F446871

General Info

Members Datasets Scaffolds Average Seq Length
451 213 902 138

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0560402|Ga0501033_0560402_170_583
Length 137
Sequence MTPTPRSFELRSLTPVLIVDAVEPGLAFWTDRLGFTKENEVPGPDGTLVFASAKKGDVEVMYQTRASVIADGTPASELDGHSITLFITVPSVADLDAIEARVKGTPIVKPRHDTFYGATEFYVREPGGNVVGFAAFK

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.33
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 29.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0560402 3300049570 Bacteria 786
2 MRS1b_contig_3251030 2162886011 Bacteria 1567
3 Ga0065712_10121751 3300005290 Bacteria 1661
4 Ga0065712_10183929 3300005290 Bacteria 1179
5 Ga0065712_10204667 3300005290 Bacteria 1095
6 Ga0065715_10093526 3300005293 Unclassified 4652
7 Ga0065715_10160962 3300005293 Bacteria 1630
8 Ga0070676_10023665 3300005328 Bacteria 3453
9 Ga0070676_10216372 3300005328 Bacteria 1263
10 Ga0070683_100004042 3300005329 Bacteria 12014
11 Ga0070683_100058108 3300005329 Bacteria 3594
12 Ga0070690_100495675 3300005330 Bacteria 913
13 Ga0070690_101002092 3300005330 Bacteria 658
14 Ga0070690_101398583 3300005330 Bacteria 563
15 Ga0068869_100567764 3300005334 Bacteria 955
16 Ga0070666_10384018 3300005335 Unclassified 1008
17 Ga0070680_100038934 3300005336 Bacteria 3846
18 Ga0070680_100084214 3300005336 Unclassified 2626
19 Ga0070680_100361764 3300005336 Unclassified 1234
20 Ga0070680_100773022 3300005336 Bacteria 827
21 Ga0070680_101116354 3300005336 Unclassified 681
22 Ga0070682_100001389 3300005337 Bacteria 13646
23 Ga0070682_100003946 3300005337 Bacteria 8236
24 Ga0070682_100262355 3300005337 Bacteria 1251
25 Ga0070682_101445027 3300005337 Bacteria 589
26 Ga0068868_100113891 3300005338 Bacteria 2200
27 Ga0068868_100774318 3300005338 Unclassified 864
28 Ga0070660_100219566 3300005339 Unclassified 1545
29 Ga0070660_100262809 3300005339 Unclassified 1410
30 Ga0070660_100743775 3300005339 Bacteria 823
31 Ga0070689_100291365 3300005340 Unclassified 1356
32 Ga0070691_10046119 3300005341 Bacteria 2069
33 Ga0070691_10172029 3300005341 Unclassified 1123
34 Ga0070687_100036163 3300005343 Bacteria 2458
35 Ga0070687_100088734 3300005343 Bacteria 1705
36 Ga0070661_100010103 3300005344 Bacteria 6556
37 Ga0070661_100228081 3300005344 Bacteria 1431
38 Ga0070692_10240716 3300005345 Unclassified 1078
39 Ga0070669_100048184 3300005353 Bacteria 3110
40 Ga0070675_100000029 3300005354 Bacteria 102686
41 Ga0070675_101266573 3300005354 Bacteria 679
42 Ga0070671_100443073 3300005355 Bacteria 1114
43 Ga0070674_100365026 3300005356 Bacteria 1170
44 Ga0070673_100009117 3300005364 Bacteria 6645
45 Ga0070673_100422129 3300005364 Bacteria 1196
46 Ga0070673_100577876 3300005364 Unclassified 1023
47 Ga0070659_100101054 3300005366 Bacteria 2321
48 Ga0070659_101214042 3300005366 Unclassified 667
49 Ga0070667_100000040 3300005367 Bacteria 170222
50 Ga0070667_100116200 3300005367 Bacteria 2324
51 Ga0070667_100510915 3300005367 Unclassified 1102
52 Ga0070709_10012888 3300005434 Bacteria 4685
53 Ga0070709_10683670 3300005434 Unclassified 797
54 Ga0070714_100015991 3300005435 Bacteria 6049
55 Ga0070710_10005596 3300005437 Bacteria 5983
56 Ga0070701_10077313 3300005438 Bacteria 1793
57 Ga0070705_100216863 3300005440 Bacteria 1322
58 Ga0070700_100356191 3300005441 Bacteria 1086
59 Ga0070694_100037340 3300005444 Bacteria 3222
60 Ga0070708_100001445 3300005445 Bacteria 18129
61 Ga0070708_100003138 3300005445 Bacteria 12870
62 Ga0070708_100107159 3300005445 Bacteria 2565
63 Ga0070708_100205326 3300005445 Bacteria 1846
64 Ga0070663_100000031 3300005455 Bacteria 74126
65 Ga0070678_100745180 3300005456 Bacteria 886
66 Ga0070662_100005351 3300005457 Bacteria 8202
67 Ga0070662_100154174 3300005457 Bacteria 1792
68 Ga0070662_100652524 3300005457 Unclassified 888
69 Ga0070681_10000409 3300005458 Bacteria 34934
70 Ga0070681_10012229 3300005458 Bacteria 8508
71 Ga0070681_10030436 3300005458 Bacteria 5415
72 Ga0070681_10046938 3300005458 Bacteria 4318
73 Ga0070681_10054795 3300005458 Unclassified 3973
74 Ga0070681_10151458 3300005458 Bacteria 2245
75 Ga0070681_10178525 3300005458 Unclassified 2045
76 Ga0068867_100028688 3300005459 Bacteria 4007
77 Ga0068867_100043431 3300005459 Unclassified 3291
78 Ga0068867_100061007 3300005459 Bacteria 2799
