F446850

General Info

Members Datasets Scaffolds Average Seq Length
451 195 381 115

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0001865|Ga0495650_0001865_12657_13034
Length 125
Sequence MRNYRNFFMIPHEIERHQAQPQQVEIVLHLDPNLFWFGGHFAVQPLLPGVAQLDWVMHYATTLLAPGWRFHSIQNVKFQAPLLPETTVTLALSWQEARQILAFSYQRHDGDARHTASSGKIRLCR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
9 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
10 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
11 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
12 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
13 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
14 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
15 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
16 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
17 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
18 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
19 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
20 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
21 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
22 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
23 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
24 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
25 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
26 2751185917 Enterobacter sp. HK169 Isolate Unclassified
27 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
28 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
29 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
30 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
31 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
32 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
33 2821118458 Enterobacter asburiae 609 Isolate Unclassified
34 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
35 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
36 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
37 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
38 2865014394 Pantoea sp. R-71966 Isolate Unclassified
39 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
40 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
41 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
42 2876601092 Pantoea endophytica 596 Isolate Unclassified
43 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
44 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
45 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
46 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
47 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
48 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
49 2904504865 Serratia marcescens 1822 Isolate Unclassified
50 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
51 2937539931 Pantoea sp. LS15 Isolate Unclassified
52 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
53 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
54 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
55 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
56 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
57 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
58 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
59 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
60 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
61 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
65 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
121 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
128 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
129 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
186 640753048 Serratia proteamaculans 568 Isolate Endosphere
187 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
188 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
189 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
190 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
191 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
192 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
193 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
194 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
195 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.48
Metatranscriptomes 0
Isolates 15.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 3.1
Nodule 4.21
Rhizoplane 6.87
Rhizosphere 57.21
Stem 0
Stem Tuber 0.89
Unclassified 27.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_121856 2162886007 Bacteria 7727
2 SwRhRL2b_contig_2498991 2162886007 Bacteria 1029
3 SwRhRL2b_contig_714942 2162886007 Bacteria 2605
4 JGI24739J22299_10001919 3300001989 Bacteria 7955
5 JGI25162J39368_1009243 3300002737 Bacteria 1336
6 Ga0058692_1000241 3300003856 Bacteria 30802
7 Ga0058692_1000467 3300003856 Bacteria 18185
8 Ga0058692_1000511 3300003856 Bacteria 17175
9 Ga0058692_1000526 3300003856 Bacteria 16625
10 Ga0058692_1018456 3300003856 Bacteria 1508
11 Ga0058692_1032548 3300003856 Bacteria 973
12 Ga0058692_1066679 3300003856 Bacteria 554
13 Ga0065703_1018816 3300005272 Bacteria 6766
14 Ga0065704_10085195 3300005289 Bacteria 3248
15 Ga0065704_10138013 3300005289 Bacteria 1548
16 Ga0070668_100070880 3300005347 Bacteria 2714
17 Ga0070659_100009800 3300005366 Bacteria 7041
18 Ga0070662_100062183 3300005457 Bacteria 2727
19 Ga0070665_100000117 3300005548 Bacteria 149831
20 Ga0070665_100015389 3300005548 Bacteria 7682
21 Ga0070665_100323745 3300005548 Bacteria 1546
22 Ga0070664_101132654 3300005564 Bacteria 737
23 Ga0068857_100000006 3300005577 Bacteria 168660
24 Ga0068851_10001763 3300005834 Bacteria 9460
25 Ga0075364_10023660 3300006051 Bacteria 3891
26 Ga0075364_10062020 3300006051 Bacteria 2453
27 Ga0075364_10116038 3300006051 Bacteria 1790
28 Ga0075364_10132302 3300006051 Bacteria 1675
29 Ga0075432_10050636 3300006058 Bacteria 1465
30 Ga0075366_10007107 3300006195 Bacteria 6163
31 Ga0079104_1000078 3300006946 Bacteria 141909
32 Ga0079104_1000130 3300006946 Bacteria 107410
33 Ga0079104_1000398 3300006946 Bacteria 50358
