
131	3300031852	Ga0307410_10013840	Ga0307410_100138402	246
132	3300031903	Ga0307407_10058139	Ga0307407_100581391	246
133	3300031911	Ga0307412_10378773	Ga0307412_103787731	246
134	3300031995	Ga0307409_100119019	Ga0307409_1001190193	246
135	3300032005	Ga0307411_10019524	Ga0307411_100195242	246
136	3300042436	Ga0439435_0024643	Ga0439435_0024643_254_994	246
137	3300053096	Ga0500641_0034616	Ga0500641_0034616_400_1161	246
138	3300005329	Ga0070683_100411563	Ga0070683_1004115632	247
139	3300005337	Ga0070682_100157245	Ga0070682_1001572452	247
140	3300005438	Ga0070701_10138877	Ga0070701_101388772	247
141	3300005535	Ga0070684_100092288	Ga0070684_1000922882	247
142	3300005614	Ga0068856_100294149	Ga0068856_1002941491	247
143	3300005618	Ga0068864_100144686	Ga0068864_1001446862	247
144	3300006048	Ga0075363_100002905	Ga0075363_1000029056	247
145	3300006051	Ga0075364_10178929	Ga0075364_101789292	247
146	3300006177	Ga0075362_10145170	Ga0075362_101451701	247
147	3300006353	Ga0075370_10005141	Ga0075370_100051416	247
148	3300006881	Ga0068865_100114845	Ga0068865_1001148452	247
149	3300013307	Ga0157372_10208809	Ga0157372_102088092	247
150	3300025944	Ga0207661_10293011	Ga0207661_102930112	247
151	3300026067	Ga0207678_10020484	Ga0207678_100204842	247
152	3300026121	Ga0207683_10191575	Ga0207683_101915752	247
153	3300045976	Ga0466967_0274459	Ga0466967_0274459_199_942	247
154	3300048910	Ga0496107_0518345	Ga0496107_0518345_16_780	247
155	3300048911	Ga0496108_0005014	Ga0496108_0005014_7951_8715	247
156	3300048912	Ga0496109_0020465	Ga0496109_0020465_3194_3958	247
157	3300048915	Ga0496112_0083015	Ga0496112_0083015_1941_2705	247
158	3300049586	Ga0501070_0165761	Ga0501070_0165761_785_1528	247
159	3300050490	nmdc:mga03n38_9046_c1	nmdc:mga03n38_9046_c1_549_1313	247
160	3300005347	Ga0070668_100010905	Ga0070668_1000109053	248
161	3300005548	Ga0070665_100402499	Ga0070665_1004024992	248
162	3300006038	Ga0075365_10082651	Ga0075365_100826512	248
163	3300006048	Ga0075363_100068564	Ga0075363_1000685642	248
164	3300025941	Ga0207711_10052982	Ga0207711_100529821	248
165	3300025972	Ga0207668_10006512	Ga0207668_100065123	248
166	3300026095	Ga0207676_10616241	Ga0207676_106162411	248
167	3300028379	Ga0268266_10352217	Ga0268266_103522172	248
168	3300031903	Ga0307407_10202260	Ga0307407_102022602	248
169	3300032005	Ga0307411_10321496	Ga0307411_103214963	248
170	3300044683	Ga0466965_0005838	Ga0466965_0005838_2024_2770	248
171	3300044706	Ga0466964_0013013	Ga0466964_0013013_2059_2805	248
172	3300044735	Ga0466968_0004709	Ga0466968_0004709_2627_3373	248
173	3300044842	Ga0466957_0007058	Ga0466957_0007058_3581_4327	248
174	3300044901	Ga0466960_0001318	Ga0466960_0001318_5111_5857	248
175	3300045049	Ga0466959_0033820	Ga0466959_0033820_2040_2786	248
176	3300046460	Ga0495638_0001579	Ga0495638_0001579_9847_10593	248
177	3300048903	Ga0496100_0433587	Ga0496100_0433587_48_794	248
178	3300048904	Ga0496101_0115800	Ga0496101_0115800_486_1232	248
179	3300048915	Ga0496112_0015772	Ga0496112_0015772_3830_4576	248
180	3300048918	Ga0496115_0642766	Ga0496115_0642766_40_786	248