79 Ga0068867_100693155 3300005459 Unclassified 898
80 Ga0070706_100117029 3300005467 Bacteria 2483
81 Ga0070706_100130102 3300005467 Bacteria 2349
82 Ga0070707_100010321 3300005468 Bacteria 8694
83 Ga0070707_100075635 3300005468 Bacteria 3248
84 Ga0070707_100198095 3300005468 Bacteria 1958
85 Ga0070698_100020643 3300005471 Bacteria 6907
86 Ga0070699_100547243 3300005518 Unclassified 1053
87 Ga0070699_100695741 3300005518 Unclassified 929
88 Ga0070679_100004585 3300005530 Bacteria 12752
89 Ga0070679_100026477 3300005530 Bacteria 5698
90 Ga0070679_100057869 3300005530 Bacteria 3863
91 Ga0070679_100134951 3300005530 Bacteria 2449
92 Ga0070679_100292596 3300005530 Bacteria 1580
93 Ga0070679_100326568 3300005530 Bacteria 1483
94 Ga0070679_100478624 3300005530 Bacteria 1189
95 Ga0070679_100528400 3300005530 Bacteria 1124
96 Ga0070679_100667078 3300005530 Bacteria 983
97 Ga0070684_100001569 3300005535 Bacteria 16503
98 Ga0070684_100060033 3300005535 Bacteria 3325
99 Ga0070684_100220701 3300005535 Bacteria 1730
100 Ga0070684_100624914 3300005535 Bacteria 1002
101 Ga0070684_100714159 3300005535 Bacteria 935
102 Ga0070684_100759750 3300005535 Unclassified 905
103 Ga0070697_100079176 3300005536 Bacteria 2705
104 Ga0070697_100265233 3300005536 Unclassified 1471
105 Ga0070697_100305260 3300005536 Bacteria 1368
106 Ga0070697_100343613 3300005536 Bacteria 1288
107 Ga0070697_101829626 3300005536 Unclassified 543
108 Ga0068853_100004928 3300005539 Bacteria 10393
109 Ga0068853_100176370 3300005539 Bacteria 1936
110 Ga0068853_101062058 3300005539 Bacteria 780
111 Ga0070672_100007932 3300005543 Bacteria 7252
112 Ga0070686_100098633 3300005544 Unclassified 1969
113 Ga0070686_100188248 3300005544 Bacteria 1471
114 Ga0070686_100525899 3300005544 Bacteria 922
115 Ga0070695_100001915 3300005545 Bacteria 11778
116 Ga0070695_100025027 3300005545 Bacteria 3682
117 Ga0070695_100030103 3300005545 Bacteria 3378
118 Ga0070695_100153953 3300005545 Bacteria 1607
119 Ga0070695_100409479 3300005545 Unclassified 1030
120 Ga0070696_100315419 3300005546 Unclassified 1202
121 Ga0070696_100836146 3300005546 Bacteria 760
122 Ga0070693_100001273 3300005547 Bacteria 11395
123 Ga0070693_100141019 3300005547 Bacteria 1517
124 Ga0070693_100434234 3300005547 Unclassified 918
125 Ga0070693_100462742 3300005547 Unclassified 892
126 Ga0070693_100821635 3300005547 Unclassified 690
127 Ga0070693_101377337 3300005547 Unclassified 548
128 Ga0070704_100319108 3300005549 Unclassified 1301
129 Ga0070704_101861994 3300005549 Unclassified 557
130 Ga0068855_100005903 3300005563 Bacteria 14931
131 Ga0068855_100017429 3300005563 Bacteria 8639
132 Ga0068855_100141020 3300005563 Bacteria 2747
133 Ga0070664_100001516 3300005564 Bacteria 18524
134 Ga0070664_101740912 3300005564 Unclassified 591
135 Ga0068857_100010759 3300005577 Bacteria 7963
136 Ga0068854_100171933 3300005578 Bacteria 1686
137 Ga0068854_100719594 3300005578 Unclassified 863
138 Ga0068854_100725598 3300005578 Unclassified 860
139 Ga0068856_100109675 3300005614 Bacteria 2756
140 Ga0068856_100154602 3300005614 Bacteria 2304
141 Ga0068856_100252610 3300005614 Bacteria 1778
142 Ga0068856_100310740 3300005614 Bacteria 1594
143 Ga0068856_100551149 3300005614 Unclassified 1174
144 Ga0070702_100074408 3300005615 Bacteria 2015
145 Ga0070702_100183636 3300005615 Bacteria 1371
146 Ga0068852_100122257 3300005616 Bacteria 2386
147 Ga0068852_100918451 3300005616 Unclassified 893
148 Ga0068852_101299149 3300005616 Unclassified 749
149 Ga0068852_101323925 3300005616 Unclassified 742
150 Ga0068852_101970845 3300005616 Unclassified 606
151 Ga0068859_100074087 3300005617 Bacteria 3443
152 Ga0068864_100477668 3300005618 Bacteria 1196
153 Ga0068866_10060308 3300005718 Bacteria 1966
154 Ga0068861_100128020 3300005719 Unclassified 2057
155 Ga0068861_101344770 3300005719 Unclassified 696
156 Ga0068863_100290454 3300005841 Unclassified 1585
157 Ga0068858_100278121 3300005842 Bacteria 1594
158 Ga0068858_100386639 3300005842 Bacteria 1343
159 Ga0068858_100608224 3300005842 Bacteria 1061
160 Ga0068860_100610651 3300005843 Bacteria 1097
161 Ga0068862_100234207 3300005844 Bacteria 1667
162 Ga0081455_10240573 3300005937 Bacteria 1330
163 Ga0070716_100033001 3300006173 Bacteria 2828
164 Ga0070716_100182300 3300006173 Unclassified 1380