34 Ga0079104_1001042 3300006946 Bacteria 21182
35 Ga0079104_1001111 3300006946 Bacteria 19867
36 Ga0079104_1001578 3300006946 Bacteria 14902
37 Ga0079104_1005438 3300006946 Bacteria 5089
38 Ga0079104_1008063 3300006946 Bacteria 3736
39 Ga0079104_1064825 3300006946 Bacteria 778
40 Ga0105251_10000488 3300009011 Bacteria 37538
41 Ga0105251_10000577 3300009011 Bacteria 34051
42 Ga0105251_10001520 3300009011 Bacteria 19928
43 Ga0105251_10002334 3300009011 Bacteria 15021
44 Ga0105251_10006626 3300009011 Bacteria 7332
45 Ga0105251_10015923 3300009011 Bacteria 4088
46 Ga0105251_10018170 3300009011 Bacteria 3746
47 Ga0105251_10065927 3300009011 Bacteria 1694
48 Ga0105251_10268108 3300009011 Bacteria 771
49 Ga0105244_10000021 3300009036 Bacteria 238820
50 Ga0105244_10000557 3300009036 Bacteria 33275
51 Ga0105244_10002351 3300009036 Bacteria 14360
52 Ga0105244_10007187 3300009036 Bacteria 7103
53 Ga0105244_10008284 3300009036 Bacteria 6506
54 Ga0105244_10009009 3300009036 Bacteria 6175
55 Ga0105244_10029318 3300009036 Bacteria 2943
56 Ga0105244_10050116 3300009036 Bacteria 2130
57 Ga0105244_10349879 3300009036 Bacteria 681
58 Ga0105244_10383305 3300009036 Bacteria 647
59 Ga0105250_10000012 3300009092 Bacteria 274899
60 Ga0105250_10000447 3300009092 Bacteria 29734
61 Ga0105250_10001721 3300009092 Bacteria 11547
62 Ga0105250_10004136 3300009092 Bacteria 6731
63 Ga0105250_10007179 3300009092 Bacteria 4804
64 Ga0105250_10014163 3300009092 Bacteria 3281
65 Ga0105250_10033687 3300009092 Bacteria 2057
66 Ga0105250_10095938 3300009092 Bacteria 1209
67 Ga0105240_10125683 3300009093 Bacteria 3082
68 Ga0105247_10007925 3300009101 Bacteria 6495
69 Ga0105243_10000918 3300009148 Bacteria 27604
70 Ga0105241_10003272 3300009174 Bacteria 12056
71 Ga0105248_12403309 3300009177 Bacteria 600
72 Ga0105246_10010672 3300011119 Bacteria 5690
73 Ga0105246_10018281 3300011119 Bacteria 4467
74 Ga0105246_10031554 3300011119 Bacteria 3507
75 Ga0105246_10435084 3300011119 Bacteria 1098
76 Ga0105246_10822425 3300011119 Bacteria 826
77 Ga0105246_11365263 3300011119 Bacteria 660
78 Ga0157373_10001491 3300013100 Bacteria 17843
79 Ga0157373_10002210 3300013100 Bacteria 14730
80 Ga0157373_10024352 3300013100 Bacteria 4386
81 Ga0157373_10116069 3300013100 Bacteria 1881
82 Ga0157373_10818072 3300013100 Bacteria 688
83 Ga0157371_10001070 3300013102 Bacteria 29890
84 Ga0157371_10002622 3300013102 Bacteria 17077
85 Ga0157371_10011013 3300013102 Bacteria 7006
86 Ga0157371_10722873 3300013102 Bacteria 746
87 Ga0157370_10000655 3300013104 Bacteria 43089
88 Ga0157370_10002081 3300013104 Bacteria 24497
89 Ga0157370_10003828 3300013104 Bacteria 17545
90 Ga0157370_10059164 3300013104 Bacteria 3642
91 Ga0157369_10003215 3300013105 Bacteria 19480
92 Ga0157369_10240316 3300013105 Bacteria 1892
93 Ga0163162_10468540 3300013306 Bacteria 1391
94 Ga0157372_10022878 3300013307 Bacteria 6768
95 Ga0157372_10028381 3300013307 Bacteria 6105
96 Ga0157372_10759942 3300013307 Bacteria 1127
97 Ga0182008_10028714 3300014497 Bacteria 2813
98 Ga0182006_1057296 3300015261 Bacteria 1482
99 Ga0182006_1068208 3300015261 Bacteria 1325
100 Ga0182007_10064273 3300015262 Bacteria 1203
101 Ga0163161_10000107 3300017792 Bacteria 78998
102 Ga0213876_10000660 3300021384 Bacteria 24722
103 Ga0209437_100035 3300025233 Bacteria 481110
104 Ga0207656_10039198 3300025321 Bacteria 2002
105 Ga0207696_1000033 3300025711 Bacteria 360689
106 Ga0207696_1000040 3300025711 Bacteria 318695
107 Ga0207696_1000070 3300025711 Bacteria 227242
108 Ga0207696_1000553 3300025711 Bacteria 29996
109 Ga0207696_1000558 3300025711 Bacteria 29569
110 Ga0207696_1004926 3300025711 Bacteria 5649
111 Ga0207696_1005691 3300025711 Bacteria 5138
112 Ga0207696_1097750 3300025711 Bacteria 801
113 Ga0207655_1000040 3300025728 Bacteria 335311
114 Ga0207655_1000043 3300025728 Bacteria 332919
115 Ga0207655_1000082 3300025728 Bacteria 213760
116 Ga0207655_1002569 3300025728 Bacteria 14522
117 Ga0207655_1005534 3300025728 Bacteria 8569
118 Ga0207655_1007439 3300025728 Bacteria 7102
119 Ga0207655_1017262 3300025728 Bacteria 3900
120 Ga0207655_1022937 3300025728 Bacteria 3110
121 Ga0207655_1066610 3300025728 Bacteria 1360
122 Ga0207655_1121086 3300025728 Bacteria 867
123 Ga0207713_1000001 3300025735 Bacteria 2295391
124 Ga0207713_1000017 3300025735 Bacteria 394495
125 Ga0207713_1000065 3300025735 Bacteria 196128
126 Ga0207713_1001357 3300025735 Bacteria 19946
127 Ga0207713_1010040 3300025735 Bacteria 5277
128 Ga0207713_1010243 3300025735 Bacteria 5204
129 Ga0207713_1055572 3300025735 Bacteria 1544
130 Ga0207713_1102610 3300025735 Bacteria 985
131 Ga0207710_10000016 3300025900 Bacteria 388568
132 Ga0207654_10000006 3300025911 Bacteria 815027
133 Ga0207695_10300076 3300025913 Bacteria 1498
134 Ga0207671_10303489 3300025914 Bacteria 1261
135 Ga0207690_10080449 3300025932 Bacteria 2274
136 Ga0207706_10087585 3300025933 Bacteria 2738
137 Ga0207709_10000505 3300025935 Bacteria 34640
138 Ga0207709_10010222 3300025935 Bacteria 5168
139 Ga0207679_11026688 3300025945 Bacteria 756
140 Ga0207668_10776862 3300025972 Bacteria 846
141 Ga0207674_10000018 3300026116 Bacteria 167809
142 Ga0209281_1000008 3300027111 Bacteria 867470
143 Ga0209281_1000031 3300027111 Bacteria 422772
144 Ga0209281_1000112 3300027111 Bacteria 213847
145 Ga0209281_1000162 3300027111 Bacteria 159535
146 Ga0209281_1000248 3300027111 Bacteria 107418
147 Ga0209281_1000618 3300027111 Bacteria 39906
148 Ga0209281_1000832 3300027111 Bacteria 27672
149 Ga0209281_1000833 3300027111 Bacteria 27672
150 Ga0209281_1003472 3300027111 Bacteria 5188
151 Ga0209281_1014421 3300027111 Bacteria 1673
152 Ga0209371_1000027 3300027312 Bacteria 448853
153 Ga0209371_1000092 3300027312 Bacteria 171648
154 Ga0209371_1000167 3300027312 Bacteria 98922
155 Ga0209371_1000266 3300027312 Bacteria 61272
156 Ga0209371_1001638 3300027312 Bacteria 14415
157 Ga0209371_1001900 3300027312 Bacteria 12799
158 Ga0209371_1010496 3300027312 Bacteria 2841