181	3300048925	Ga0496122_0028332	Ga0496122_0028332_259_1005	248
182	3300048926	Ga0496123_0012568	Ga0496123_0012568_1149_1895	248
183	3300048929	Ga0496126_0002245	Ga0496126_0002245_10987_11733	248
184	3300053079	Ga0500610_0018021	Ga0500610_0018021_2591_3337	248
185	3300053104	Ga0500556_0043434	Ga0500556_0043434_450_1196	248
186	3300053108	Ga0500562_000536	Ga0500562_000536_2936_3682	248
187	3300053139	Ga0500568_0061402	Ga0500568_0061402_47_793	248
188	3300002077	JGI24744J21845_10000568	JGI24744J21845_100005682	249
189	3300005330	Ga0070690_100005958	Ga0070690_1000059583	249
190	3300005341	Ga0070691_10006168	Ga0070691_100061683	249
191	3300005365	Ga0070688_100003217	Ga0070688_1000032172	249
192	3300005434	Ga0070709_10015671	Ga0070709_100156712	249
193	3300005438	Ga0070701_10002338	Ga0070701_100023383	249
194	3300005444	Ga0070694_100018759	Ga0070694_1000187594	249
195	3300005539	Ga0068853_100003320	Ga0068853_1000033208	249
196	3300005545	Ga0070695_100011954	Ga0070695_1000119544	249
197	3300009092	Ga0105250_10046529	Ga0105250_100465291	249
198	3300009098	Ga0105245_10000930	Ga0105245_100009303	249
199	3300009101	Ga0105247_10001839	Ga0105247_1000183914	249
200	3300009148	Ga0105243_10000506	Ga0105243_1000050615	249
201	3300009174	Ga0105241_10036523	Ga0105241_100365232	249
202	3300009177	Ga0105248_10002906	Ga0105248_1000290616	249
203	3300009551	Ga0105238_10047032	Ga0105238_100470322	249
204	3300009553	Ga0105249_10004819	Ga0105249_100048195	249
205	3300010375	Ga0105239_10041945	Ga0105239_100419452	249
206	3300013296	Ga0157374_10121169	Ga0157374_101211692	249
207	3300013297	Ga0157378_10000789	Ga0157378_1000078910	249
208	3300014968	Ga0157379_10003998	Ga0157379_100039988	249
209	3300049571	Ga0501034_0051376	Ga0501034_0051376_2347_3096	249
210	3300006048	Ga0075363_100335576	Ga0075363_1003355761	250
211	3300009147	Ga0114129_10018613	Ga0114129_100186132	250
212	3300045976	Ga0466967_0283795	Ga0466967_0283795_361_1113	250
213	3300050507	nmdc:mga05p37_90529_c1	nmdc:mga05p37_90529_c1_2859_3611	250
214	3300050509	nmdc:mga0qj67_7733_c1	nmdc:mga0qj67_7733_c1_3837_4589	250
215	3300050510	nmdc:mga06r32_30031_c1	nmdc:mga06r32_30031_c1_184_936	250
216	3300048907	Ga0496104_0300687	Ga0496104_0300687_486_1241	251
217	3300048915	Ga0496112_0111661	Ga0496112_0111661_1648_2415	251
218	3300005439	Ga0070711_100445023	Ga0070711_1004450231	252
219	3300035116	Ga0373945_0126140	Ga0373945_0126140_228_986	252
220	3300044658	Ga0466972_0020076	Ga0466972_0020076_352_1140	252
221	3300046459	Ga0495629_0006984	Ga0495629_0006984_3916_4719	252
222	3300046461	Ga0495641_0020366	Ga0495641_0020366_2032_2835	252
223	3300046473	Ga0495582_0220323	Ga0495582_0220323_15_818	252
224	3300046499	Ga0495594_0181776	Ga0495594_0181776_233_1036	252
225	3300046531	Ga0495665_0026118	Ga0495665_0026118_1642_2445	252
226	3300046533	Ga0495640_0065502	Ga0495640_0065502_265_1068	252
227	3300047319	Ga0495674_0027043	Ga0495674_0027043_2068_2871	252
228	3300047321	Ga0495676_0027822	Ga0495676_0027822_138_941	252
229	3300048915	Ga0496112_0274399	Ga0496112_0274399_475_1278	252