165 Ga0068871_100868859 3300006358 Bacteria 835
166 Ga0075428_100825148 3300006844 Bacteria 985
167 Ga0075433_10016451 3300006852 Bacteria 6098
168 Ga0075433_10394662 3300006852 Unclassified 1221
169 Ga0075434_100052491 3300006871 Bacteria 4051
170 Ga0075434_100083234 3300006871 Bacteria 3197
171 Ga0068865_100045437 3300006881 Unclassified 3011
172 Ga0075436_100060180 3300006914 Bacteria 2623
173 Ga0075436_100089739 3300006914 Bacteria 2136
174 Ga0075436_100803196 3300006914 Bacteria 701
175 Ga0075436_100957344 3300006914 Unclassified 642
176 Ga0097620_100074086 3300006931 Bacteria 3443
177 Ga0075435_100041866 3300007076 Bacteria 3662
178 Ga0075435_100496439 3300007076 Unclassified 1055
179 Ga0099795_10024061 3300007788 Viruses 2027
180 Ga0099795_10040366 3300007788 Bacteria 1657
181 Ga0105240_10041532 3300009093 Bacteria 5870
182 Ga0105240_10191212 3300009093 Bacteria 2407
183 Ga0105240_10575312 3300009093 Bacteria 1243
184 Ga0105240_11164903 3300009093 Unclassified 818
185 Ga0105240_11995775 3300009093 Unclassified 603
186 Ga0105245_10006776 3300009098 Bacteria 10043
187 Ga0105245_10012231 3300009098 Bacteria 7467
188 Ga0105245_10061039 3300009098 Unclassified 3397
189 Ga0105245_10113464 3300009098 Bacteria 2523
190 Ga0105245_10233760 3300009098 Bacteria 1779
191 Ga0114129_10071962 3300009147 Bacteria 4820
192 Ga0114129_10144743 3300009147 Bacteria 3256
193 Ga0105243_10218764 3300009148 Bacteria 1682
194 Ga0105241_10622300 3300009174 Unclassified 977
195 Ga0105242_10004781 3300009176 Bacteria 10477
196 Ga0105242_10079654 3300009176 Unclassified 2736
197 Ga0105242_10934951 3300009176 Bacteria 870
198 Ga0105242_11128896 3300009176 Unclassified 799
199 Ga0105242_12220737 3300009176 Unclassified 594
200 Ga0105248_10000289 3300009177 Bacteria 59500
201 Ga0105248_10063145 3300009177 Bacteria 4157
202 Ga0105248_10525369 3300009177 Bacteria 1335
203 Ga0105248_10698277 3300009177 Bacteria 1145
204 Ga0105248_11483051 3300009177 Bacteria 768
205 Ga0105248_12689305 3300009177 Unclassified 567
206 Ga0105237_10000291 3300009545 Bacteria 69396
207 Ga0105237_10029124 3300009545 Bacteria 5617
208 Ga0105238_10017420 3300009551 Bacteria 7301
209 Ga0105238_10099879 3300009551 Bacteria 2885
210 Ga0105249_10000338 3300009553 Bacteria 47285
211 Ga0105249_10480431 3300009553 Bacteria 1285
212 Ga0105249_11204759 3300009553 Bacteria 828
213 Ga0099796_10029192 3300010159 Unclassified 1777
214 Ga0105239_10182759 3300010375 Bacteria 2346
215 Ga0105239_10344125 3300010375 Bacteria 1683
216 Ga0105239_10645596 3300010375 Bacteria 1209
217 Ga0105239_11008127 3300010375 Unclassified 957
218 Ga0105239_12814337 3300010375 Unclassified 568
219 Ga0157373_10189438 3300013100 Bacteria 1450
220 Ga0157373_10335397 3300013100 Unclassified 1077
221 Ga0157370_10125415 3300013104 Unclassified 2397
222 Ga0157370_10172311 3300013104 Bacteria 2011
223 Ga0157369_10066763 3300013105 Unclassified 3869
224 Ga0157369_10097532 3300013105 Unclassified 3136
225 Ga0157369_10346806 3300013105 Unclassified 1542
226 Ga0157369_10400893 3300013105 Bacteria 1423
227 Ga0157369_10429814 3300013105 Bacteria 1369
228 Ga0157374_10459377 3300013296 Bacteria 1275
229 Ga0157374_10628165 3300013296 Unclassified 1085
230 Ga0157378_10003158 3300013297 Bacteria 14648
231 Ga0157378_10003743 3300013297 Bacteria 13481
232 Ga0157378_10023134 3300013297 Bacteria 5469
233 Ga0157378_10581752 3300013297 Bacteria 1129
234 Ga0157378_11628231 3300013297 Unclassified 692
235 Ga0163162_10335766 3300013306 Bacteria 1644
236 Ga0157372_10010522 3300013307 Bacteria 9845
237 Ga0157372_10011795 3300013307 Bacteria 9309
238 Ga0157372_10031822 3300013307 Bacteria 5780
239 Ga0157372_10088364 3300013307 Bacteria 3519
240 Ga0157372_10305087 3300013307 Bacteria 1852
241 Ga0157372_10359056 3300013307 Bacteria 1698
242 Ga0157372_10386581 3300013307 Unclassified 1630
243 Ga0157372_10449570 3300013307 Bacteria 1502
244 Ga0157375_10011474 3300013308 Bacteria 7827
245 Ga0157375_11909358 3300013308 Bacteria 705
246 Ga0163163_10524323 3300014325 Bacteria 1247
247 Ga0157380_10739945 3300014326 Bacteria 993
248 Ga0157377_10009597 3300014745 Bacteria 4757
249 Ga0157379_10896052 3300014968 Bacteria 841
250 Ga0182005_1201290 3300015265 Unclassified 599
251 Ga0206353_10883918 3300020082 Unclassified 674