159 Ga0209371_1011213 3300027312 Bacteria 2677
160 Ga0207428_10298100 3300027907 Bacteria 1193
161 Ga0268266_10000079 3300028379 Bacteria 213545
162 Ga0268266_10036528 3300028379 Bacteria 4183
163 Ga0268266_11093257 3300028379 Bacteria 771
164 Ga0268256_1000045 3300030500 Bacteria 330053
165 Ga0268256_1000082 3300030500 Bacteria 171648
166 Ga0268256_1000124 3300030500 Bacteria 111181
167 Ga0268256_1000269 3300030500 Bacteria 54055
168 Ga0268256_1001428 3300030500 Bacteria 14415
169 Ga0268256_1011271 3300030500 Bacteria 2841
170 Ga0268256_1011854 3300030500 Bacteria 2728
171 Ga0268256_1012165 3300030500 Bacteria 2677
172 Ga0316183_1161623 3300030742 Bacteria 537
173 Ga0436365_0743852 3300039437 Bacteria 24807
174 Ga0439438_000001 3300041405 Bacteria 1263568
175 Ga0439438_082409 3300041405 Bacteria 788
176 Ga0439447_002853 3300041407 Bacteria 6203
177 Ga0439447_007585 3300041407 Bacteria 3425
178 Ga0439466_0000003 3300041411 Bacteria 486229
179 Ga0451853_1718086 3300041512 Bacteria 3935
180 Ga0439432_003432 3300042006 Bacteria 5881
181 Ga0439432_004393 3300042006 Bacteria 5152
182 Ga0439432_006186 3300042006 Bacteria 4287
183 Ga0439432_019518 3300042006 Bacteria 2257
184 Ga0439432_147925 3300042006 Bacteria 689
185 Ga0439449_0036852 3300042007 Bacteria 1819
186 Ga0439452_000039 3300042010 Bacteria 145243
187 Ga0439452_000212 3300042010 Bacteria 41258
188 Ga0439463_004550 3300042016 Bacteria 3477
189 Ga0450902_022393 3300042137 Bacteria 1046
190 Ga0450907_000266 3300042146 Bacteria 17670
191 Ga0439464_0000799 3300042439 Bacteria 6902
192 Ga0439464_0003423 3300042439 Bacteria 3999
193 Ga0495627_000194 3300046453 Bacteria 66597
194 Ga0495627_006693 3300046453 Bacteria 4488
195 Ga0495591_000014 3300046458 Bacteria 254281
196 Ga0495591_000029 3300046458 Bacteria 179657
197 Ga0495591_000717 3300046458 Bacteria 24075
198 Ga0495591_003259 3300046458 Bacteria 8520
199 Ga0495591_006096 3300046458 Bacteria 5412
200 Ga0495638_0001551 3300046460 Bacteria 20607
201 Ga0495650_0000032 3300046471 Bacteria 425389
202 Ga0495650_0000103 3300046471 Bacteria 210023
203 Ga0495650_0001865 3300046471 Bacteria 18852
204 Ga0495650_0082473 3300046471 Bacteria 1237
205 Ga0495605_0019868 3300046474 Bacteria 3577
206 Ga0495584_0020196 3300046491 Bacteria 3385
207 Ga0495585_0005689 3300046492 Bacteria 7825
208 Ga0495596_0000920 3300046500 Bacteria 17531
209 Ga0495596_0254255 3300046500 Bacteria 682
210 Ga0495607_0004099 3300046501 Bacteria 10890
211 Ga0495606_0000843 3300046507 Bacteria 46153
212 Ga0495616_0008994 3300046513 Bacteria 5865
213 Ga0495616_0121602 3300046513 Bacteria 1204
214 Ga0495620_0001496 3300046515 Bacteria 13914
215 Ga0495632_0139674 3300046519 Bacteria 1124
216 Ga0495637_0036019 3300046520 Bacteria 2159
217 Ga0495637_0089415 3300046520 Bacteria 1217
218 Ga0495637_0213747 3300046520 Bacteria 704
219 Ga0495643_0008127 3300046522 Bacteria 6680
220 Ga0495643_0168453 3300046522 Bacteria 1073
221 Ga0495644_0007653 3300046523 Bacteria 4166
222 Ga0495648_0000299 3300046524 Bacteria 55022
223 Ga0495648_0011517 3300046524 Bacteria 6651
224 Ga0495654_0000019 3300046530 Bacteria 289483
225 Ga0495654_0001254 3300046530 Bacteria 17873
226 Ga0495654_0002110 3300046530 Bacteria 13007
227 Ga0495654_0014054 3300046530 Bacteria 4269
228 Ga0495654_0021518 3300046530 Bacteria 3354
229 Ga0495654_0052196 3300046530 Bacteria 1992
230 Ga0495597_0001032 3300046542 Bacteria 21268
231 Ga0495668_0011801 3300046616 Bacteria 5210
232 Ga0495625_0019921 3300046660 Bacteria 5190
233 Ga0495588_0001199 3300046674 Bacteria 11185
234 Ga0495671_0008738 3300046692 Bacteria 5688
235 Ga0495671_0011386 3300046692 Bacteria 4897
236 Ga0495649_0000510 3300046694 Bacteria 33248
237 Ga0495649_0000847 3300046694 Bacteria 24572
238 Ga0495649_0029299 3300046694 Bacteria 3046
239 Ga0495589_0000006 3300046794 Bacteria 303635
240 Ga0495660_0000021 3300046810 Bacteria 293250
241 Ga0495660_0027170 3300046810 Bacteria 3238
242 Ga0495672_0000002 3300047320 Bacteria 740116
243 Ga0495672_0000012 3300047320 Bacteria 519975
244 Ga0495672_0000020 3300047320 Bacteria 432845
245 Ga0495672_0095023 3300047320 Bacteria 1628
246 Ga0495683_0006345 3300047323 Bacteria 6462
247 Ga0495683_0015636 3300047323 Bacteria 3944
248 Ga0495679_000020 3300047446 Bacteria 228413
249 Ga0495679_000494 3300047446 Bacteria 28041
250 Ga0495679_002582 3300047446 Bacteria 9128
251 Ga0495679_009387 3300047446 Bacteria 3919
252 Ga0495673_0000079 3300047469 Bacteria 202569
253 Ga0495673_0008992 3300047469 Bacteria 5559
254 Ga0495673_0150605 3300047469 Bacteria 899
255 Ga0496100_0007123 3300048903 Bacteria 6143
256 Ga0496100_0176105 3300048903 Bacteria 1544
257 Ga0496100_0191087 3300048903 Bacteria 1486
258 Ga0496101_0000671 3300048904 Bacteria 20633
259 Ga0496101_0124217 3300048904 Bacteria 1954
260 Ga0496101_0659923 3300048904 Bacteria 826
261 Ga0496101_0801719 3300048904 Bacteria 743
262 Ga0496102_0001584 3300048905 Bacteria 20074
263 Ga0496103_0029193 3300048906 Bacteria 3351
264 Ga0496103_0074950 3300048906 Bacteria 2121
265 Ga0496104_0000119 3300048907 Bacteria 74104
266 Ga0496105_0008091 3300048908 Bacteria 8175
267 Ga0496106_0043063 3300048909 Bacteria 3387
268 Ga0496111_0834581 3300048914 Bacteria 666
269 Ga0496113_0084501 3300048916 Bacteria 2437
270 Ga0496113_0462623 3300048916 Bacteria 1019
271 Ga0496116_0000031 3300048919 Bacteria 420043
272 Ga0496116_0000623 3300048919 Bacteria 46579
273 Ga0496116_0005510 3300048919 Bacteria 11700
274 Ga0496116_0016308 3300048919 Bacteria 5817
275 Ga0496116_0292631 3300048919 Bacteria 780
276 Ga0496117_0000004 3300048920 Bacteria 877131
277 Ga0496117_0000298 3300048920 Bacteria 87318
278 Ga0496117_0000486 3300048920 Bacteria 65652
279 Ga0496117_0001035 3300048920 Bacteria 42455
280 Ga0496117_0001085 3300048920 Bacteria 41180
281 Ga0496117_0003937 3300048920 Bacteria 16804
282 Ga0496117_0008440 3300048920 Bacteria 9778
283 Ga0496117_0011518 3300048920 Bacteria 7916
284 Ga0496117_0014154 3300048920 Bacteria 6895
285 Ga0496117_0025938 3300048920 Bacteria 4595