230	3300005335	Ga0070666_10339083	Ga0070666_103390831	253
231	3300005347	Ga0070668_100077002	Ga0070668_1000770023	253
232	3300005355	Ga0070671_100002457	Ga0070671_10000245713	253
233	3300005467	Ga0070706_100357571	Ga0070706_1003575712	253
234	3300005544	Ga0070686_100077421	Ga0070686_1000774212	253
235	3300005548	Ga0070665_100021813	Ga0070665_1000218136	253
236	3300005842	Ga0068858_100586224	Ga0068858_1005862241	253
237	3300005844	Ga0068862_100304588	Ga0068862_1003045882	253
238	3300006038	Ga0075365_10012089	Ga0075365_100120895	253
239	3300006048	Ga0075363_100009646	Ga0075363_1000096464	253
240	3300006051	Ga0075364_10068805	Ga0075364_100688052	253
241	3300006177	Ga0075362_10007725	Ga0075362_100077254	253
242	3300006186	Ga0075369_10029796	Ga0075369_100297962	253
243	3300009101	Ga0105247_10165316	Ga0105247_101653163	253
244	3300009177	Ga0105248_10479527	Ga0105248_104795272	253
245	3300009553	Ga0105249_10011185	Ga0105249_100111852	253
246	3300014325	Ga0163163_10116953	Ga0163163_101169533	253
247	3300025931	Ga0207644_10002196	Ga0207644_1000219611	253
248	3300025941	Ga0207711_10329625	Ga0207711_103296252	253
249	3300025961	Ga0207712_10043000	Ga0207712_100430002	253
250	3300025972	Ga0207668_10073041	Ga0207668_100730413	253
251	3300026035	Ga0207703_10483501	Ga0207703_104835012	253
252	3300028379	Ga0268266_10045677	Ga0268266_100456773	253
253	3300044658	Ga0466972_0063212	Ga0466972_0063212_545_1306	253
254	3300044735	Ga0466968_0038088	Ga0466968_0038088_728_1489	253
255	3300044842	Ga0466957_0284283	Ga0466957_0284283_286_1047	253
256	3300048904	Ga0496101_0076662	Ga0496101_0076662_242_1003	253
257	3300048905	Ga0496102_0012602	Ga0496102_0012602_3377_4183	253
258	3300048907	Ga0496104_0048490	Ga0496104_0048490_2868_3629	253
259	3300048908	Ga0496105_0216638	Ga0496105_0216638_332_1093	253
260	3300048913	Ga0496110_0212193	Ga0496110_0212193_478_1239	253
261	3300048914	Ga0496111_0158475	Ga0496111_0158475_476_1237	253
262	3300048916	Ga0496113_0197094	Ga0496113_0197094_81_887	253
263	3300048921	Ga0496118_0195203	Ga0496118_0195203_360_1166	253
264	3300050492	nmdc:mga0yw44_76184_c1	nmdc:mga0yw44_76184_c1_208_1014	253
265	3300050516	nmdc:mga0sz30_42942_c1	nmdc:mga0sz30_42942_c1_182_988	253
266	3300002239	JGI24034J26672_10009979	JGI24034J26672_100099792	254
267	3300002244	JGI24742J22300_10014677	JGI24742J22300_100146771	254
268	3300005328	Ga0070676_10019956	Ga0070676_100199563	254
269	3300005334	Ga0068869_100006256	Ga0068869_1000062566	254
270	3300005335	Ga0070666_10155305	Ga0070666_101553052	254
271	3300005338	Ga0068868_100000374	Ga0068868_10000037413	254
272	3300005340	Ga0070689_100002806	Ga0070689_10000280610	254
273	3300005347	Ga0070668_100000344	Ga0070668_10000034416	254
274	3300005353	Ga0070669_100011727	Ga0070669_1000117274	254
275	3300005354	Ga0070675_100195792	Ga0070675_1001957921	254
276	3300005356	Ga0070674_100002532	Ga0070674_1000025326	254
277	3300005366	Ga0070659_100023888	Ga0070659_1000238885	254
278	3300005367	Ga0070667_100013056	Ga0070667_1000130562	254
279	3300005437	Ga0070710_10000616	Ga0070710_1000061616	254