252 Ga0213876_10292275 3300021384 Unclassified 866
253 Ga0213875_10054917 3300021388 Bacteria 1865
254 Ga0207642_10009574 3300025899 Bacteria 3378
255 Ga0207642_10050432 3300025899 Unclassified 1877
256 Ga0207688_10130384 3300025901 Bacteria 1474
257 Ga0207680_10619276 3300025903 Unclassified 774
258 Ga0207699_10016735 3300025906 Bacteria 3843
259 Ga0207699_10123055 3300025906 Bacteria 1681
260 Ga0207645_10006576 3300025907 Bacteria 8318
261 Ga0207645_10047587 3300025907 Bacteria 2738
262 Ga0207645_10579857 3300025907 Unclassified 761
263 Ga0207654_10220257 3300025911 Unclassified 1258
264 Ga0207707_10001728 3300025912 Bacteria 20055
265 Ga0207707_10032943 3300025912 Bacteria 4536
266 Ga0207707_10041066 3300025912 Bacteria 4039
267 Ga0207707_10047936 3300025912 Bacteria 3722
268 Ga0207707_10148893 3300025912 Unclassified 2047
269 Ga0207707_10256194 3300025912 Bacteria 1519
270 Ga0207707_10311286 3300025912 Unclassified 1360
271 Ga0207707_10398419 3300025912 Bacteria 1182
272 Ga0207695_10058625 3300025913 Unclassified 3996
273 Ga0207695_10079782 3300025913 Bacteria 3316
274 Ga0207695_10124331 3300025913 Unclassified 2544
275 Ga0207695_10459440 3300025913 Bacteria 1156
276 Ga0207671_10007691 3300025914 Bacteria 9304
277 Ga0207693_10958018 3300025915 Unclassified 655
278 Ga0207660_10039271 3300025917 Bacteria 3308
279 Ga0207660_10107777 3300025917 Bacteria 2091
280 Ga0207660_10116985 3300025917 Bacteria 2014
281 Ga0207660_10479924 3300025917 Bacteria 1007
282 Ga0207660_11336568 3300025917 Unclassified 581
283 Ga0207662_10022599 3300025918 Bacteria 3607
284 Ga0207662_10370807 3300025918 Unclassified 965
285 Ga0207657_10258139 3300025919 Unclassified 1387
286 Ga0207657_11229156 3300025919 Archaea 568
287 Ga0207649_10005395 3300025920 Bacteria 6923
288 Ga0207649_11210840 3300025920 Unclassified 597
289 Ga0207652_10003387 3300025921 Bacteria 13172
290 Ga0207652_10026050 3300025921 Unclassified 4867
291 Ga0207652_10088318 3300025921 Unclassified 2720
292 Ga0207652_10094414 3300025921 Unclassified 2634
293 Ga0207652_10109416 3300025921 Bacteria 2450
294 Ga0207652_10112426 3300025921 Bacteria 2417
295 Ga0207652_10198263 3300025921 Bacteria 1807
296 Ga0207652_10350438 3300025921 Bacteria 1332
297 Ga0207652_10389404 3300025921 Bacteria 1258
298 Ga0207652_10428568 3300025921 Bacteria 1193
299 Ga0207646_10010691 3300025922 Bacteria 8934
300 Ga0207646_11168960 3300025922 Bacteria 675
301 Ga0207681_10018228 3300025923 Bacteria 4422
302 Ga0207681_10569899 3300025923 Unclassified 933
303 Ga0207694_10272098 3300025924 Bacteria 1389
304 Ga0207659_10000073 3300025926 Bacteria 64021
305 Ga0207687_10143860 3300025927 Bacteria 1812
306 Ga0207687_10207671 3300025927 Bacteria 1535
307 Ga0207687_10290527 3300025927 Bacteria 1314
308 Ga0207687_10371387 3300025927 Unclassified 1170
309 Ga0207687_10612866 3300025927 Unclassified 918
310 Ga0207687_10614915 3300025927 Bacteria 917
311 Ga0207664_10058879 3300025929 Bacteria 3058
312 Ga0207690_11070277 3300025932 Unclassified 672
313 Ga0207706_10010967 3300025933 Bacteria 8263
314 Ga0207706_10028481 3300025933 Bacteria 4989
315 Ga0207706_10225385 3300025933 Bacteria 1641
316 Ga0207686_10048041 3300025934 Bacteria 2641
317 Ga0207686_10099666 3300025934 Bacteria 1937
318 Ga0207686_11629297 3300025934 Unclassified 533
319 Ga0207670_11246264 3300025936 Bacteria 630
320 Ga0207669_10088030 3300025937 Unclassified 2013
321 Ga0207704_10242602 3300025938 Bacteria 1347
322 Ga0207704_10953606 3300025938 Unclassified 724
323 Ga0207665_10003227 3300025939 Bacteria 10922
324 Ga0207665_10314231 3300025939 Unclassified 1174
325 Ga0207691_10184147 3300025940 Bacteria 1824
326 Ga0207711_10000265 3300025941 Bacteria 56633
327 Ga0207711_10022698 3300025941 Bacteria 5249
328 Ga0207711_10324800 3300025941 Unclassified 1422
329 Ga0207711_11837787 3300025941 Bacteria 549
330 Ga0207661_10013579 3300025944 Bacteria 5947
331 Ga0207661_10031420 3300025944 Bacteria 4102
332 Ga0207661_10974938 3300025944 Bacteria 781
333 Ga0207679_10008403 3300025945 Bacteria 6577
334 Ga0207679_10375012 3300025945 Bacteria 1246
335 Ga0207679_10853924 3300025945 Unclassified 831
336 Ga0207667_10008749 3300025949 Bacteria 12001
337 Ga0207667_10160528 3300025949 Unclassified 2312
338 Ga0207667_10362382 3300025949 Unclassified 1478
339 Ga0207651_10030057 3300025960 Bacteria 3453