286 Ga0496117_0042194 3300048920 Bacteria 3332
287 Ga0496117_0099151 3300048920 Bacteria 1849
288 Ga0496118_0000072 3300048921 Bacteria 201387
289 Ga0496118_0000323 3300048921 Bacteria 82847
290 Ga0496118_0001319 3300048921 Bacteria 37658
291 Ga0496118_0002434 3300048921 Bacteria 25050
292 Ga0496118_0003732 3300048921 Bacteria 18850
293 Ga0496118_0012145 3300048921 Bacteria 8310
294 Ga0496118_0053810 3300048921 Bacteria 3054
295 Ga0496118_0065037 3300048921 Bacteria 2671
296 Ga0496118_0081097 3300048921 Bacteria 2279
297 Ga0496118_0117549 3300048921 Bacteria 1744
298 Ga0496118_0155643 3300048921 Bacteria 1422
299 Ga0496118_0640210 3300048921 Bacteria 502
300 Ga0496119_0000188 3300048922 Bacteria 87312
301 Ga0496119_0000741 3300048922 Bacteria 43950
302 Ga0496119_0001629 3300048922 Bacteria 26500
303 Ga0496119_0001826 3300048922 Bacteria 24657
304 Ga0496119_0002279 3300048922 Bacteria 21256
305 Ga0496119_0009914 3300048922 Bacteria 8087
306 Ga0496119_0029534 3300048922 Bacteria 3715
307 Ga0496119_0034606 3300048922 Bacteria 3322
308 Ga0496119_0037927 3300048922 Bacteria 3121
309 Ga0496119_0172840 3300048922 Bacteria 1139
310 Ga0496119_0515228 3300048922 Bacteria 554
311 Ga0496120_0000062 3300048923 Bacteria 172365
312 Ga0496120_0000252 3300048923 Bacteria 89838
313 Ga0496120_0000302 3300048923 Bacteria 82387
314 Ga0496120_0000389 3300048923 Bacteria 70922
315 Ga0496120_0001166 3300048923 Bacteria 33619
316 Ga0496120_0001877 3300048923 Bacteria 23391
317 Ga0496120_0001913 3300048923 Bacteria 22983
318 Ga0496120_0002608 3300048923 Bacteria 17868
319 Ga0496120_0100000 3300048923 Bacteria 1534
320 Ga0496121_0000047 3300048924 Bacteria 335768
321 Ga0496121_0001155 3300048924 Bacteria 46296
322 Ga0496121_0001222 3300048924 Bacteria 44730
323 Ga0496121_0003763 3300048924 Bacteria 21231
324 Ga0496121_0008113 3300048924 Bacteria 12488
325 Ga0496121_0014431 3300048924 Bacteria 8383
326 Ga0496121_0020348 3300048924 Bacteria 6576
327 Ga0496121_0145976 3300048924 Bacteria 1748
328 Ga0496122_0000108 3300048925 Bacteria 191029
329 Ga0496122_0001367 3300048925 Bacteria 39674
330 Ga0496122_0002008 3300048925 Bacteria 30259
331 Ga0496122_0005674 3300048925 Bacteria 14730
332 Ga0496122_0017495 3300048925 Bacteria 6699
333 Ga0496122_0025647 3300048925 Bacteria 5111
334 Ga0496122_0068917 3300048925 Bacteria 2536
335 Ga0496122_0091267 3300048925 Bacteria 2074
336 Ga0496122_0362037 3300048925 Bacteria 752
337 Ga0496123_0000065 3300048926 Bacteria 211758
338 Ga0496123_0000508 3300048926 Bacteria 67759
339 Ga0496123_0000605 3300048926 Bacteria 60923
340 Ga0496123_0006055 3300048926 Bacteria 11877
341 Ga0496123_0017936 3300048926 Bacteria 5666
342 Ga0496123_0023673 3300048926 Bacteria 4693
343 Ga0496123_0049665 3300048926 Bacteria 2809
344 Ga0496123_0122292 3300048926 Bacteria 1461
345 Ga0496124_0000053 3300048927 Bacteria 252285
346 Ga0496124_0000147 3300048927 Bacteria 145724
347 Ga0496124_0001108 3300048927 Bacteria 42354
348 Ga0496124_0001901 3300048927 Bacteria 28695
349 Ga0496124_0003341 3300048927 Bacteria 19748
350 Ga0496124_0006836 3300048927 Bacteria 12293
351 Ga0496124_0006859 3300048927 Bacteria 12264
352 Ga0496124_0007018 3300048927 Bacteria 12070
353 Ga0496124_0021902 3300048927 Bacteria 5878
354 Ga0496124_0038385 3300048927 Bacteria 4159
355 Ga0496124_0075106 3300048927 Bacteria 2792
356 Ga0496124_0256871 3300048927 Bacteria 1288
357 Ga0496124_0498723 3300048927 Bacteria 817
358 Ga0496125_0005436 3300048928 Bacteria 14165
359 Ga0496125_0036930 3300048928 Bacteria 4255
360 Ga0496125_0043092 3300048928 Bacteria 3836
361 Ga0496125_0055714 3300048928 Bacteria 3218
362 Ga0496125_0362083 3300048928 Bacteria 862
363 Ga0496126_0000387 3300048929 Bacteria 91081
364 Ga0496126_0000759 3300048929 Bacteria 58398
365 Ga0496126_0019693 3300048929 Bacteria 6640
366 Ga0496126_0042149 3300048929 Bacteria 4217
367 Ga0496126_0107702 3300048929 Bacteria 2430
368 Ga0496126_0145758 3300048929 Bacteria 2033
369 Ga0496126_0337822 3300048929 Bacteria 1234
370 Ga0496126_0625931 3300048929 Bacteria 845
371 Ga0496126_0649525 3300048929 Bacteria 825
372 Ga0496126_1392704 3300048929 Bacteria 506
373 Ga0495678_000326 3300049459 Bacteria 50497
374 Ga0495678_182525 3300049459 Bacteria 657
375 Ga0495682_0000015 3300049460 Bacteria 235048
376 nmdc:mga00v17_4369_c1 3300050491 Bacteria 7344
377 nmdc:mga00v17_522540_c1 3300050491 Bacteria 769
378 nmdc:mga00v17_6716_c1 3300050491 Bacteria 6114
379 nmdc:mga00v17_74120_c1 3300050491 Bacteria 2114
380 nmdc:mga0k408_7167_c1 3300050493 Bacteria 5957
381 Ga0500621_000001 3300053126 Bacteria 1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0095023 Ga0495672_0095023_1301_1600 99
2 3300048904 Ga0496101_0659923 Ga0496101_0659923_25_372 102
3 3300048929 Ga0496126_0042149 Ga0496126_0042149_2609_2956 102
4 3300011119 Ga0105246_10010672 Ga0105246_100106726 106
5 iso_pu_bacteria 2506520007 2506576862 109
6 iso_pu_bacteria 2506520008 2506582000 109
7 iso_pu_bacteria 2508501071 2508850829 109
8 iso_pu_bacteria 2654587920 2656279234 109
9 iso_pu_bacteria 2687453601 2689443261 109
10 iso_pu_bacteria 2869551831 2869552667 109
11 iso_pu_bacteria 2888373701 2888374859 109
12 iso_pu_bacteria 2904504865 2904506848 109
13 iso_pu_bacteria 640753048 640936414 109
14 iso_pu_bacteria 2511231025 2511378570 111
15 iso_pu_bacteria 2511231035 2511434073 111
16 iso_pu_bacteria 2608642108 2608668985 111
17 iso_pu_bacteria 2844528606 2844530446 111
18 iso_pu_bacteria 2865014394 2865015612 111
19 iso_pu_bacteria 2876601092 2876602024 111
20 iso_pu_bacteria 2881609920 2881612350 111
21 iso_pu_bacteria 2939602548 2939602572 111
22 iso_pu_bacteria 2945951305 2945953506 111
23 iso_pu_bacteria 2978975091 2978975998 111
24 iso_pu_bacteria 8016733728 8016736402 111
25 iso_pu_bacteria 8019499862 8019503073 111
26 iso_pu_bacteria 2891670763 2891672615 112
27 iso_pu_bacteria 8054844752 8054846299 112
28 iso_pu_bacteria 8054849141 8054850407 112
29 3300005272 Ga0065703_1018816 Ga0065703_10188168 113