280	3300005439	Ga0070711_100001704	Ga0070711_1000017042	254
281	3300005441	Ga0070700_100001450	Ga0070700_10000145011	254
282	3300005455	Ga0070663_100090891	Ga0070663_1000908912	254
283	3300005456	Ga0070678_100000071	Ga0070678_10000007116	254
284	3300005457	Ga0070662_100006383	Ga0070662_1000063836	254
285	3300005457	Ga0070662_100193855	Ga0070662_1001938552	254
286	3300005459	Ga0068867_100064029	Ga0068867_1000640292	254
287	3300005545	Ga0070695_100288588	Ga0070695_1002885881	254
288	3300005546	Ga0070696_100001427	Ga0070696_1000014274	254
289	3300005547	Ga0070693_100031371	Ga0070693_1000313713	254
290	3300005548	Ga0070665_100002637	Ga0070665_1000026378	254
291	3300005549	Ga0070704_100000466	Ga0070704_10000046611	254
292	3300005578	Ga0068854_100000231	Ga0068854_10000023117	254
293	3300005614	Ga0068856_100558460	Ga0068856_1005584601	254
294	3300005615	Ga0070702_100012114	Ga0070702_1000121144	254
295	3300005718	Ga0068866_10000141	Ga0068866_1000014118	254
296	3300005718	Ga0068866_10089180	Ga0068866_100891801	254
297	3300005719	Ga0068861_100000275	Ga0068861_10000027512	254
298	3300005842	Ga0068858_100000584	Ga0068858_10000058417	254
299	3300005843	Ga0068860_100003733	Ga0068860_1000037333	254
300	3300005844	Ga0068862_100008481	Ga0068862_10000848110	254
301	3300006163	Ga0070715_10018033	Ga0070715_100180332	254
302	3300006173	Ga0070716_100012697	Ga0070716_1000126972	254
303	3300006175	Ga0070712_100001124	Ga0070712_1000011242	254
304	3300006186	Ga0075369_10012506	Ga0075369_100125062	254
305	3300006237	Ga0097621_100032241	Ga0097621_1000322414	254
306	3300006237	Ga0097621_100207534	Ga0097621_1002075342	254
307	3300006353	Ga0075370_10027513	Ga0075370_100275133	254
308	3300006881	Ga0068865_100000173	Ga0068865_10000017316	254
309	3300006881	Ga0068865_100017932	Ga0068865_1000179322	254
310	3300009176	Ga0105242_10005862	Ga0105242_100058625	254
311	3300013307	Ga0157372_10006182	Ga0157372_100061827	254
312	3300014326	Ga0157380_10002911	Ga0157380_100029116	254
313	3300014326	Ga0157380_10046709	Ga0157380_100467091	254
314	3300017792	Ga0163161_10005518	Ga0163161_100055187	254
315	3300017792	Ga0163161_10027396	Ga0163161_100273963	254
316	3300025898	Ga0207692_10019742	Ga0207692_100197423	254
317	3300025898	Ga0207692_10295531	Ga0207692_102955311	254
318	3300025899	Ga0207642_10000110	Ga0207642_100001105	254
319	3300025900	Ga0207710_10001641	Ga0207710_100016417	254
320	3300025901	Ga0207688_10000851	Ga0207688_100008512	254
321	3300025903	Ga0207680_10094376	Ga0207680_100943762	254
322	3300025905	Ga0207685_10001807	Ga0207685_100018072	254
323	3300025906	Ga0207699_10020268	Ga0207699_100202682	254
324	3300025906	Ga0207699_10039937	Ga0207699_100399373	254
325	3300025907	Ga0207645_10004740	Ga0207645_100047409	254
326	3300025911	Ga0207654_10309897	Ga0207654_103098971	254
327	3300025915	Ga0207693_10000700	Ga0207693_1000070015	254
328	3300025915	Ga0207693_10000722	Ga0207693_1000072224	254
329	3300025916	Ga0207663_10033898	Ga0207663_100338984	254
330	3300025918	Ga0207662_10062405	Ga0207662_100624052	254
331	3300025923	Ga0207681_10070568	Ga0207681_100705683	254
