F446954

General Info

Members Datasets Scaffolds Average Seq Length
452 210 904 279

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100203308|Ga0075436_1002033082
Length 322
Sequence MLVLGYQHAIESYLRRDWEPRTDKWELIRFSCPGEAMPRGITPRKPAKSGRHDGLRTATKVTGKVAVSSKAKPFGGTKRQASVHSAPKDKTAKSAKGYKPTAPERVSEILKRLDQLYRDVTCALTHKSAWELLVATILSAQSTDVRVNMVTPELFRKYPTVQDFARLESEQLEPDIRSTGFFRNKSKSVVGAAKKIVSDFGGQVPENMADLLTLPGVARKTANVVLGTWFKTADGVVVDTHVHRISRRLELTKNEDPKKIEEDLMRIIPKEKWILFSHQVIWHGRKLCFARSPKCADCPLENICHAEDKTWSTVDRHAGAKA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
91 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.98
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 7.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100203308 3300006914 Bacteria 1403
2 Ga0065712_10082803 3300005290 Bacteria 2884
3 Ga0065712_10105094 3300005290 Bacteria 1946
4 Ga0065715_10011916 3300005293 Bacteria 3474
5 Ga0065715_10111442 3300005293 Bacteria 2573
6 Ga0070676_10050498 3300005328 Bacteria 2438
7 Ga0070683_100111289 3300005329 Bacteria 2583
8 Ga0070683_100222166 3300005329 Bacteria 1795
9 Ga0070670_100017561 3300005331 Bacteria 6139
10 Ga0068869_100016098 3300005334 Bacteria 5035
11 Ga0068869_100053145 3300005334 Bacteria 2943
12 Ga0070666_10040737 3300005335 Bacteria 3101
13 Ga0070680_100150744 3300005336 Bacteria 1952
14 Ga0070682_100008130 3300005337 Bacteria 5916
15 Ga0068868_100106524 3300005338 Bacteria 2274
16 Ga0070660_100060293 3300005339 Bacteria 2944
17 Ga0070660_100172639 3300005339 Bacteria 1747
18 Ga0070689_100290084 3300005340 Bacteria 1359
19 Ga0070691_10099153 3300005341 Bacteria 1445
20 Ga0070687_100097464 3300005343 Bacteria 1639
21 Ga0070661_100025961 3300005344 Bacteria 4210
22 Ga0070661_100040940 3300005344 Bacteria 3380
23 Ga0070668_100005814 3300005347 Bacteria 9149
24 Ga0070669_100058356 3300005353 Bacteria 2832
25 Ga0070673_100038009 3300005364 Bacteria 3672
26 Ga0070659_100037926 3300005366 Bacteria 3758
27 Ga0070667_100049524 3300005367 Bacteria 3538
28 Ga0070709_10000616 3300005434 Bacteria 20414
29 Ga0070709_10172980 3300005434 Bacteria 1511
30 Ga0070709_10286188 3300005434 Bacteria 1199
31 Ga0070714_100000775 3300005435 Bacteria 22663
32 Ga0070714_100331630 3300005435 Bacteria 1425
33 Ga0070714_100484257 3300005435 Bacteria 1178
34 Ga0070714_100535305 3300005435 Bacteria 1120
35 Ga0070713_100000297 3300005436 Bacteria 32896
36 Ga0070713_100000836 3300005436 Bacteria 19666
37 Ga0070713_100005635 3300005436 Bacteria 8588
38 Ga0070713_100029464 3300005436 Unclassified 4349
39 Ga0070713_100060289 3300005436 Bacteria 3171
40 Ga0070710_10016625 3300005437 Bacteria 3748
41 Ga0070710_10342263 3300005437 Unclassified 988
42 Ga0070711_100001964 3300005439 Bacteria 11538
43 Ga0070711_100008149 3300005439 Bacteria 6406
44 Ga0070711_100011481 3300005439 Bacteria 5502
45 Ga0070711_100022258 3300005439 Bacteria 4106
46 Ga0070708_100003650 3300005445 Bacteria 12068
47 Ga0070708_100025533 3300005445 Bacteria 5051
48 Ga0070708_100041845 3300005445 Unclassified 4019
49 Ga0070663_100002712 3300005455 Bacteria 10016
50 Ga0070678_100022680 3300005456 Bacteria 4166
51 Ga0070678_100240270 3300005456 Bacteria 1514
52 Ga0070662_100015183 3300005457 Bacteria 5154
53 Ga0070681_10000394 3300005458 Bacteria 35340
54 Ga0070681_10006170 3300005458 Bacteria 11642
55 Ga0070681_10033759 3300005458 Bacteria 5136
56 Ga0070681_10242318 3300005458 Bacteria 1716
57 Ga0068867_100150136 3300005459 Bacteria 1829
58 Ga0070706_100001186 3300005467 Bacteria 27906
59 Ga0070706_100001941 3300005467 Bacteria 21314
60 Ga0070706_100017794 3300005467 Bacteria 6557
61 Ga0070707_100001843 3300005468 Bacteria 20354
62 Ga0070707_100112204 3300005468 Unclassified 2644
63 Ga0070707_100160494 3300005468 Unclassified 2190
64 Ga0070698_100000758 3300005471 Bacteria 34912
65 Ga0070699_100012112 3300005518 Bacteria 7444
66 Ga0070699_100021685 3300005518 Bacteria 5539
67 Ga0070699_100160110 3300005518 Bacteria 1992
68 Ga0070679_100003147 3300005530 Bacteria 15080
69 Ga0070679_100116553 3300005530 Bacteria 2656
70 Ga0070679_100145331 3300005530 Bacteria 2349
71 Ga0070684_100109431 3300005535 Bacteria 2476
72 Ga0070684_100389488 3300005535 Bacteria 1284
73 Ga0070697_100000353 3300005536 Bacteria 36186
74 Ga0070697_100011022 3300005536 Bacteria 7062
75 Ga0070697_100041359 3300005536 Bacteria 3730