30 3300005289 Ga0065704_10138013 Ga0065704_101380132 113
31 3300006946 Ga0079104_1001578 Ga0079104_10015787 113
32 3300006946 Ga0079104_1008063 Ga0079104_10080632 113
33 3300009011 Ga0105251_10001520 Ga0105251_1000152015 113
34 3300009011 Ga0105251_10015923 Ga0105251_100159233 113
35 3300009036 Ga0105244_10000557 Ga0105244_1000055729 113
36 3300009092 Ga0105250_10000447 Ga0105250_1000044725 113
37 3300009092 Ga0105250_10014163 Ga0105250_100141635 113
38 3300009101 Ga0105247_10007925 Ga0105247_100079252 113
39 3300009174 Ga0105241_10003272 Ga0105241_100032727 113
40 3300013100 Ga0157373_10002210 Ga0157373_1000221014 113
41 3300013104 Ga0157370_10002081 Ga0157370_100020819 113
42 3300017792 Ga0163161_10000107 Ga0163161_1000010774 113
43 3300025711 Ga0207696_1000033 Ga0207696_1000033356 113
44 3300025711 Ga0207696_1000553 Ga0207696_10005538 113
45 3300025728 Ga0207655_1000040 Ga0207655_100004010 113
46 3300025735 Ga0207713_1000065 Ga0207713_100006510 113
47 3300025735 Ga0207713_1001357 Ga0207713_100135711 113
48 3300025900 Ga0207710_10000016 Ga0207710_1000001610 113
49 3300025911 Ga0207654_10000006 Ga0207654_1000000610 113
50 3300027111 Ga0209281_1000008 Ga0209281_1000008861 113
51 3300027111 Ga0209281_1014421 Ga0209281_10144212 113
52 3300042006 Ga0439432_004393 Ga0439432_004393_2487_2831 113
53 3300046453 Ga0495627_000194 Ga0495627_000194_61119_61463 113
54 3300046519 Ga0495632_0139674 Ga0495632_0139674_284_625 113
55 3300046520 Ga0495637_0213747 Ga0495637_0213747_295_639 113
56 3300046530 Ga0495654_0001254 Ga0495654_0001254_12568_12912 113
57 3300046530 Ga0495654_0052196 Ga0495654_0052196_1380_1724 113
58 3300046794 Ga0495589_0000006 Ga0495589_0000006_4965_5309 113
59 3300048906 Ga0496103_0074950 Ga0496103_0074950_1305_1649 113
60 3300048919 Ga0496116_0000031 Ga0496116_0000031_5098_5442 113
61 3300048920 Ga0496117_0025938 Ga0496117_0025938_1208_1552 113
62 3300048921 Ga0496118_0155643 Ga0496118_0155643_870_1214 113
63 3300048922 Ga0496119_0034606 Ga0496119_0034606_1446_1790 113
64 iso_pu_bacteria 2537561728 2538428552 113
65 iso_pu_bacteria 2547132416 2548648140 113
66 iso_pu_bacteria 2599185299 2599928036 113
67 iso_pu_bacteria 2600255256 2601534634 113
68 iso_pu_bacteria 2600255257 2601539219 113
69 iso_pu_bacteria 2600255310 2601757568 113
70 iso_pu_bacteria 2600255311 2601763927 113
71 iso_pu_bacteria 2602042046 2603640274 113
72 iso_pu_bacteria 2602042047 2603645956 113
73 iso_pu_bacteria 2602042067 2603706449 113
74 iso_pu_bacteria 2648501693 2650896942 113
75 iso_pu_bacteria 2667528172 2671105330 113
76 iso_pu_bacteria 2671180115 2671586458 113
77 iso_pu_bacteria 2681812866 2681998876 113
78 iso_pu_bacteria 2681812869 2682009707 113
79 iso_pu_bacteria 2711768156 2712472085 113
80 iso_pu_bacteria 2751185917 2753857955 113
81 iso_pu_bacteria 2765235842 2765591121 113
82 iso_pu_bacteria 2775506706 2775542808 113
83 iso_pu_bacteria 2791354903 2791922856 113
84 iso_pu_bacteria 2808606414 2809124172 113
85 iso_pu_bacteria 2811995292 2813726519 113
86 iso_pu_bacteria 2814123068 2814693893 113
87 iso_pu_bacteria 2821118458 2821122426 113
88 iso_pu_bacteria 2823373977 2823378115 113
89 iso_pu_bacteria 2847797336 2847801391 113
90 iso_pu_bacteria 2855195626 2855199480 113
91 iso_pu_bacteria 2871272651 2871274672 113
92 iso_pu_bacteria 2871282230 2871284330 113
93 iso_pu_bacteria 2884086401 2884089533 113
94 iso_pu_bacteria 2888366609 2888371077 113
95 iso_pu_bacteria 2900051742 2900054858 113
96 iso_pu_bacteria 2927833300 2927836575 113
97 iso_pu_bacteria 2937539931 2937540146 113
98 iso_pu_bacteria 2939568625 2939572165 113
99 iso_pu_bacteria 2939607340 2939611499 113
100 iso_pu_bacteria 2939642701 2939646477 113
101 iso_pu_bacteria 2945874760 2945876193 113
102 iso_pu_bacteria 2974310843 2974314647 113
103 iso_pu_bacteria 2984494565 2984498224 113
104 iso_pu_bacteria 2990261002 2990265525 113
105 iso_pu_bacteria 8018405270 8018408864 113
106 iso_pu_bacteria 8055087960 8055092389 113
107 iso_pu_bacteria 8055092621 8055093586 113
108 iso_pu_bacteria 8055097453 8055097683 113
109 iso_pu_bacteria 8057304971 8057307978 113
110 3300002737 JGI25162J39368_1009243 JGI25162J39368_10092432 115
111 3300003856 Ga0058692_1000241 Ga0058692_100024116 115
112 3300003856 Ga0058692_1018456 Ga0058692_10184562 115
113 3300003856 Ga0058692_1066679 Ga0058692_10666791 115
114 3300005347 Ga0070668_100070880 Ga0070668_1000708802 115
115 3300005457 Ga0070662_100062183 Ga0070662_1000621834 115
116 3300005548 Ga0070665_100323745 Ga0070665_1003237452 115
117 3300006051 Ga0075364_10116038 Ga0075364_101160382 115
118 3300006051 Ga0075364_10132302 Ga0075364_101323021 115
119 3300009011 Ga0105251_10000488 Ga0105251_1000048830 115
120 3300009011 Ga0105251_10018170 Ga0105251_100181702 115
121 3300009011 Ga0105251_10065927 Ga0105251_100659272 115
122 3300009036 Ga0105244_10050116 Ga0105244_100501162 115
123 3300009036 Ga0105244_10349879 Ga0105244_103498792 115
124 3300009036 Ga0105244_10383305 Ga0105244_103833052 115
125 3300009092 Ga0105250_10004136 Ga0105250_100041368 115
126 3300009092 Ga0105250_10007179 Ga0105250_100071795 115
127 3300009177 Ga0105248_12403309 Ga0105248_124033092 115
128 3300011119 Ga0105246_10031554 Ga0105246_100315543 115
129 3300011119 Ga0105246_10435084 Ga0105246_104350842 115
130 3300011119 Ga0105246_11365263 Ga0105246_113652632 115
131 3300013100 Ga0157373_10001491 Ga0157373_100014917 115
132 3300013100 Ga0157373_10818072 Ga0157373_108180722 115
133 3300013102 Ga0157371_10001070 Ga0157371_1000107030 115
134 3300013102 Ga0157371_10002622 Ga0157371_1000262213 115
135 3300013105 Ga0157369_10003215 Ga0157369_1000321510 115
136 3300013105 Ga0157369_10240316 Ga0157369_102403162 115
137 3300013306 Ga0163162_10468540 Ga0163162_104685402 115
138 3300013307 Ga0157372_10022878 Ga0157372_100228785 115
139 3300013307 Ga0157372_10028381 Ga0157372_100283812 115
140 3300013307 Ga0157372_10759942 Ga0157372_107599422 115
141 3300014497 Ga0182008_10028714 Ga0182008_100287142 115
142 3300015261 Ga0182006_1068208 Ga0182006_10682082 115