332	3300025927	Ga0207687_10000624	Ga0207687_100006243	254
333	3300025932	Ga0207690_10106121	Ga0207690_101061212	254
334	3300025933	Ga0207706_10018131	Ga0207706_100181314	254
335	3300025933	Ga0207706_10072823	Ga0207706_100728234	254
336	3300025934	Ga0207686_10004217	Ga0207686_100042174	254
337	3300025935	Ga0207709_10000967	Ga0207709_1000096713	254
338	3300025937	Ga0207669_10000732	Ga0207669_100007325	254
339	3300025938	Ga0207704_10000669	Ga0207704_100006697	254
340	3300025939	Ga0207665_10005059	Ga0207665_100050592	254
341	3300025940	Ga0207691_10131374	Ga0207691_101313742	254
342	3300025941	Ga0207711_10003239	Ga0207711_100032397	254
343	3300025942	Ga0207689_10011382	Ga0207689_100113826	254
344	3300025960	Ga0207651_10031318	Ga0207651_100313181	254
345	3300025961	Ga0207712_10000899	Ga0207712_100008997	254
346	3300025972	Ga0207668_10002090	Ga0207668_100020907	254
347	3300025986	Ga0207658_10015597	Ga0207658_100155972	254
348	3300026023	Ga0207677_10000773	Ga0207677_1000077312	254
349	3300026035	Ga0207703_10009155	Ga0207703_100091557	254
350	3300026041	Ga0207639_10021117	Ga0207639_100211174	254
351	3300026067	Ga0207678_10002508	Ga0207678_1000250812	254
352	3300026067	Ga0207678_10021626	Ga0207678_100216264	254
353	3300026075	Ga0207708_10003247	Ga0207708_1000324711	254
354	3300026078	Ga0207702_10522182	Ga0207702_105221821	254
355	3300026089	Ga0207648_10003262	Ga0207648_1000326212	254
356	3300026089	Ga0207648_10223871	Ga0207648_102238712	254
357	3300026118	Ga0207675_100000479	Ga0207675_10000047915	254
358	3300026121	Ga0207683_10000398	Ga0207683_1000039817	254
359	3300026121	Ga0207683_10025875	Ga0207683_100258752	254
360	3300028379	Ga0268266_10021258	Ga0268266_100212582	254
361	3300028381	Ga0268264_10018503	Ga0268264_100185033	254
362	3300035114	Ga0373939_0052071	Ga0373939_0052071_92_901	254
363	3300035691	Ga0373931_0013011	Ga0373931_0013011_2828_3592	254
364	3300035691	Ga0373931_0020164	Ga0373931_0020164_646_1455	254
365	3300048903	Ga0496100_0003476	Ga0496100_0003476_3723_4532	254
366	3300048904	Ga0496101_0001234	Ga0496101_0001234_12981_13790	254
367	3300048904	Ga0496101_0126078	Ga0496101_0126078_297_1061	254
368	3300048905	Ga0496102_0004692	Ga0496102_0004692_3134_3943	254
369	3300048905	Ga0496102_0349304	Ga0496102_0349304_611_1375	254
370	3300048905	Ga0496102_0628348	Ga0496102_0628348_19_783	254
371	3300048906	Ga0496103_0012375	Ga0496103_0012375_4182_4991	254
372	3300048909	Ga0496106_0003800	Ga0496106_0003800_113_922	254
373	3300048909	Ga0496106_0018509	Ga0496106_0018509_2842_3606	254
374	3300048910	Ga0496107_0000295	Ga0496107_0000295_16069_16878	254
375	3300048910	Ga0496107_0021577	Ga0496107_0021577_1115_1879	254
376	3300048917	Ga0496114_0001535	Ga0496114_0001535_6844_7653	254
377	3300048917	Ga0496114_0278279	Ga0496114_0278279_122_886	254
378	3300048918	Ga0496115_0008390	Ga0496115_0008390_2421_3230	254
379	3300050496	nmdc:mga07m45_120880_c1	nmdc:mga07m45_120880_c1_132_896	254
380	3300050496	nmdc:mga07m45_45684_c1	nmdc:mga07m45_45684_c1_1425_2189	254