340 Ga0207651_10373377 3300025960 Bacteria 1207
341 Ga0207651_11322939 3300025960 Unclassified 648
342 Ga0207712_10000872 3300025961 Bacteria 21924
343 Ga0207712_10084886 3300025961 Bacteria 2315
344 Ga0207712_10779039 3300025961 Bacteria 840
345 Ga0207712_11611061 3300025961 Unclassified 582
346 Ga0207640_10425011 3300025981 Unclassified 1088
347 Ga0207640_10746773 3300025981 Bacteria 843
348 Ga0207640_11019329 3300025981 Unclassified 729
349 Ga0207658_10000020 3300025986 Bacteria 202984
350 Ga0207658_10350923 3300025986 Unclassified 1285
351 Ga0207677_10017594 3300026023 Bacteria 4267
352 Ga0207677_10096118 3300026023 Bacteria 2167
353 Ga0207703_10601074 3300026035 Bacteria 1040
354 Ga0207639_10004713 3300026041 Bacteria 9182
355 Ga0207639_10903594 3300026041 Unclassified 825
356 Ga0207639_11145417 3300026041 Bacteria 730
357 Ga0207678_10000010 3300026067 Bacteria 149258
358 Ga0207708_10001320 3300026075 Bacteria 18634
359 Ga0207702_10027227 3300026078 Bacteria 4748
360 Ga0207702_10228322 3300026078 Bacteria 1738
361 Ga0207702_10348847 3300026078 Unclassified 1416
362 Ga0207702_11535329 3300026078 Unclassified 659
363 Ga0207641_10273520 3300026088 Unclassified 1586
364 Ga0207641_11704523 3300026088 Unclassified 632
365 Ga0207648_10023071 3300026089 Bacteria 5581
366 Ga0207648_10064453 3300026089 Bacteria 3194
367 Ga0207648_10117882 3300026089 Unclassified 2333
368 Ga0207648_10276499 3300026089 Unclassified 1501
369 Ga0207676_11147981 3300026095 Bacteria 769
370 Ga0207674_10001487 3300026116 Bacteria 30252
371 Ga0207675_100051308 3300026118 Bacteria 3848
372 Ga0207675_100480638 3300026118 Unclassified 1235
373 Ga0207675_101125080 3300026118 Unclassified 805
374 Ga0207698_10010863 3300026142 Bacteria 5877
375 Ga0207698_10403904 3300026142 Bacteria 1306
376 Ga0207698_10416273 3300026142 Bacteria 1288
377 Ga0207698_10643612 3300026142 Bacteria 1049
378 Ga0209967_1001389 3300027364 Bacteria 3102
379 Ga0210000_1007053 3300027462 Unclassified 1641
380 Ga0209968_1015667 3300027526 Unclassified 1201
381 Ga0209970_1090548 3300027614 Unclassified 580
382 Ga0209966_1133016 3300027695 Unclassified 575
383 Ga0373948_0023358 3300034817 Bacteria 1199
384 Ga0373950_0036262 3300034818 Bacteria 930
385 Ga0373958_0000572 3300034819 Bacteria 4574
386 Ga0373959_0003689 3300034820 Unclassified 2452
387 Ga0373938_0000235 3300034957 Bacteria 8644
388 Ga0373928_0004433 3300035084 Bacteria 2673
389 Ga0373929_0002931 3300035085 Bacteria 3111
390 Ga0373940_0000853 3300035088 Bacteria 5110
391 Ga0373949_0015234 3300035090 Bacteria 1715
392 Ga0373951_0004979 3300035091 Bacteria 3113
393 Ga0373951_0043530 3300035091 Bacteria 1089
394 Ga0373952_0010527 3300035092 Bacteria 1789
395 Ga0373932_0012470 3300035112 Bacteria 2093
396 Ga0373960_0021302 3300035121 Bacteria 1722
397 Ga0373960_0122133 3300035121 Unclassified 865
398 Ga0373942_0001335 3300035207 Bacteria 6401
399 Ga0373942_0297768 3300035207 Unclassified 559
400 Ga0373961_0024157 3300035241 Bacteria 1642
401 Ga0373962_0001684 3300035242 Bacteria 5254
402 Ga0373931_0008621 3300035691 Bacteria 4844
403 Ga0373931_0039636 3300035691 Bacteria 2468
404 Ga0373931_0118723 3300035691 Bacteria 1509
405 Ga0373931_0913931 3300035691 Unclassified 590
406 Ga0373927_0009495 3300035695 Bacteria 6523
407 Ga0373937_0744210 3300036401 Unclassified 928
408 Ga0436364_0290793 3300037853 Bacteria 1267
409 Ga0436365_0931492 3300039437 Bacteria 11326
410 Ga0436365_1061046 3300039437 Bacteria 927
411 Ga0451576_0061516 3300045051 Bacteria 3915
412 Ga0451576_0670278 3300045051 Bacteria 1090
413 Ga0495629_0006086 3300046459 Bacteria 8965
414 Ga0495580_0013960 3300046472 Bacteria 6111
415 Ga0495582_0162867 3300046473 Bacteria 1269
416 Ga0495582_0278020 3300046473 Bacteria 961
417 Ga0495594_0026579 3300046499 Bacteria 3115
418 Ga0495594_0233464 3300046499 Unclassified 1048
419 Ga0495665_0246234 3300046531 Bacteria 921
420 Ga0495587_0665226 3300046536 Bacteria 572
421 Ga0495645_0823815 3300046543 Unclassified 555
422 Ga0495588_0453935 3300046674 Unclassified 672
423 Ga0495658_0555238 3300046683 Bacteria 735
424 Ga0495669_0404318 3300046684 Bacteria 662
425 Ga0495581_0384302 3300047315 Bacteria 819
426 Ga0496106_0901768 3300048909 Bacteria 698
427 Ga0496109_0418053 3300048912 Unclassified 1267