143 3300015262 Ga0182007_10064273 Ga0182007_100642732 115
144 3300025233 Ga0209437_100035 Ga0209437_100035316 115
145 3300025711 Ga0207696_1000070 Ga0207696_1000070125 115
146 3300025728 Ga0207655_1002569 Ga0207655_10025695 115
147 3300025728 Ga0207655_1005534 Ga0207655_100553411 115
148 3300025728 Ga0207655_1022937 Ga0207655_10229372 115
149 3300025735 Ga0207713_1000001 Ga0207713_1000001615 115
150 3300025735 Ga0207713_1102610 Ga0207713_11026102 115
151 3300025933 Ga0207706_10087585 Ga0207706_100875852 115
152 3300025972 Ga0207668_10776862 Ga0207668_107768622 115
153 3300027312 Ga0209371_1000167 Ga0209371_100016760 115
154 3300027312 Ga0209371_1001638 Ga0209371_100163810 115
155 3300027312 Ga0209371_1001900 Ga0209371_10019007 115
156 3300028379 Ga0268266_10036528 Ga0268266_100365282 115
157 3300030500 Ga0268256_1000124 Ga0268256_100012454 115
158 3300030500 Ga0268256_1001428 Ga0268256_10014288 115
159 3300030500 Ga0268256_1011854 Ga0268256_10118542 115
160 3300030742 Ga0316183_1161623 Ga0316183_11616232 115
161 3300041405 Ga0439438_000001 Ga0439438_000001_402819_403166 115
162 3300041405 Ga0439438_082409 Ga0439438_082409_221_568 115
163 3300041407 Ga0439447_002853 Ga0439447_002853_953_1300 115
164 3300041407 Ga0439447_007585 Ga0439447_007585_1117_1464 115
165 3300041411 Ga0439466_0000003 Ga0439466_0000003_88261_88608 115
166 3300042006 Ga0439432_006186 Ga0439432_006186_886_1233 115
167 3300042006 Ga0439432_147925 Ga0439432_147925_208_555 115
168 3300042007 Ga0439449_0036852 Ga0439449_0036852_854_1201 115
169 3300042016 Ga0439463_004550 Ga0439463_004550_2068_2415 115
170 3300042146 Ga0450907_000266 Ga0450907_000266_5896_6243 115
171 3300042439 Ga0439464_0003423 Ga0439464_0003423_2122_2469 115
172 3300046458 Ga0495591_000014 Ga0495591_000014_170314_170661 115
173 3300046458 Ga0495591_003259 Ga0495591_003259_5102_5449 115
174 3300046458 Ga0495591_006096 Ga0495591_006096_338_685 115
175 3300046471 Ga0495650_0000032 Ga0495650_0000032_220151_220498 115
176 3300046474 Ga0495605_0019868 Ga0495605_0019868_1331_1678 115
177 3300046491 Ga0495584_0020196 Ga0495584_0020196_2899_3246 115
178 3300046492 Ga0495585_0005689 Ga0495585_0005689_6628_6975 115
179 3300046500 Ga0495596_0000920 Ga0495596_0000920_10460_10807 115
180 3300046500 Ga0495596_0254255 Ga0495596_0254255_273_620 115
181 3300046501 Ga0495607_0004099 Ga0495607_0004099_5497_5844 115
182 3300046507 Ga0495606_0000843 Ga0495606_0000843_26275_26622 115
183 3300046513 Ga0495616_0008994 Ga0495616_0008994_311_658 115
184 3300046520 Ga0495637_0089415 Ga0495637_0089415_484_831 115
185 3300046522 Ga0495643_0008127 Ga0495643_0008127_2562_2909 115
186 3300046523 Ga0495644_0007653 Ga0495644_0007653_295_642 115
187 3300046524 Ga0495648_0000299 Ga0495648_0000299_47522_47869 115
188 3300046524 Ga0495648_0011517 Ga0495648_0011517_1467_1814 115
189 3300046530 Ga0495654_0000019 Ga0495654_0000019_241971_242318 115
190 3300046530 Ga0495654_0002110 Ga0495654_0002110_12044_12391 115
191 3300046616 Ga0495668_0011801 Ga0495668_0011801_2307_2654 115
192 3300046692 Ga0495671_0008738 Ga0495671_0008738_2001_2348 115
193 3300046694 Ga0495649_0029299 Ga0495649_0029299_176_523 115
194 3300046810 Ga0495660_0000021 Ga0495660_0000021_70870_71217 115
195 3300046810 Ga0495660_0027170 Ga0495660_0027170_1223_1570 115
196 3300047320 Ga0495672_0000002 Ga0495672_0000002_183811_184158 115
197 3300047320 Ga0495672_0000012 Ga0495672_0000012_423612_423959 115
198 3300047323 Ga0495683_0006345 Ga0495683_0006345_4570_4917 115
199 3300047323 Ga0495683_0015636 Ga0495683_0015636_267_614 115
200 3300047446 Ga0495679_000494 Ga0495679_000494_15039_15386 115
201 3300047469 Ga0495673_0008992 Ga0495673_0008992_3335_3682 115
202 3300047469 Ga0495673_0150605 Ga0495673_0150605_70_417 115
203 3300048903 Ga0496100_0007123 Ga0496100_0007123_3432_3779 115
204 3300048903 Ga0496100_0176105 Ga0496100_0176105_880_1227 115
205 3300048904 Ga0496101_0000671 Ga0496101_0000671_9858_10205 115
206 3300048904 Ga0496101_0801719 Ga0496101_0801719_106_453 115
207 3300048905 Ga0496102_0001584 Ga0496102_0001584_1745_2092 115
208 3300048906 Ga0496103_0029193 Ga0496103_0029193_1951_2298 115
209 3300048908 Ga0496105_0008091 Ga0496105_0008091_6500_6847 115
210 3300048909 Ga0496106_0043063 Ga0496106_0043063_2252_2599 115
211 3300048914 Ga0496111_0834581 Ga0496111_0834581_121_468 115
212 3300048916 Ga0496113_0462623 Ga0496113_0462623_12_359 115
213 3300048919 Ga0496116_0016308 Ga0496116_0016308_884_1231 115
214 3300048919 Ga0496116_0292631 Ga0496116_0292631_392_739 115
215 3300048920 Ga0496117_0000004 Ga0496117_0000004_390225_390572 115
216 3300048920 Ga0496117_0000486 Ga0496117_0000486_37748_38095 115
217 3300048920 Ga0496117_0042194 Ga0496117_0042194_2197_2544 115
218 3300048921 Ga0496118_0000072 Ga0496118_0000072_63225_63572 115
219 3300048921 Ga0496118_0000323 Ga0496118_0000323_29635_29982 115
220 3300048921 Ga0496118_0065037 Ga0496118_0065037_962_1309 115
221 3300048922 Ga0496119_0000188 Ga0496119_0000188_55885_56232 115
222 3300048922 Ga0496119_0001826 Ga0496119_0001826_236_583 115
223 3300048922 Ga0496119_0029534 Ga0496119_0029534_2050_2397 115
224 3300048922 Ga0496119_0515228 Ga0496119_0515228_62_409 115
225 3300048923 Ga0496120_0000062 Ga0496120_0000062_140938_141285 115
226 3300048923 Ga0496120_0000252 Ga0496120_0000252_24013_24360 115
227 3300048923 Ga0496120_0000302 Ga0496120_0000302_15261_15608 115
228 3300048924 Ga0496121_0000047 Ga0496121_0000047_180047_180394 115
229 3300048925 Ga0496122_0001367 Ga0496122_0001367_37482_37829 115
230 3300048925 Ga0496122_0091267 Ga0496122_0091267_1051_1398 115
231 3300048926 Ga0496123_0000508 Ga0496123_0000508_53324_53671 115
232 3300048926 Ga0496123_0049665 Ga0496123_0049665_2071_2418 115
233 3300048927 Ga0496124_0001108 Ga0496124_0001108_3988_4335 115
234 3300048927 Ga0496124_0006836 Ga0496124_0006836_10636_10983 115
235 3300048927 Ga0496124_0021902 Ga0496124_0021902_4318_4665 115
236 3300048927 Ga0496124_0038385 Ga0496124_0038385_1156_1503 115