381	3300050516	nmdc:mga0sz30_21409_c1	nmdc:mga0sz30_21409_c1_419_1183	254
382	3300001977	JGI24746J21847_1004683	JGI24746J21847_10046832	255
383	3300002077	JGI24744J21845_10004392	JGI24744J21845_100043922	255
384	3300002077	JGI24744J21845_10006279	JGI24744J21845_100062792	255
385	3300005334	Ga0068869_100029943	Ga0068869_1000299432	255
386	3300005338	Ga0068868_100090444	Ga0068868_1000904443	255
387	3300005339	Ga0070660_100528538	Ga0070660_1005285381	255
388	3300005345	Ga0070692_10039925	Ga0070692_100399252	255
389	3300005347	Ga0070668_100133888	Ga0070668_1001338882	255
390	3300005364	Ga0070673_100074522	Ga0070673_1000745221	255
391	3300005367	Ga0070667_100157008	Ga0070667_1001570082	255
392	3300005435	Ga0070714_100117205	Ga0070714_1001172052	255
393	3300005440	Ga0070705_100023931	Ga0070705_1000239313	255
394	3300005441	Ga0070700_100225477	Ga0070700_1002254772	255
395	3300005466	Ga0070685_10044733	Ga0070685_100447332	255
396	3300005543	Ga0070672_100124704	Ga0070672_1001247042	255
397	3300005549	Ga0070704_100036495	Ga0070704_1000364954	255
398	3300005578	Ga0068854_100054711	Ga0068854_1000547113	255
399	3300005617	Ga0068859_100044097	Ga0068859_1000440972	255
400	3300005618	Ga0068864_100079291	Ga0068864_1000792911	255
401	3300005834	Ga0068851_10186648	Ga0068851_101866481	255
402	3300005937	Ga0081455_10021191	Ga0081455_100211915	255
403	3300006051	Ga0075364_10000797	Ga0075364_1000079711	255
404	3300006186	Ga0075369_10005734	Ga0075369_100057345	255
405	3300006844	Ga0075428_100005428	Ga0075428_1000054288	255
406	3300006846	Ga0075430_100010682	Ga0075430_1000106825	255
407	3300006847	Ga0075431_100191953	Ga0075431_1001919532	255
408	3300006931	Ga0097620_100044095	Ga0097620_1000440954	255
409	3300009092	Ga0105250_10052247	Ga0105250_100522472	255
410	3300009176	Ga0105242_10558199	Ga0105242_105581991	255
411	3300011119	Ga0105246_10013016	Ga0105246_100130163	255
412	3300013105	Ga0157369_10777728	Ga0157369_107777281	255
413	3300013296	Ga0157374_10005644	Ga0157374_100056446	255
414	3300013297	Ga0157378_10109587	Ga0157378_101095873	255
415	3300013306	Ga0163162_11155680	Ga0163162_111556801	255
416	3300014745	Ga0157377_10014604	Ga0157377_100146043	255
417	3300014968	Ga0157379_10040476	Ga0157379_100404762	255
418	3300017792	Ga0163161_10123061	Ga0163161_101230612	255
419	3300025885	Ga0207653_10081899	Ga0207653_100818992	255
420	3300025900	Ga0207710_10050348	Ga0207710_100503482	255
421	3300025901	Ga0207688_10005366	Ga0207688_100053666	255
422	3300025904	Ga0207647_10024570	Ga0207647_100245702	255
423	3300025908	Ga0207643_10106889	Ga0207643_101068892	255
424	3300025914	Ga0207671_10636093	Ga0207671_106360931	255
425	3300025927	Ga0207687_10021991	Ga0207687_100219912	255
426	3300025934	Ga0207686_10358292	Ga0207686_103582921	255
427	3300025942	Ga0207689_10026364	Ga0207689_100263644	255
428	3300025972	Ga0207668_10242700	Ga0207668_102427002	255
429	3300025972	Ga0207668_10404419	Ga0207668_104044192	255
430	3300025986	Ga0207658_10249279	Ga0207658_102492792	255
431	3300026023	Ga0207677_10103450	Ga0207677_101034502	255
432	3300026041	Ga0207639_10373215	Ga0207639_103732151	255