76 Ga0068853_100084572 3300005539 Bacteria 2780
77 Ga0068853_100095146 3300005539 Bacteria 2626
78 Ga0070672_100180034 3300005543 Bacteria 1761
79 Ga0070686_100029896 3300005544 Bacteria 3318
80 Ga0070695_100036288 3300005545 Bacteria 3101
81 Ga0070696_100021981 3300005546 Bacteria 4329
82 Ga0070693_100037478 3300005547 Bacteria 2704
83 Ga0070693_100051918 3300005547 Bacteria 2349
84 Ga0070665_100004403 3300005548 Bacteria 14805
85 Ga0070704_100131555 3300005549 Bacteria 1940
86 Ga0068855_100000363 3300005563 Bacteria 56220
87 Ga0068855_100026911 3300005563 Bacteria 6882
88 Ga0068855_100124890 3300005563 Bacteria 2943
89 Ga0068855_100165906 3300005563 Unclassified 2504
90 Ga0070664_100002997 3300005564 Bacteria 13659
91 Ga0070664_100017999 3300005564 Bacteria 5801
92 Ga0068857_100007495 3300005577 Bacteria 9392
93 Ga0068857_100030777 3300005577 Bacteria 4741
94 Ga0068857_100083853 3300005577 Bacteria 2848
95 Ga0068854_100019834 3300005578 Bacteria 4537
96 Ga0068854_100019906 3300005578 Bacteria 4531
97 Ga0068854_100022992 3300005578 Bacteria 4254
98 Ga0068854_100139214 3300005578 Unclassified 1860
99 Ga0068856_100000567 3300005614 Bacteria 40443
100 Ga0068856_100000773 3300005614 Bacteria 34735
101 Ga0068856_100001253 3300005614 Bacteria 26694
102 Ga0068856_100014173 3300005614 Bacteria 7706
103 Ga0068856_100019487 3300005614 Bacteria 6585
104 Ga0068856_100192728 3300005614 Bacteria 2052
105 Ga0068856_100531519 3300005614 Bacteria 1197
106 Ga0068856_100553542 3300005614 Bacteria 1171
107 Ga0068856_100723311 3300005614 Bacteria 1016
108 Ga0070702_100102492 3300005615 Bacteria 1758
109 Ga0068852_100019826 3300005616 Bacteria 5333
110 Ga0068859_100002574 3300005617 Bacteria 18434
111 Ga0068859_100005456 3300005617 Bacteria 12936
112 Ga0068864_100035678 3300005618 Bacteria 4234
113 Ga0068864_100044353 3300005618 Bacteria 3811
114 Ga0068864_100123063 3300005618 Bacteria 2322
115 Ga0068864_100180354 3300005618 Bacteria 1930
116 Ga0068866_10002392 3300005718 Bacteria 7771
117 Ga0068866_10023842 3300005718 Bacteria 2851
118 Ga0068866_10056766 3300005718 Bacteria 2015
119 Ga0068851_10007348 3300005834 Bacteria 5054
120 Ga0068863_100010621 3300005841 Bacteria 8940
121 Ga0068863_100053166 3300005841 Bacteria 3838
122 Ga0068863_100093608 3300005841 Archaea 2852
123 Ga0068863_100265845 3300005841 Bacteria 1659
124 Ga0068858_100018785 3300005842 Bacteria 6466
125 Ga0068858_100047672 3300005842 Bacteria 3971
126 Ga0068858_100102194 3300005842 Bacteria 2674
127 Ga0068860_100013919 3300005843 Bacteria 7887
128 Ga0070717_10008616 3300006028 Bacteria 7625
129 Ga0070717_10013882 3300006028 Bacteria 6187
130 Ga0070717_10057743 3300006028 Bacteria 3208
131 Ga0070717_10065813 3300006028 Bacteria 3013
132 Ga0070717_10074537 3300006028 Bacteria 2837
133 Ga0070717_10088504 3300006028 Bacteria 2610
134 Ga0070717_10154496 3300006028 Bacteria 1987
135 Ga0070716_100003475 3300006173 Bacteria 7424
136 Ga0070716_100017753 3300006173 Unclassified 3694
137 Ga0070716_100019184 3300006173 Bacteria 3572
138 Ga0070716_100063374 3300006173 Bacteria 2146
139 Ga0070712_100003038 3300006175 Bacteria 10376
140 Ga0070712_100006054 3300006175 Bacteria 7489
141 Ga0070712_100010089 3300006175 Bacteria 5952
142 Ga0070712_100022710 3300006175 Unclassified 4136
143 Ga0070712_100061446 3300006175 Bacteria 2654
144 Ga0070712_100076123 3300006175 Bacteria 2416
145 Ga0070712_100160800 3300006175 Bacteria 1734
146 Ga0097621_100000085 3300006237 Bacteria 50268
147 Ga0097621_100005323 3300006237 Bacteria 9063
148 Ga0097621_100009628 3300006237 Bacteria 7024
149 Ga0097621_100011556 3300006237 Bacteria 6507
150 Ga0068871_100000849 3300006358 Bacteria 20448
151 Ga0068871_100001152 3300006358 Bacteria 17738
152 Ga0068871_100002644 3300006358 Bacteria 12239
153 Ga0068871_100050117 3300006358 Bacteria 3377
154 Ga0068871_100087565 3300006358 Bacteria 2589
155 Ga0068871_100107485 3300006358 Bacteria 2343
156 Ga0075434_100003959 3300006871 Bacteria 13266
157 Ga0068865_100116128 3300006881 Bacteria 1982
158 Ga0068865_100294582 3300006881 Bacteria 1296
159 Ga0075436_100002566 3300006914 Bacteria 12505
160 Ga0075436_100088909 3300006914 Bacteria 2146
161 Ga0097620_100002574 3300006931 Bacteria 18434
162 Ga0097620_100005456 3300006931 Bacteria 12936
163 Ga0075435_100003364 3300007076 Bacteria 10843
164 Ga0075435_100015070 3300007076 Bacteria 5803