237 3300048927 Ga0496124_0075106 Ga0496124_0075106_508_855 115
238 3300048928 Ga0496125_0005436 Ga0496125_0005436_2382_2729 115
239 3300048929 Ga0496126_0337822 Ga0496126_0337822_221_568 115
240 3300048929 Ga0496126_0625931 Ga0496126_0625931_88_435 115
241 3300049459 Ga0495678_000326 Ga0495678_000326_38513_38860 115
242 3300049459 Ga0495678_182525 Ga0495678_182525_225_572 115
243 3300049460 Ga0495682_0000015 Ga0495682_0000015_54267_54614 115
244 3300050491 nmdc:mga00v17_6716_c1 nmdc:mga00v17_6716_c1_5035_5382 115
245 3300050491 nmdc:mga00v17_74120_c1 nmdc:mga00v17_74120_c1_1323_1670 115
246 3300053126 Ga0500621_000001 Ga0500621_000001_819424_819771 115
247 3300009011 Ga0105251_10002334 Ga0105251_1000233415 116
248 3300009036 Ga0105244_10002351 Ga0105244_100023515 116
249 3300009036 Ga0105244_10029318 Ga0105244_100293182 116
250 3300009092 Ga0105250_10033687 Ga0105250_100336872 116
251 3300025711 Ga0207696_1005691 Ga0207696_10056918 116
252 3300025728 Ga0207655_1066610 Ga0207655_10666102 116
253 3300046513 Ga0495616_0121602 Ga0495616_0121602_145_495 116
254 3300046520 Ga0495637_0036019 Ga0495637_0036019_377_727 116
255 3300046530 Ga0495654_0014054 Ga0495654_0014054_3162_3512 116
256 3300046530 Ga0495654_0021518 Ga0495654_0021518_417_767 116
257 3300046542 Ga0495597_0001032 Ga0495597_0001032_15345_15695 116
258 3300046660 Ga0495625_0019921 Ga0495625_0019921_1355_1705 116
259 3300046674 Ga0495588_0001199 Ga0495588_0001199_3852_4202 116
260 3300047320 Ga0495672_0000020 Ga0495672_0000020_12877_13227 116
261 3300047446 Ga0495679_000020 Ga0495679_000020_55807_56157 116
262 3300048928 Ga0496125_0362083 Ga0496125_0362083_348_698 116
263 2162886007 SwRhRL2b_contig_121856 SwRhRL2b_0014.00003560 117
264 2162886007 SwRhRL2b_contig_2498991 SwRhRL2b_0871.00002580 117
265 2162886007 SwRhRL2b_contig_714942 SwRhRL2b_0636.00005400 117
266 3300001989 JGI24739J22299_10001919 JGI24739J22299_100019192 117
267 3300003856 Ga0058692_1000467 Ga0058692_100046711 117
268 3300003856 Ga0058692_1000511 Ga0058692_100051116 117
269 3300003856 Ga0058692_1000526 Ga0058692_100052610 117
270 3300003856 Ga0058692_1032548 Ga0058692_10325482 117
271 3300005289 Ga0065704_10085195 Ga0065704_100851952 117
272 3300005366 Ga0070659_100009800 Ga0070659_1000098006 117
273 3300005548 Ga0070665_100000117 Ga0070665_10000011766 117
274 3300005548 Ga0070665_100015389 Ga0070665_1000153899 117
275 3300005564 Ga0070664_101132654 Ga0070664_1011326542 117
276 3300005577 Ga0068857_100000006 Ga0068857_10000000693 117
277 3300005834 Ga0068851_10001763 Ga0068851_1000176311 117
278 3300006051 Ga0075364_10023660 Ga0075364_100236603 117
279 3300006051 Ga0075364_10062020 Ga0075364_100620203 117
280 3300006058 Ga0075432_10050636 Ga0075432_100506361 117
281 3300006195 Ga0075366_10007107 Ga0075366_100071077 117
282 3300006946 Ga0079104_1000078 Ga0079104_100007833 117
283 3300006946 Ga0079104_1000130 Ga0079104_100013020 117
284 3300006946 Ga0079104_1000398 Ga0079104_100039819 117
285 3300006946 Ga0079104_1001042 Ga0079104_100104215 117
286 3300006946 Ga0079104_1001111 Ga0079104_100111123 117
287 3300006946 Ga0079104_1005438 Ga0079104_10054385 117
288 3300006946 Ga0079104_1064825 Ga0079104_10648252 117
289 3300009011 Ga0105251_10000577 Ga0105251_1000057713 117
290 3300009011 Ga0105251_10006626 Ga0105251_100066265 117
291 3300009011 Ga0105251_10268108 Ga0105251_102681082 117
292 3300009036 Ga0105244_10000021 Ga0105244_10000021153 117
293 3300009036 Ga0105244_10007187 Ga0105244_100071879 117
294 3300009036 Ga0105244_10008284 Ga0105244_100082842 117
295 3300009036 Ga0105244_10009009 Ga0105244_100090095 117
296 3300009092 Ga0105250_10000012 Ga0105250_1000001277 117
297 3300009092 Ga0105250_10001721 Ga0105250_1000172115 117
298 3300009092 Ga0105250_10095938 Ga0105250_100959382 117
299 3300009093 Ga0105240_10125683 Ga0105240_101256834 117
300 3300009148 Ga0105243_10000918 Ga0105243_1000091819 117
301 3300011119 Ga0105246_10018281 Ga0105246_100182812 117
302 3300011119 Ga0105246_10822425 Ga0105246_108224252 117
303 3300013100 Ga0157373_10024352 Ga0157373_100243527 117
304 3300013100 Ga0157373_10116069 Ga0157373_101160692 117
305 3300013102 Ga0157371_10011013 Ga0157371_100110133 117
306 3300013102 Ga0157371_10722873 Ga0157371_107228732 117
307 3300013104 Ga0157370_10000655 Ga0157370_1000065531 117
308 3300013104 Ga0157370_10003828 Ga0157370_100038287 117
309 3300013104 Ga0157370_10059164 Ga0157370_100591643 117
310 3300015261 Ga0182006_1057296 Ga0182006_10572962 117
311 3300021384 Ga0213876_10000660 Ga0213876_1000066018 117
312 3300025321 Ga0207656_10039198 Ga0207656_100391982 117
313 3300025711 Ga0207696_1000040 Ga0207696_1000040123 117
314 3300025711 Ga0207696_1000558 Ga0207696_100055827 117
315 3300025711 Ga0207696_1004926 Ga0207696_10049265 117
316 3300025711 Ga0207696_1097750 Ga0207696_10977502 117
317 3300025728 Ga0207655_1000043 Ga0207655_1000043228 117
318 3300025728 Ga0207655_1000082 Ga0207655_1000082131 117
319 3300025728 Ga0207655_1007439 Ga0207655_10074399 117
320 3300025728 Ga0207655_1017262 Ga0207655_10172622 117
321 3300025728 Ga0207655_1121086 Ga0207655_11210862 117
322 3300025735 Ga0207713_1000017 Ga0207713_1000017124 117
323 3300025735 Ga0207713_1010040 Ga0207713_10100402 117
324 3300025735 Ga0207713_1010243 Ga0207713_10102438 117
325 3300025735 Ga0207713_1055572 Ga0207713_10555722 117
326 3300025913 Ga0207695_10300076 Ga0207695_103000761 117
327 3300025914 Ga0207671_10303489 Ga0207671_103034892 117
328 3300025932 Ga0207690_10080449 Ga0207690_100804492 117
329 3300025935 Ga0207709_10000505 Ga0207709_1000050525 117
330 3300025935 Ga0207709_10010222 Ga0207709_100102224 117
331 3300025945 Ga0207679_11026688 Ga0207679_110266881 117
332 3300026116 Ga0207674_10000018 Ga0207674_1000001889 117
333 3300027111 Ga0209281_1000031 Ga0209281_1000031281 117
334 3300027111 Ga0209281_1000112 Ga0209281_100011263 117
335 3300027111 Ga0209281_1000162 Ga0209281_100016292 117
336 3300027111 Ga0209281_1000248 Ga0209281_100024896 117