428 Ga0496112_0005755 3300048915 Bacteria 10779
429 Ga0496112_0067381 3300048915 Unclassified 3533
430 Ga0496112_0189703 3300048915 Bacteria 2018
431 Ga0496113_1505584 3300048916 Bacteria 519
432 Ga0496117_0180362 3300048920 Bacteria 1214
433 Ga0496118_0218348 3300048921 Bacteria 1112
434 Ga0496121_0147390 3300048924 Bacteria 1737
435 Ga0496122_0000037 3300048925 Bacteria 304495
436 Ga0496123_0000083 3300048926 Bacteria 188730
437 Ga0496126_0611700 3300048929 Bacteria 857
438 Ga0501042_0649606 3300049578 Bacteria 767
439 Ga0501043_0769176 3300049579 Bacteria 699
440 Ga0501046_0659635 3300049580 Bacteria 739
441 Ga0501047_0504779 3300049581 Unclassified 1036
442 Ga0501048_0899981 3300049582 Bacteria 636
443 Ga0501073_0647736 3300049589 Bacteria 729
444 Ga0501044_0818500 3300049823 Unclassified 810
445 nmdc:mga0rr50_1093618_c1 3300050513 Unclassified 678
446 nmdc:mga0rr50_11226_c1 3300050513 Bacteria 5721
447 nmdc:mga08x19_114444_c1 3300050514 Unclassified 1802
448 nmdc:mga08x19_386303_c1 3300050514 Bacteria 981
449 nmdc:mga08x19_403464_c1 3300050514 Bacteria 959
450 nmdc:mga08x19_52917_c1 3300050514 Bacteria 2612
451 Ga0500652_177736 3300053131 Bacteria 873
452 Ga0501033_0560402
453 MRS1b_contig_3251030
454 Ga0065712_10121751
455 Ga0065712_10183929
456 Ga0065712_10204667
457 Ga0065715_10093526
458 Ga0065715_10160962
459 Ga0070676_10023665
460 Ga0070676_10216372
461 Ga0070683_100004042
462 Ga0070683_100058108
463 Ga0070690_100495675
464 Ga0070690_101002092
465 Ga0070690_101398583
466 Ga0068869_100567764
467 Ga0070666_10384018
468 Ga0070680_100038934
469 Ga0070680_100084214
470 Ga0070680_100361764
471 Ga0070680_100773022
472 Ga0070680_101116354
473 Ga0070682_100001389
474 Ga0070682_100003946
475 Ga0070682_100262355
476 Ga0070682_101445027
477 Ga0068868_100113891
478 Ga0068868_100774318
479 Ga0070660_100219566
480 Ga0070660_100262809
481 Ga0070660_100743775
482 Ga0070689_100291365
483 Ga0070691_10046119
484 Ga0070691_10172029
485 Ga0070687_100036163
486 Ga0070687_100088734
487 Ga0070661_100010103
488 Ga0070661_100228081
489 Ga0070692_10240716
490 Ga0070669_100048184
491 Ga0070675_100000029
492 Ga0070675_101266573
493 Ga0070671_100443073
494 Ga0070674_100365026
495 Ga0070673_100009117
496 Ga0070673_100422129
497 Ga0070673_100577876
498 Ga0070659_100101054
499 Ga0070659_101214042
500 Ga0070667_100000040
501 Ga0070667_100116200
502 Ga0070667_100510915
503 Ga0070709_10012888
504 Ga0070709_10683670
505 Ga0070714_100015991
506 Ga0070710_10005596
507 Ga0070701_10077313
508 Ga0070705_100216863
509 Ga0070700_100356191
510 Ga0070694_100037340
511 Ga0070708_100001445
512 Ga0070708_100003138
513 Ga0070708_100107159
514 Ga0070708_100205326
515 Ga0070663_100000031
516 Ga0070678_100745180
517 Ga0070662_100005351
518 Ga0070662_100154174
519 Ga0070662_100652524
520 Ga0070681_10000409
521 Ga0070681_10012229
522 Ga0070681_10030436
523 Ga0070681_10046938
524 Ga0070681_10054795
525 Ga0070681_10151458
526 Ga0070681_10178525
527 Ga0068867_100028688
528 Ga0068867_100043431
529 Ga0068867_100061007
530 Ga0068867_100693155
531 Ga0070706_100117029
532 Ga0070706_100130102
533 Ga0070707_100010321
534 Ga0070707_100075635
535 Ga0070707_100198095
536 Ga0070698_100020643
537 Ga0070699_100547243
538 Ga0070699_100695741
539 Ga0070679_100004585
540 Ga0070679_100026477
541 Ga0070679_100057869
542 Ga0070679_100134951
543 Ga0070679_100292596
544 Ga0070679_100326568
545 Ga0070679_100478624
546 Ga0070679_100528400
547 Ga0070679_100667078
548 Ga0070684_100001569
549 Ga0070684_100060033
550 Ga0070684_100220701
551 Ga0070684_100624914
552 Ga0070684_100714159
553 Ga0070684_100759750
554 Ga0070697_100079176
555 Ga0070697_100265233
556 Ga0070697_100305260
557 Ga0070697_100343613
558 Ga0070697_101829626
559 Ga0068853_100004928
560 Ga0068853_100176370
561 Ga0068853_101062058
562 Ga0070672_100007932
563 Ga0070686_100098633
564 Ga0070686_100188248
565 Ga0070686_100525899
566 Ga0070695_100001915
567 Ga0070695_100025027
568 Ga0070695_100030103
569 Ga0070695_100153953
570 Ga0070695_100409479
571 Ga0070696_100315419
572 Ga0070696_100836146
573 Ga0070693_100001273
574 Ga0070693_100141019
575 Ga0070693_100434234
576 Ga0070693_100462742
577 Ga0070693_100821635
578 Ga0070693_101377337
579 Ga0070704_100319108
580 Ga0070704_101861994
581 Ga0068855_100005903