165 Ga0105240_10015732 3300009093 Bacteria 10267
166 Ga0105240_10036600 3300009093 Bacteria 6311
167 Ga0105240_10235060 3300009093 Bacteria 2127
168 Ga0105240_10377144 3300009093 Bacteria 1602
169 Ga0105245_10064900 3300009098 Bacteria 3300
170 Ga0105245_10098528 3300009098 Bacteria 2701
171 Ga0105245_10152287 3300009098 Bacteria 2188
172 Ga0105245_10346971 3300009098 Bacteria 1470
173 Ga0105245_10933665 3300009098 Bacteria 910
174 Ga0105243_10495395 3300009148 Bacteria 1156
175 Ga0105241_10031176 3300009174 Bacteria 3990
176 Ga0105241_10033908 3300009174 Bacteria 3834
177 Ga0105241_10668216 3300009174 Unclassified 945
178 Ga0105242_10035519 3300009176 Bacteria 3997
179 Ga0105242_10039415 3300009176 Bacteria 3803
180 Ga0105237_10018033 3300009545 Bacteria 7312
181 Ga0105237_10170717 3300009545 Unclassified 2175
182 Ga0105238_10001062 3300009551 Bacteria 27743
183 Ga0105238_10140366 3300009551 Bacteria 2393
184 Ga0105249_10266935 3300009553 Bacteria 1703
185 Ga0105239_10255493 3300010375 Bacteria 1969
186 Ga0105239_10376887 3300010375 Bacteria 1604
187 Ga0105239_10385341 3300010375 Unclassified 1585
188 Ga0157373_10012997 3300013100 Bacteria 6110
189 Ga0157373_10046945 3300013100 Bacteria 3081
190 Ga0157370_10032415 3300013104 Bacteria 5103
191 Ga0157370_10073002 3300013104 Bacteria 3237
192 Ga0157369_10000386 3300013105 Bacteria 58547
193 Ga0157369_10043326 3300013105 Bacteria 4906
194 Ga0157369_10052025 3300013105 Unclassified 4432
195 Ga0157369_10183158 3300013105 Bacteria 2203
196 Ga0157369_10280004 3300013105 Bacteria 1737
197 Ga0157374_10000253 3300013296 Bacteria 49319
198 Ga0157374_10000453 3300013296 Bacteria 37355
199 Ga0157374_10000609 3300013296 Bacteria 31684
200 Ga0157374_10006646 3300013296 Bacteria 9823
201 Ga0157374_10072869 3300013296 Bacteria 3241
202 Ga0157374_10469519 3300013296 Bacteria 1261
203 Ga0157378_10000117 3300013297 Bacteria 76732
204 Ga0157378_10000321 3300013297 Bacteria 47154
205 Ga0157378_10001717 3300013297 Bacteria 19681
206 Ga0157378_10076181 3300013297 Bacteria 3022
207 Ga0163162_10013645 3300013306 Bacteria 7937
208 Ga0157372_10000500 3300013307 Bacteria 43103
209 Ga0157372_10007417 3300013307 Bacteria 11664
210 Ga0157372_10008139 3300013307 Bacteria 11151
211 Ga0157372_10012897 3300013307 Bacteria 8910
212 Ga0157372_10035970 3300013307 Bacteria 5454
213 Ga0157372_10049417 3300013307 Unclassified 4677
214 Ga0157372_10072351 3300013307 Unclassified 3886
215 Ga0157372_10313136 3300013307 Unclassified 1827
216 Ga0157375_10161170 3300013308 Bacteria 2385
217 Ga0157379_10481158 3300014968 Unclassified 1149
218 Ga0157376_10014042 3300014969 Bacteria 5995
219 Ga0157376_10129367 3300014969 Bacteria 2250
220 Ga0157376_10144984 3300014969 Bacteria 2135
221 Ga0157376_10541644 3300014969 Bacteria 1150
222 Ga0224569_102368 3300022732 Unclassified 1537
223 Ga0224571_100238 3300022734 Unclassified 2716
224 Ga0228598_1002108 3300024227 Unclassified 4349
225 Ga0228598_1006462 3300024227 Unclassified 2426
226 Ga0207656_10005405 3300025321 Bacteria 4512
227 Ga0207692_10173225 3300025898 Bacteria 1252
228 Ga0207692_10352180 3300025898 Unclassified 908
229 Ga0207642_10012301 3300025899 Bacteria 3086
230 Ga0207680_10164976 3300025903 Bacteria 1488
231 Ga0207647_10203888 3300025904 Bacteria 1143
232 Ga0207685_10048457 3300025905 Bacteria 1628
233 Ga0207685_10056873 3300025905 Bacteria 1532
234 Ga0207699_10000566 3300025906 Bacteria 18209
235 Ga0207699_10006842 3300025906 Bacteria 5546
236 Ga0207699_10055349 3300025906 Bacteria 2360
237 Ga0207699_10070919 3300025906 Bacteria 2129
238 Ga0207699_10103934 3300025906 Bacteria 1808
239 Ga0207699_10386233 3300025906 Bacteria 995
240 Ga0207645_10009069 3300025907 Bacteria 6904
241 Ga0207705_10381217 3300025909 Bacteria 1089
242 Ga0207684_10005992 3300025910 Bacteria 11122
243 Ga0207684_10345495 3300025910 Bacteria 1281
244 Ga0207654_10010110 3300025911 Bacteria 4799
245 Ga0207654_10018296 3300025911 Bacteria 3675
246 Ga0207707_10008181 3300025912 Bacteria 9075
247 Ga0207707_10153471 3300025912 Bacteria 2013
248 Ga0207707_10166425 3300025912 Bacteria 1927
249 Ga0207707_10166925 3300025912 Bacteria 1924
250 Ga0207707_10195809 3300025912 Bacteria 1763
251 Ga0207695_10004625 3300025913 Bacteria 18666
252 Ga0207695_10025559 3300025913 Bacteria 6608
253 Ga0207695_10033887 3300025913 Bacteria 5560