433	3300026075	Ga0207708_10012655	Ga0207708_100126555	255
434	3300026088	Ga0207641_10034306	Ga0207641_100343064	255
435	3300026095	Ga0207676_10106806	Ga0207676_101068061	255
436	3300026118	Ga0207675_100052426	Ga0207675_1000524261	255
437	3300026118	Ga0207675_100313438	Ga0207675_1003134382	255
438	3300028379	Ga0268266_10007847	Ga0268266_100078476	255
439	3300028380	Ga0268265_10140953	Ga0268265_101409532	255
440	3300041410	Ga0439461_0003664	Ga0439461_0003664_1233_2006	255
441	3300041411	Ga0439466_0007324	Ga0439466_0007324_1821_2594	255
442	3300041413	Ga0439465_0007378	Ga0439465_0007378_2544_3311	255
443	3300042002	Ga0439442_011327	Ga0439442_011327_665_1438	255
444	3300042435	Ga0439434_0021807	Ga0439434_0021807_1029_1802	255
445	3300047320	Ga0495672_0165043	Ga0495672_0165043_129_896	255
446	3300048907	Ga0496104_0221735	Ga0496104_0221735_1015_1782	255
447	3300048911	Ga0496108_0000123	Ga0496108_0000123_36393_37160	255
448	3300048912	Ga0496109_0004086	Ga0496109_0004086_8048_8815	255
449	3300048913	Ga0496110_0284843	Ga0496110_0284843_444_1211	255
450	3300048915	Ga0496112_0059675	Ga0496112_0059675_1786_2553	255
451	3300048916	Ga0496113_0155433	Ga0496113_0155433_377_1144	255
452	3300050491	nmdc:mga00v17_1082_c1	nmdc:mga00v17_1082_c1_9713_10480	255
453	3300050494	nmdc:mga06z11_32401_c1	nmdc:mga06z11_32401_c1_68_835	255
454	3300050516	nmdc:mga0sz30_18408_c1	nmdc:mga0sz30_18408_c1_475_1242	255

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3fxt-assembly1.cif.gz_A	crystal structure of the n-terminal domain of human nudt6	0.7626	137	222
5i0c-assembly1.cif.gz_A	crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12	0.7546	89	157
3pp9-assembly2.cif.gz_B	1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a	0.7278	61	221
3pp9-assembly2.cif.gz_C	1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a	0.7137	61	221
1y9w-assembly1.cif.gz_B	structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579	0.7102	90	218

ID	Description	Score	Start	End	Superfamily
af_O53594_3_209_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.9068	4	222	3.40.630.30
af_O53594_3_209_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8984	4	222	3.40.630.30
af_E0CYC6_80_216_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.7593	91	152	3.40.630.30
af_Q8IQP3_53_143_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.7346	92	155	3.40.630.30
af_Q10436_98_233_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.7334	91	223	3.40.630.30

ID	Description	Score	Start	End	GO Terms
AF-A0A6B3ENW6-F1-model_v4	GNAT family N-acetyltransferase	0.8892	55	159	GO:0016747
AF-A0A662VTG7-F1-model_v4	N-acetyltransferase domain-containing protein	0.8864	40	219	GO:0016747
AF-A0A1E7I206-F1-model_v4	N-acetyltransferase domain-containing protein	0.8631	46	219	GO:0016747
AF-A0A7V9PXJ3-F1-model_v4	GNAT family N-acetyltransferase	0.863	1	159
AF-X8AE06-F1-model_v4	deleted	0.8612	1	160

Feature Viewer

pLDDT	pTM	Quality
76.09	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F447374

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map