582 Ga0068855_100017429
583 Ga0068855_100141020
584 Ga0070664_100001516
585 Ga0070664_101740912
586 Ga0068857_100010759
587 Ga0068854_100171933
588 Ga0068854_100719594
589 Ga0068854_100725598
590 Ga0068856_100109675
591 Ga0068856_100154602
592 Ga0068856_100252610
593 Ga0068856_100310740
594 Ga0068856_100551149
595 Ga0070702_100074408
596 Ga0070702_100183636
597 Ga0068852_100122257
598 Ga0068852_100918451
599 Ga0068852_101299149
600 Ga0068852_101323925
601 Ga0068852_101970845
602 Ga0068859_100074087
603 Ga0068864_100477668
604 Ga0068866_10060308
605 Ga0068861_100128020
606 Ga0068861_101344770
607 Ga0068863_100290454
608 Ga0068858_100278121
609 Ga0068858_100386639
610 Ga0068858_100608224
611 Ga0068860_100610651
612 Ga0068862_100234207
613 Ga0081455_10240573
614 Ga0070716_100033001
615 Ga0070716_100182300
616 Ga0068871_100868859
617 Ga0075428_100825148
618 Ga0075433_10016451
619 Ga0075433_10394662
620 Ga0075434_100052491
621 Ga0075434_100083234
622 Ga0068865_100045437
623 Ga0075436_100060180
624 Ga0075436_100089739
625 Ga0075436_100803196
626 Ga0075436_100957344
627 Ga0097620_100074086
628 Ga0075435_100041866
629 Ga0075435_100496439
630 Ga0099795_10024061
631 Ga0099795_10040366
632 Ga0105240_10041532
633 Ga0105240_10191212
634 Ga0105240_10575312
635 Ga0105240_11164903
636 Ga0105240_11995775
637 Ga0105245_10006776
638 Ga0105245_10012231
639 Ga0105245_10061039
640 Ga0105245_10113464
641 Ga0105245_10233760
642 Ga0114129_10071962
643 Ga0114129_10144743
644 Ga0105243_10218764
645 Ga0105241_10622300
646 Ga0105242_10004781
647 Ga0105242_10079654
648 Ga0105242_10934951
649 Ga0105242_11128896
650 Ga0105242_12220737
651 Ga0105248_10000289
652 Ga0105248_10063145
653 Ga0105248_10525369
654 Ga0105248_10698277
655 Ga0105248_11483051
656 Ga0105248_12689305
657 Ga0105237_10000291
658 Ga0105237_10029124
659 Ga0105238_10017420
660 Ga0105238_10099879
661 Ga0105249_10000338
662 Ga0105249_10480431
663 Ga0105249_11204759
664 Ga0099796_10029192
665 Ga0105239_10182759
666 Ga0105239_10344125
667 Ga0105239_10645596
668 Ga0105239_11008127
669 Ga0105239_12814337
670 Ga0157373_10189438
671 Ga0157373_10335397
672 Ga0157370_10125415
673 Ga0157370_10172311
674 Ga0157369_10066763
675 Ga0157369_10097532
676 Ga0157369_10346806
677 Ga0157369_10400893
678 Ga0157369_10429814
679 Ga0157374_10459377
680 Ga0157374_10628165
681 Ga0157378_10003158
682 Ga0157378_10003743
683 Ga0157378_10023134
684 Ga0157378_10581752
685 Ga0157378_11628231
686 Ga0163162_10335766
687 Ga0157372_10010522
688 Ga0157372_10011795
689 Ga0157372_10031822
690 Ga0157372_10088364
691 Ga0157372_10305087
692 Ga0157372_10359056
693 Ga0157372_10386581
694 Ga0157372_10449570
695 Ga0157375_10011474
696 Ga0157375_11909358
697 Ga0163163_10524323
698 Ga0157380_10739945
699 Ga0157377_10009597
700 Ga0157379_10896052
701 Ga0182005_1201290
702 Ga0206353_10883918
703 Ga0213876_10292275
704 Ga0213875_10054917
705 Ga0207642_10009574
706 Ga0207642_10050432
707 Ga0207688_10130384
708 Ga0207680_10619276
709 Ga0207699_10016735
710 Ga0207699_10123055
711 Ga0207645_10006576
712 Ga0207645_10047587
713 Ga0207645_10579857
714 Ga0207654_10220257
715 Ga0207707_10001728
716 Ga0207707_10032943
717 Ga0207707_10041066
718 Ga0207707_10047936
719 Ga0207707_10148893
720 Ga0207707_10256194
721 Ga0207707_10311286
722 Ga0207707_10398419
723 Ga0207695_10058625
724 Ga0207695_10079782
725 Ga0207695_10124331
726 Ga0207695_10459440
727 Ga0207671_10007691
728 Ga0207693_10958018
729 Ga0207660_10039271
730 Ga0207660_10107777
731 Ga0207660_10116985
732 Ga0207660_10479924
733 Ga0207660_11336568
734 Ga0207662_10022599
735 Ga0207662_10370807
736 Ga0207657_10258139
737 Ga0207657_11229156
738 Ga0207649_10005395
739 Ga0207649_11210840
740 Ga0207652_10003387
741 Ga0207652_10026050
742 Ga0207652_10088318
743 Ga0207652_10094414
744 Ga0207652_10109416
745 Ga0207652_10112426
746 Ga0207652_10198263
747 Ga0207652_10350438
748 Ga0207652_10389404
749 Ga0207652_10428568
750 Ga0207646_10010691
751 Ga0207646_11168960
752 Ga0207681_10018228
753 Ga0207681_10569899
754 Ga0207694_10272098
755 Ga0207659_10000073
756 Ga0207687_10143860
757 Ga0207687_10207671
758 Ga0207687_10290527
759 Ga0207687_10371387
760 Ga0207687_10612866
761 Ga0207687_10614915
762 Ga0207664_10058879
763 Ga0207690_11070277
764 Ga0207706_10010967
765 Ga0207706_10028481
766 Ga0207706_10225385