254 Ga0207671_10029651 3300025914 Bacteria 4084
255 Ga0207671_10125456 3300025914 Bacteria 1966
256 Ga0207693_10000076 3300025915 Bacteria 88185
257 Ga0207693_10000344 3300025915 Bacteria 42936
258 Ga0207693_10004565 3300025915 Bacteria 11690
259 Ga0207693_10011894 3300025915 Bacteria 7036
260 Ga0207693_10017801 3300025915 Bacteria 5665
261 Ga0207693_10117321 3300025915 Bacteria 2090
262 Ga0207663_10004528 3300025916 Bacteria 6920
263 Ga0207663_10019551 3300025916 Bacteria 3819
264 Ga0207663_10037647 3300025916 Bacteria 2918
265 Ga0207663_10049721 3300025916 Bacteria 2602
266 Ga0207660_10378249 3300025917 Archaea 1138
267 Ga0207662_10077990 3300025918 Bacteria 2016
268 Ga0207657_10002319 3300025919 Bacteria 20621
269 Ga0207649_10075429 3300025920 Bacteria 2167
270 Ga0207652_10269916 3300025921 Bacteria 1534
271 Ga0207646_10003289 3300025922 Bacteria 18402
272 Ga0207646_10370707 3300025922 Unclassified 1293
273 Ga0207681_10009802 3300025923 Bacteria 5860
274 Ga0207694_10000816 3300025924 Bacteria 27837
275 Ga0207694_10048076 3300025924 Bacteria 3300
276 Ga0207694_10064323 3300025924 Bacteria 2859
277 Ga0207650_10011352 3300025925 Bacteria 6130
278 Ga0207687_10003874 3300025927 Bacteria 10050
279 Ga0207687_10011597 3300025927 Bacteria 5762
280 Ga0207687_10019765 3300025927 Bacteria 4465
281 Ga0207687_10038123 3300025927 Bacteria 3283
282 Ga0207687_10517686 3300025927 Bacteria 997
283 Ga0207700_10000271 3300025928 Bacteria 30901
284 Ga0207700_10005247 3300025928 Bacteria 7726
285 Ga0207700_10005478 3300025928 Bacteria 7606
286 Ga0207700_10025714 3300025928 Bacteria 4093
287 Ga0207700_10071743 3300025928 Unclassified 2668
288 Ga0207700_10253462 3300025928 Bacteria 1504
289 Ga0207664_10000240 3300025929 Bacteria 41406
290 Ga0207664_10084795 3300025929 Unclassified 2585
291 Ga0207664_10181421 3300025929 Bacteria 1807
292 Ga0207664_10236907 3300025929 Bacteria 1588
293 Ga0207664_10402863 3300025929 Bacteria 1217
294 Ga0207664_10602319 3300025929 Unclassified 987
295 Ga0207690_10167245 3300025932 Bacteria 1644
296 Ga0207706_10000165 3300025933 Bacteria 73590
297 Ga0207686_10036506 3300025934 Bacteria 2959
298 Ga0207686_10094510 3300025934 Bacteria 1982
299 Ga0207709_10032709 3300025935 Bacteria 3048
300 Ga0207704_10256389 3300025938 Bacteria 1316
301 Ga0207665_10003888 3300025939 Bacteria 9991
302 Ga0207665_10004799 3300025939 Bacteria 9003
303 Ga0207665_10016326 3300025939 Bacteria 4875
304 Ga0207665_10116009 3300025939 Bacteria 1887
305 Ga0207665_10170962 3300025939 Unclassified 1569
306 Ga0207691_10105113 3300025940 Bacteria 2515
307 Ga0207711_10002093 3300025941 Bacteria 18016
308 Ga0207711_10003712 3300025941 Bacteria 13162
309 Ga0207711_10059374 3300025941 Bacteria 3293
310 Ga0207711_10262172 3300025941 Bacteria 1589
311 Ga0207689_10025271 3300025942 Bacteria 4977
312 Ga0207661_10141875 3300025944 Bacteria 2068
313 Ga0207679_10013609 3300025945 Bacteria 5334
314 Ga0207679_10309480 3300025945 Bacteria 1364
315 Ga0207667_10001662 3300025949 Bacteria 28037
316 Ga0207667_10002616 3300025949 Bacteria 22316
317 Ga0207667_10009669 3300025949 Bacteria 11342
318 Ga0207667_10032379 3300025949 Bacteria 5635
319 Ga0207667_10065262 3300025949 Bacteria 3798
320 Ga0207667_10357447 3300025949 Unclassified 1489
321 Ga0207712_10007426 3300025961 Bacteria 6920
322 Ga0207668_10010385 3300025972 Bacteria 5625
323 Ga0207640_10014822 3300025981 Bacteria 4496
324 Ga0207640_10016532 3300025981 Bacteria 4294
325 Ga0207640_10097620 3300025981 Bacteria 2051
326 Ga0207640_10221855 3300025981 Bacteria 1448
327 Ga0207658_10168788 3300025986 Bacteria 1800
328 Ga0207677_10002758 3300026023 Bacteria 9276
329 Ga0207703_10047742 3300026035 Bacteria 3453
330 Ga0207703_10176695 3300026035 Bacteria 1881
331 Ga0207639_10066478 3300026041 Bacteria 2802
332 Ga0207639_10190623 3300026041 Bacteria 1751
333 Ga0207678_10001477 3300026067 Bacteria 21564
334 Ga0207702_10000216 3300026078 Bacteria 67884
335 Ga0207702_10000664 3300026078 Bacteria 37414
336 Ga0207702_10011343 3300026078 Bacteria 7430
337 Ga0207702_10031251 3300026078 Bacteria 4437
338 Ga0207702_10039499 3300026078 Bacteria 3954
339 Ga0207702_10042012 3300026078 Bacteria 3834
340 Ga0207702_10105163 3300026078 Bacteria 2500
341 Ga0207702_10266804 3300026078 Bacteria 1614
342 Ga0207702_10866578 3300026078 Bacteria 894
343 Ga0207641_10037183 3300026088 Bacteria 4065
344 Ga0207641_10049378 3300026088 Bacteria 3555
345 Ga0207648_10022211 3300026089 Bacteria 5700
346 Ga0207676_10024247 3300026095 Bacteria 4487
347 Ga0207674_10001619 3300026116 Bacteria 28985
348 Ga0207674_10004568 3300026116 Bacteria 16625
349 Ga0207674_10068835 3300026116 Bacteria 3561
350 Ga0207683_10489786 3300026121 Bacteria 1135
351 Ga0207698_10065753 3300026142 Bacteria 2850
352 Ga0265356_1000205 3300028017 Bacteria 11207
353 Ga0268266_10074112 3300028379 Bacteria 2955
354 Ga0268265_10057481 3300028380 Bacteria 2965
355 Ga0265338_10038025 3300028800 Bacteria 4568
356 Ga0265338_10081798 3300028800 Unclassified 2706
357 Ga0265762_1000037 3300030760 Bacteria 15562
358 Ga0265760_10000115 3300031090 Bacteria 20404
359 Ga0265760_10005301 3300031090 Bacteria 3697
360 Ga0265760_10020164 3300031090 Bacteria 1923
361 Ga0265340_10008156 3300031247 Bacteria 5667
362 Ga0265339_10034914 3300031249 Bacteria 2824
363 Ga0265316_10044177 3300031344 Bacteria 3546
364 Ga0265313_10005956 3300031595 Bacteria 8810
365 Ga0265314_10035510 3300031711 Bacteria 3632
366 Ga0265314_10068053 3300031711 Bacteria 2395
367 Ga0265342_10108806 3300031712 Bacteria 1571
368 Ga0307405_10101357 3300031731 Bacteria 1932
369 Ga0307410_10178654 3300031852 Bacteria 1605
370 Ga0307416_100266675 3300032002 Bacteria 1678
371 Ga0307415_100037308 3300032126 Bacteria 3193
372 Ga0373926_0011579 3300035083 Bacteria 2970
373 Ga0373923_0017315 3300035111 Bacteria 2755
374 Ga0373936_0002341 3300035113 Bacteria 7088
375 Ga0373936_0007176 3300035113 Bacteria 4195
376 Ga0373945_0002492 3300035116 Bacteria 5769
377 Ga0373945_0188757 3300035116 Bacteria 851
378 Ga0373943_0000395 3300035170 Bacteria 18292
379 Ga0373943_0014495 3300035170 Bacteria 3570
380 Ga0373955_0044726 3300035172 Bacteria 2386
381 Ga0373924_0001463 3300035410 Bacteria 7686
382 Ga0373924_0039070 3300035410 Bacteria 1938
383 Ga0373931_0046211 3300035691 Bacteria 2301
384 Ga0373935_0008367 3300035692 Bacteria 6189
385 Ga0373935_0011877 3300035692 Bacteria 5232
386 Ga0373935_0014247 3300035692 Bacteria 4799
387 Ga0373935_0359177 3300035692 Bacteria 1040
388 Ga0373927_0000099 3300035695 Bacteria 65306
389 Ga0373927_0316077 3300035695 Bacteria 1028
390 Ga0373947_0001644 3300035725 Bacteria 13692
391 Ga0373947_0009012 3300035725 Bacteria 5738
392 Ga0373947_0037658 3300035725 Bacteria 2871
393 Ga0373937_0238463 3300036401 Bacteria 1713
394 Ga0373937_0488531 3300036401 Unclassified 1170
395 Ga0373925_0000227 3300037068 Bacteria 60089
396 Ga0373925_0010044 3300037068 Bacteria 6876
397 Ga0373925_0020425 3300037068 Bacteria 4821
398 Ga0373925_0100309 3300037068 Bacteria 2225
399 Ga0451577_0001499 3300042876 Bacteria 30880
400 Ga0453683_0042916 3300044673 Bacteria 2839
401 Ga0453684_0000698 3300044712 Bacteria 119496
402 Ga0451576_0023250 3300045051 Bacteria 6713
403 Ga0466958_0097024 3300045836 Bacteria 1829
404 Ga0466967_0133919 3300045976 Unclassified 2303
405 Ga0466967_0134103 3300045976 Bacteria 2302
406 Ga0495603_0219925 3300046455 Bacteria 1096
407 Ga0495629_0022127 3300046459 Bacteria 4533
408 Ga0495580_0000408 3300046472 Bacteria 35435
409 Ga0495580_0086879 3300046472 Unclassified 2178
410 Ga0495580_0100151 3300046472 Bacteria 2016
411 Ga0495580_0117968 3300046472 Bacteria 1843
412 Ga0495580_0329672 3300046472 Bacteria 1037
413 Ga0495582_0003159 3300046473 Bacteria 9248
414 Ga0495582_0008396 3300046473 Bacteria 5697
415 Ga0495664_0038973 3300046477 Bacteria 2807
416 Ga0495594_0025096 3300046499 Bacteria 3203
417 Ga0495630_0189250 3300046517 Bacteria 1570
418 Ga0495630_0189844 3300046517 Bacteria 1568
419 Ga0495630_0257548 3300046517 Bacteria 1333
420 Ga0495665_0001183 3300046531 Bacteria 13898
421 Ga0495586_0081452 3300046535 Bacteria 1779
422 Ga0495645_0015543 3300046543 Bacteria 5414
423 Ga0495657_0216122 3300046675 Bacteria 1164
424 Ga0495623_0057237 3300046679 Bacteria 2453
425 Ga0495624_0040230 3300046690 Bacteria 2995
426 Ga0495600_0230609 3300046809 Bacteria 1182
427 Ga0495581_0067435 3300047315 Bacteria 2069
428 Ga0495581_0220716 3300047315 Bacteria 1108
429 Ga0495674_0016285 3300047319 Bacteria 6935
430 Ga0495674_0024014 3300047319 Bacteria 5609
431 Ga0495674_0341310 3300047319 Bacteria 1217
432 Ga0495675_0046113 3300047444 Bacteria 2775
433 Ga0496102_0035418 3300048905 Bacteria 4493
434 Ga0496102_0212250 3300048905 Bacteria 1825