767 Ga0207686_10048041
768 Ga0207686_10099666
769 Ga0207686_11629297
770 Ga0207670_11246264
771 Ga0207669_10088030
772 Ga0207704_10242602
773 Ga0207704_10953606
774 Ga0207665_10003227
775 Ga0207665_10314231
776 Ga0207691_10184147
777 Ga0207711_10000265
778 Ga0207711_10022698
779 Ga0207711_10324800
780 Ga0207711_11837787
781 Ga0207661_10013579
782 Ga0207661_10031420
783 Ga0207661_10974938
784 Ga0207679_10008403
785 Ga0207679_10375012
786 Ga0207679_10853924
787 Ga0207667_10008749
788 Ga0207667_10160528
789 Ga0207667_10362382
790 Ga0207651_10030057
791 Ga0207651_10373377
792 Ga0207651_11322939
793 Ga0207712_10000872
794 Ga0207712_10084886
795 Ga0207712_10779039
796 Ga0207712_11611061
797 Ga0207640_10425011
798 Ga0207640_10746773
799 Ga0207640_11019329
800 Ga0207658_10000020
801 Ga0207658_10350923
802 Ga0207677_10017594
803 Ga0207677_10096118
804 Ga0207703_10601074
805 Ga0207639_10004713
806 Ga0207639_10903594
807 Ga0207639_11145417
808 Ga0207678_10000010
809 Ga0207708_10001320
810 Ga0207702_10027227
811 Ga0207702_10228322
812 Ga0207702_10348847
813 Ga0207702_11535329
814 Ga0207641_10273520
815 Ga0207641_11704523
816 Ga0207648_10023071
817 Ga0207648_10064453
818 Ga0207648_10117882
819 Ga0207648_10276499
820 Ga0207676_11147981
821 Ga0207674_10001487
822 Ga0207675_100051308
823 Ga0207675_100480638
824 Ga0207675_101125080
825 Ga0207698_10010863
826 Ga0207698_10403904
827 Ga0207698_10416273
828 Ga0207698_10643612
829 Ga0209967_1001389
830 Ga0210000_1007053
831 Ga0209968_1015667
832 Ga0209970_1090548
833 Ga0209966_1133016
834 Ga0373948_0023358
835 Ga0373950_0036262
836 Ga0373958_0000572
837 Ga0373959_0003689
838 Ga0373938_0000235
839 Ga0373928_0004433
840 Ga0373929_0002931
841 Ga0373940_0000853
842 Ga0373949_0015234
843 Ga0373951_0004979
844 Ga0373951_0043530
845 Ga0373952_0010527
846 Ga0373932_0012470
847 Ga0373960_0021302
848 Ga0373960_0122133
849 Ga0373942_0001335
850 Ga0373942_0297768
851 Ga0373961_0024157
852 Ga0373962_0001684
853 Ga0373931_0008621
854 Ga0373931_0039636
855 Ga0373931_0118723
856 Ga0373931_0913931
857 Ga0373927_0009495
858 Ga0373937_0744210
859 Ga0436364_0290793
860 Ga0436365_0931492
861 Ga0436365_1061046
862 Ga0451576_0061516
863 Ga0451576_0670278
864 Ga0495629_0006086
865 Ga0495580_0013960
866 Ga0495582_0162867
867 Ga0495582_0278020
868 Ga0495594_0026579
869 Ga0495594_0233464
870 Ga0495665_0246234
871 Ga0495587_0665226
872 Ga0495645_0823815
873 Ga0495588_0453935
874 Ga0495658_0555238
875 Ga0495669_0404318
876 Ga0495581_0384302
877 Ga0496106_0901768
878 Ga0496109_0418053
879 Ga0496112_0005755
880 Ga0496112_0067381
881 Ga0496112_0189703
882 Ga0496113_1505584
883 Ga0496117_0180362
884 Ga0496118_0218348
885 Ga0496121_0147390
886 Ga0496122_0000037
887 Ga0496123_0000083
888 Ga0496126_0611700
889 Ga0501042_0649606
890 Ga0501043_0769176
891 Ga0501046_0659635
892 Ga0501047_0504779
893 Ga0501048_0899981
894 Ga0501073_0647736
895 Ga0501044_0818500
896 nmdc:mga0rr50_1093618_c1
897 nmdc:mga0rr50_11226_c1
898 nmdc:mga08x19_114444_c1
899 nmdc:mga08x19_386303_c1
900 nmdc:mga08x19_403464_c1
901 nmdc:mga08x19_52917_c1
902 Ga0500652_177736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

133

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8404 16 138
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8063 19 140
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8025 16 138
4nvs-assembly1.cif.gz_A crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 0.7989 15 138
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7741 15 140
ID Description Score Start End Superfamily
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9131 91 137 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8769 89 138 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8129 88 140 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8091 87 140 3.30.720.110
4nvsA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8074 16 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9T107-F1-model_v4 VOC family protein 0.9976 15 140
AF-A0A1Q7QJQ6-F1-model_v4 VOC domain-containing protein 0.9974 14 140
AF-A0A2V7HVK1-F1-model_v4 VOC domain-containing protein 0.9816 25 140
AF-A0A2V7HVK1-F1-model_v4 VOC domain-containing protein 0.9652 25 140
AF-A0A2V9UV26-F1-model_v4 VOC domain-containing protein 0.9651 14 140

Map