435 Ga0496104_0032081 3300048907 Unclassified 4889
436 Ga0496104_0053737 3300048907 Bacteria 3807
437 Ga0496104_0130400 3300048907 Bacteria 2415
438 Ga0496104_0294039 3300048907 Bacteria 1537
439 Ga0496105_0002068 3300048908 Bacteria 14517
440 Ga0496106_0103084 3300048909 Unclassified 2214
441 Ga0496108_0212212 3300048911 Bacteria 1681
442 Ga0496111_0309792 3300048914 Bacteria 1170
443 Ga0496112_0000753 3300048915 Bacteria 22676
444 Ga0496112_0025334 3300048915 Bacteria 5697
445 Ga0496112_0108004 3300048915 Bacteria 2753
446 Ga0496112_0143029 3300048915 Bacteria 2361
447 Ga0496114_0077357 3300048917 Bacteria 2805
448 Ga0496114_0280774 3300048917 Bacteria 1468
449 Ga0496115_0027517 3300048918 Bacteria 4448
450 Ga0496115_0138940 3300048918 Bacteria 2004
451 nmdc:mga0rr50_42029_c1 3300050513 Bacteria 3335
452 Ga0495619_0172455 3300053085 Bacteria 1496
453 Ga0075436_100203308
454 Ga0065712_10082803
455 Ga0065712_10105094
456 Ga0065715_10011916
457 Ga0065715_10111442
458 Ga0070676_10050498
459 Ga0070683_100111289
460 Ga0070683_100222166
461 Ga0070670_100017561
462 Ga0068869_100016098
463 Ga0068869_100053145
464 Ga0070666_10040737
465 Ga0070680_100150744
466 Ga0070682_100008130
467 Ga0068868_100106524
468 Ga0070660_100060293
469 Ga0070660_100172639
470 Ga0070689_100290084
471 Ga0070691_10099153
472 Ga0070687_100097464
473 Ga0070661_100025961
474 Ga0070661_100040940
475 Ga0070668_100005814
476 Ga0070669_100058356
477 Ga0070673_100038009
478 Ga0070659_100037926
479 Ga0070667_100049524
480 Ga0070709_10000616
481 Ga0070709_10172980
482 Ga0070709_10286188
483 Ga0070714_100000775
484 Ga0070714_100331630
485 Ga0070714_100484257
486 Ga0070714_100535305
487 Ga0070713_100000297
488 Ga0070713_100000836
489 Ga0070713_100005635
490 Ga0070713_100029464
491 Ga0070713_100060289
492 Ga0070710_10016625
493 Ga0070710_10342263
494 Ga0070711_100001964
495 Ga0070711_100008149
496 Ga0070711_100011481
497 Ga0070711_100022258
498 Ga0070708_100003650
499 Ga0070708_100025533
500 Ga0070708_100041845
501 Ga0070663_100002712
502 Ga0070678_100022680
503 Ga0070678_100240270
504 Ga0070662_100015183
505 Ga0070681_10000394
506 Ga0070681_10006170
507 Ga0070681_10033759
508 Ga0070681_10242318
509 Ga0068867_100150136
510 Ga0070706_100001186
511 Ga0070706_100001941
512 Ga0070706_100017794
513 Ga0070707_100001843
514 Ga0070707_100112204
515 Ga0070707_100160494
516 Ga0070698_100000758
517 Ga0070699_100012112
518 Ga0070699_100021685
519 Ga0070699_100160110
520 Ga0070679_100003147
521 Ga0070679_100116553
522 Ga0070679_100145331
523 Ga0070684_100109431
524 Ga0070684_100389488
525 Ga0070697_100000353
526 Ga0070697_100011022
527 Ga0070697_100041359
528 Ga0068853_100084572
529 Ga0068853_100095146
530 Ga0070672_100180034
531 Ga0070686_100029896
532 Ga0070695_100036288
533 Ga0070696_100021981
534 Ga0070693_100037478
535 Ga0070693_100051918
536 Ga0070665_100004403
537 Ga0070704_100131555
538 Ga0068855_100000363
539 Ga0068855_100026911
540 Ga0068855_100124890
541 Ga0068855_100165906
542 Ga0070664_100002997
543 Ga0070664_100017999
544 Ga0068857_100007495
545 Ga0068857_100030777
546 Ga0068857_100083853
547 Ga0068854_100019834
548 Ga0068854_100019906
549 Ga0068854_100022992
550 Ga0068854_100139214
551 Ga0068856_100000567
552 Ga0068856_100000773
553 Ga0068856_100001253
554 Ga0068856_100014173
555 Ga0068856_100019487
556 Ga0068856_100192728
557 Ga0068856_100531519
558 Ga0068856_100553542
559 Ga0068856_100723311
560 Ga0070702_100102492
561 Ga0068852_100019826
562 Ga0068859_100002574
563 Ga0068859_100005456
564 Ga0068864_100035678
565 Ga0068864_100044353
566 Ga0068864_100123063
567 Ga0068864_100180354
568 Ga0068866_10002392
569 Ga0068866_10023842
570 Ga0068866_10056766
571 Ga0068851_10007348
572 Ga0068863_100010621
573 Ga0068863_100053166
574 Ga0068863_100093608
575 Ga0068863_100265845
576 Ga0068858_100018785
577 Ga0068858_100047672
578 Ga0068858_100102194
579 Ga0068860_100013919
580 Ga0070717_10008616
581 Ga0070717_10013882
582 Ga0070717_10057743
583 Ga0070717_10065813
584 Ga0070717_10074537
585 Ga0070717_10088504
586 Ga0070717_10154496
587 Ga0070716_100003475
588 Ga0070716_100017753
589 Ga0070716_100019184
590 Ga0070716_100063374
591 Ga0070712_100003038
592 Ga0070712_100006054
593 Ga0070712_100010089
594 Ga0070712_100022710
595 Ga0070712_100061446
596 Ga0070712_100076123
597 Ga0070712_100160800
598 Ga0097621_100000085
599 Ga0097621_100005323
600 Ga0097621_100009628
601 Ga0097621_100011556
602 Ga0068871_100000849
603 Ga0068871_100001152
604 Ga0068871_100002644
605 Ga0068871_100050117
606 Ga0068871_100087565
607 Ga0068871_100107485
608 Ga0075434_100003959
609 Ga0068865_100116128
610 Ga0068865_100294582
611 Ga0075436_100002566
612 Ga0075436_100088909
613 Ga0097620_100002574
614 Ga0097620_100005456
615 Ga0075435_100003364
616 Ga0075435_100015070
617 Ga0105240_10015732
618 Ga0105240_10036600
619 Ga0105240_10235060
620 Ga0105240_10377144
621 Ga0105245_10064900
622 Ga0105245_10098528
623 Ga0105245_10152287
624 Ga0105245_10346971
625 Ga0105245_10933665
626 Ga0105243_10495395
627 Ga0105241_10031176
628 Ga0105241_10033908
629 Ga0105241_10668216
630 Ga0105242_10035519
631 Ga0105242_10039415
632 Ga0105237_10018033
633 Ga0105237_10170717
634 Ga0105238_10001062
635 Ga0105238_10140366
636 Ga0105249_10266935
637 Ga0105239_10255493
638 Ga0105239_10376887
639 Ga0105239_10385341
640 Ga0157373_10012997
641 Ga0157373_10046945
642 Ga0157370_10032415
643 Ga0157370_10073002
644 Ga0157369_10000386
645 Ga0157369_10043326
646 Ga0157369_10052025
647 Ga0157369_10183158
648 Ga0157369_10280004
649 Ga0157374_10000253
650 Ga0157374_10000453
651 Ga0157374_10000609
652 Ga0157374_10006646
653 Ga0157374_10072869
654 Ga0157374_10469519
655 Ga0157378_10000117
656 Ga0157378_10000321
657 Ga0157378_10001717
658 Ga0157378_10076181
659 Ga0163162_10013645
660 Ga0157372_10000500
661 Ga0157372_10007417
662 Ga0157372_10008139
663 Ga0157372_10012897
664 Ga0157372_10035970
665 Ga0157372_10049417
666 Ga0157372_10072351
667 Ga0157372_10313136
668 Ga0157375_10161170
669 Ga0157379_10481158
670 Ga0157376_10014042
671 Ga0157376_10129367
672 Ga0157376_10144984
673 Ga0157376_10541644
674 Ga0224569_102368
675 Ga0224571_100238
676 Ga0228598_1002108
677 Ga0228598_1006462
678 Ga0207656_10005405
679 Ga0207692_10173225
680 Ga0207692_10352180
681 Ga0207642_10012301
682 Ga0207680_10164976
683 Ga0207647_10203888
684 Ga0207685_10048457
685 Ga0207685_10056873
686 Ga0207699_10000566
687 Ga0207699_10006842
688 Ga0207699_10055349
689 Ga0207699_10070919
690 Ga0207699_10103934
691 Ga0207699_10386233
692 Ga0207645_10009069
693 Ga0207705_10381217
694 Ga0207684_10005992
695 Ga0207684_10345495
696 Ga0207654_10010110
697 Ga0207654_10018296
698 Ga0207707_10008181
699 Ga0207707_10153471
700 Ga0207707_10166425
701 Ga0207707_10166925
702 Ga0207707_10195809
703 Ga0207695_10004625
704 Ga0207695_10025559
705 Ga0207695_10033887
706 Ga0207671_10029651
707 Ga0207671_10125456
708 Ga0207693_10000076
709 Ga0207693_10000344
710 Ga0207693_10004565
711 Ga0207693_10011894
712 Ga0207693_10017801
713 Ga0207693_10117321
714 Ga0207663_10004528
715 Ga0207663_10019551
716 Ga0207663_10037647
717 Ga0207663_10049721
718 Ga0207660_10378249
719 Ga0207662_10077990
720 Ga0207657_10002319
721 Ga0207649_10075429
722 Ga0207652_10269916
723 Ga0207646_10003289
724 Ga0207646_10370707
725 Ga0207681_10009802
726 Ga0207694_10000816
727 Ga0207694_10048076
728 Ga0207694_10064323
729 Ga0207650_10011352
730 Ga0207687_10003874
731 Ga0207687_10011597
732 Ga0207687_10019765
733 Ga0207687_10038123
734 Ga0207687_10517686
735 Ga0207700_10000271
736 Ga0207700_10005247
737 Ga0207700_10005478
738 Ga0207700_10025714
739 Ga0207700_10071743
740 Ga0207700_10253462
741 Ga0207664_10000240
742 Ga0207664_10084795
743 Ga0207664_10181421
744 Ga0207664_10236907
745 Ga0207664_10402863
746 Ga0207664_10602319
747 Ga0207690_10167245
748 Ga0207706_10000165
749 Ga0207686_10036506
750 Ga0207686_10094510
751 Ga0207709_10032709
752 Ga0207704_10256389
753 Ga0207665_10003888
754 Ga0207665_10004799
755 Ga0207665_10016326
756 Ga0207665_10116009
757 Ga0207665_10170962
758 Ga0207691_10105113
759 Ga0207711_10002093
760 Ga0207711_10003712
761 Ga0207711_10059374
762 Ga0207711_10262172
763 Ga0207689_10025271
764 Ga0207661_10141875
765 Ga0207679_10013609
766 Ga0207679_10309480
767 Ga0207667_10001662
768 Ga0207667_10002616
769 Ga0207667_10009669
770 Ga0207667_10032379
771 Ga0207667_10065262
772 Ga0207667_10357447
773 Ga0207712_10007426
774 Ga0207668_10010385
775 Ga0207640_10014822
776 Ga0207640_10016532
777 Ga0207640_10097620
778 Ga0207640_10221855
779 Ga0207658_10168788
780 Ga0207677_10002758
781 Ga0207703_10047742
782 Ga0207703_10176695
783 Ga0207639_10066478
784 Ga0207639_10190623
785 Ga0207678_10001477
786 Ga0207702_10000216
787 Ga0207702_10000664
788 Ga0207702_10011343
789 Ga0207702_10031251
790 Ga0207702_10039499
791 Ga0207702_10042012
792 Ga0207702_10105163
793 Ga0207702_10266804
794 Ga0207702_10866578
795 Ga0207641_10037183
796 Ga0207641_10049378
797 Ga0207648_10022211
798 Ga0207676_10024247
799 Ga0207674_10001619
800 Ga0207674_10004568
801 Ga0207674_10068835
802 Ga0207683_10489786
803 Ga0207698_10065753
804 Ga0265356_1000205
805 Ga0268266_10074112
806 Ga0268265_10057481
807 Ga0265338_10038025
808 Ga0265338_10081798
809 Ga0265762_1000037
810 Ga0265760_10000115
811 Ga0265760_10005301
812 Ga0265760_10020164
813 Ga0265340_10008156
814 Ga0265339_10034914
815 Ga0265316_10044177
816 Ga0265313_10005956
817 Ga0265314_10035510
818 Ga0265314_10068053
819 Ga0265342_10108806
820 Ga0307405_10101357
821 Ga0307410_10178654
822 Ga0307416_100266675
823 Ga0307415_100037308
824 Ga0373926_0011579
825 Ga0373923_0017315
826 Ga0373936_0002341
827 Ga0373936_0007176
828 Ga0373945_0002492
829 Ga0373945_0188757
830 Ga0373943_0000395
831 Ga0373943_0014495
832 Ga0373955_0044726
833 Ga0373924_0001463
834 Ga0373924_0039070
835 Ga0373931_0046211
836 Ga0373935_0008367
837 Ga0373935_0011877
838 Ga0373935_0014247
839 Ga0373935_0359177
840 Ga0373927_0000099
841 Ga0373927_0316077
842 Ga0373947_0001644
843 Ga0373947_0009012
844 Ga0373947_0037658
845 Ga0373937_0238463
846 Ga0373937_0488531
847 Ga0373925_0000227
848 Ga0373925_0010044
849 Ga0373925_0020425
850 Ga0373925_0100309
851 Ga0451577_0001499
852 Ga0453683_0042916
853 Ga0453684_0000698
854 Ga0451576_0023250
855 Ga0466958_0097024
856 Ga0466967_0133919
857 Ga0466967_0134103
858 Ga0495603_0219925
859 Ga0495629_0022127
860 Ga0495580_0000408
861 Ga0495580_0086879
862 Ga0495580_0100151
863 Ga0495580_0117968
864 Ga0495580_0329672
865 Ga0495582_0003159
866 Ga0495582_0008396
867 Ga0495664_0038973
868 Ga0495594_0025096
869 Ga0495630_0189250
870 Ga0495630_0189844
871 Ga0495630_0257548
872 Ga0495665_0001183
873 Ga0495586_0081452
874 Ga0495645_0015543
875 Ga0495657_0216122
876 Ga0495623_0057237
877 Ga0495624_0040230
878 Ga0495600_0230609
879 Ga0495581_0067435
880 Ga0495581_0220716
881 Ga0495674_0016285
882 Ga0495674_0024014
883 Ga0495674_0341310
884 Ga0495675_0046113
885 Ga0496102_0035418
886 Ga0496102_0212250
887 Ga0496104_0032081
888 Ga0496104_0053737
889 Ga0496104_0130400
890 Ga0496104_0294039
891 Ga0496105_0002068
892 Ga0496106_0103084
893 Ga0496108_0212212
894 Ga0496111_0309792
895 Ga0496112_0000753
896 Ga0496112_0025334
897 Ga0496112_0108004
898 Ga0496112_0143029
899 Ga0496114_0077357
900 Ga0496114_0280774
901 Ga0496115_0027517
902 Ga0496115_0138940
903 nmdc:mga0rr50_42029_c1
904 Ga0495619_0172455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

288

304

0.98

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

134

270

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.6614 67 246
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.6349 67 240
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.6322 67 240
8a5c-assembly1.cif.gz_A crystal structure of deinococcus radiodurans endonuclease iii-1 y100l variant 0.6005 61 251
5kn8-assembly1.cif.gz_A muty n-terminal domain in complex with undamaged dna 0.5906 71 240
ID Description Score Start End Superfamily
af_C6KSY9_343_419_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.8765 168 240 1.10.1670.10
2abkA02 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.8658 172 246 1.10.1670.10
af_P0AB83_133_208_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.8605 171 245 1.10.1670.10
af_Q58030_126_218_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.8423 171 240 1.10.1670.10
af_P0AB83_133_208_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.8403 171 245 1.10.1670.10
ID Description Score Start End GO Terms
AF-A0A3M1D529-F1-model_v4 Endonuclease III 0.929 169 240 GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A1Q7N3E7-F1-model_v4 HhH-GPD domain-containing protein 0.9267 170 246 GO:0000703
GO:0003906
GO:0006285
GO:0006289
GO:0016829
GO:0051536
AF-A0A7C0XWE4-F1-model_v4 Endonuclease III 0.9195 157 240 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A3D2U929-F1-model_v4 Endonuclease III 0.9184 157 240 GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A0G0ZB61-F1-model_v4 Endonuclease III (DNA-(Apurinic or apyrimidinic site) lyase) 0.9139 159 240 GO:0004519
GO:0006285
GO:0016829
GO:0019104
GO:0046872
GO:0051539

Map