337 3300027111 Ga0209281_1000618 Ga0209281_100061831 117
338 3300027111 Ga0209281_1000832 Ga0209281_100083221 117
339 3300027111 Ga0209281_1000833 Ga0209281_100083311 117
340 3300027111 Ga0209281_1003472 Ga0209281_10034722 117
341 3300027312 Ga0209371_1000027 Ga0209371_1000027120 117
342 3300027312 Ga0209371_1000092 Ga0209371_100009264 117
343 3300027312 Ga0209371_1000266 Ga0209371_100026641 117
344 3300027312 Ga0209371_1010496 Ga0209371_10104963 117
345 3300027312 Ga0209371_1011213 Ga0209371_10112132 117
346 3300027907 Ga0207428_10298100 Ga0207428_102981002 117
347 3300028379 Ga0268266_10000079 Ga0268266_10000079138 117
348 3300028379 Ga0268266_11093257 Ga0268266_110932572 117
349 3300030500 Ga0268256_1000045 Ga0268256_1000045169 117
350 3300030500 Ga0268256_1000082 Ga0268256_100008264 117
351 3300030500 Ga0268256_1000269 Ga0268256_100026925 117
352 3300030500 Ga0268256_1011271 Ga0268256_10112713 117
353 3300030500 Ga0268256_1012165 Ga0268256_10121652 117
354 3300039437 Ga0436365_0743852 Ga0436365_0743852_7827_8180 117
355 3300041512 Ga0451853_1718086 Ga0451853_1718086_372_725 117
356 3300042006 Ga0439432_003432 Ga0439432_003432_120_473 117
357 3300042006 Ga0439432_019518 Ga0439432_019518_383_736 117
358 3300042010 Ga0439452_000039 Ga0439452_000039_75966_76319 117
359 3300042010 Ga0439452_000212 Ga0439452_000212_21884_22237 117
360 3300042137 Ga0450902_022393 Ga0450902_022393_76_429 117
361 3300042439 Ga0439464_0000799 Ga0439464_0000799_3730_4083 117
362 3300046453 Ga0495627_006693 Ga0495627_006693_2486_2839 117
363 3300046458 Ga0495591_000029 Ga0495591_000029_79540_79893 117
364 3300046458 Ga0495591_000717 Ga0495591_000717_11311_11664 117
365 3300046460 Ga0495638_0001551 Ga0495638_0001551_6270_6623 117
366 3300046471 Ga0495650_0000103 Ga0495650_0000103_73279_73632 117
367 3300046471 Ga0495650_0001865 Ga0495650_0001865_12657_13034 117
368 3300046471 Ga0495650_0082473 Ga0495650_0082473_755_1108 117
369 3300046515 Ga0495620_0001496 Ga0495620_0001496_9775_10128 117
370 3300046522 Ga0495643_0168453 Ga0495643_0168453_33_386 117
371 3300046692 Ga0495671_0011386 Ga0495671_0011386_4320_4673 117
372 3300046694 Ga0495649_0000510 Ga0495649_0000510_25262_25615 117
373 3300046694 Ga0495649_0000847 Ga0495649_0000847_22090_22443 117
374 3300047446 Ga0495679_002582 Ga0495679_002582_1704_2057 117
375 3300047446 Ga0495679_009387 Ga0495679_009387_3141_3494 117
376 3300047469 Ga0495673_0000079 Ga0495673_0000079_66028_66381 117
377 3300048903 Ga0496100_0191087 Ga0496100_0191087_429_782 117
378 3300048904 Ga0496101_0124217 Ga0496101_0124217_317_670 117
379 3300048907 Ga0496104_0000119 Ga0496104_0000119_69155_69508 117
380 3300048916 Ga0496113_0084501 Ga0496113_0084501_1661_2014 117
381 3300048919 Ga0496116_0000623 Ga0496116_0000623_20976_21329 117
382 3300048919 Ga0496116_0005510 Ga0496116_0005510_10411_10764 117
383 3300048920 Ga0496117_0000298 Ga0496117_0000298_25195_25548 117
384 3300048920 Ga0496117_0001035 Ga0496117_0001035_27376_27729 117
385 3300048920 Ga0496117_0001085 Ga0496117_0001085_12247_12600 117
386 3300048920 Ga0496117_0003937 Ga0496117_0003937_10588_10965 117
387 3300048920 Ga0496117_0008440 Ga0496117_0008440_4025_4378 117
388 3300048920 Ga0496117_0011518 Ga0496117_0011518_1781_2134 117
389 3300048920 Ga0496117_0014154 Ga0496117_0014154_5050_5403 117
390 3300048920 Ga0496117_0099151 Ga0496117_0099151_710_1063 117
391 3300048921 Ga0496118_0001319 Ga0496118_0001319_16603_16956 117
392 3300048921 Ga0496118_0002434 Ga0496118_0002434_12021_12374 117
393 3300048921 Ga0496118_0003732 Ga0496118_0003732_5770_6123 117
394 3300048921 Ga0496118_0012145 Ga0496118_0012145_1781_2134 117
395 3300048921 Ga0496118_0053810 Ga0496118_0053810_940_1293 117
396 3300048921 Ga0496118_0081097 Ga0496118_0081097_1781_2134 117
397 3300048921 Ga0496118_0117549 Ga0496118_0117549_163_516 117
398 3300048921 Ga0496118_0640210 Ga0496118_0640210_131_484 117
399 3300048922 Ga0496119_0000741 Ga0496119_0000741_17672_18025 117
400 3300048922 Ga0496119_0001629 Ga0496119_0001629_25153_25506 117
401 3300048922 Ga0496119_0002279 Ga0496119_0002279_5869_6222 117
402 3300048922 Ga0496119_0009914 Ga0496119_0009914_3058_3411 117
403 3300048922 Ga0496119_0037927 Ga0496119_0037927_2503_2856 117
404 3300048922 Ga0496119_0172840 Ga0496119_0172840_729_1082 117
405 3300048923 Ga0496120_0000389 Ga0496120_0000389_17672_18025 117
406 3300048923 Ga0496120_0001166 Ga0496120_0001166_8149_8502 117
407 3300048923 Ga0496120_0001877 Ga0496120_0001877_10953_11306 117
408 3300048923 Ga0496120_0001913 Ga0496120_0001913_9093_9446 117
409 3300048923 Ga0496120_0002608 Ga0496120_0002608_5956_6309 117
410 3300048923 Ga0496120_0100000 Ga0496120_0100000_591_944 117
411 3300048924 Ga0496121_0001155 Ga0496121_0001155_20936_21289 117
412 3300048924 Ga0496121_0001222 Ga0496121_0001222_28942_29295 117
413 3300048924 Ga0496121_0003763 Ga0496121_0003763_12968_13321 117
414 3300048924 Ga0496121_0008113 Ga0496121_0008113_7936_8289 117
415 3300048924 Ga0496121_0014431 Ga0496121_0014431_427_780 117
416 3300048924 Ga0496121_0020348 Ga0496121_0020348_4828_5181 117
417 3300048924 Ga0496121_0145976 Ga0496121_0145976_371_724 117
418 3300048925 Ga0496122_0000108 Ga0496122_0000108_110192_110545 117
419 3300048925 Ga0496122_0002008 Ga0496122_0002008_7833_8186 117
420 3300048925 Ga0496122_0005674 Ga0496122_0005674_13993_14346 117
421 3300048925 Ga0496122_0017495 Ga0496122_0017495_5742_6095 117
422 3300048925 Ga0496122_0025647 Ga0496122_0025647_736_1089 117
423 3300048925 Ga0496122_0068917 Ga0496122_0068917_1435_1788 117
424 3300048925 Ga0496122_0362037 Ga0496122_0362037_27_404 117
425 3300048926 Ga0496123_0000065 Ga0496123_0000065_80485_80838 117
426 3300048926 Ga0496123_0000605 Ga0496123_0000605_52698_53051 117
427 3300048926 Ga0496123_0006055 Ga0496123_0006055_8859_9212 117
428 3300048926 Ga0496123_0017936 Ga0496123_0017936_1122_1475 117
429 3300048926 Ga0496123_0023673 Ga0496123_0023673_3273_3650 117
430 3300048926 Ga0496123_0122292 Ga0496123_0122292_472_825 117
431 3300048927 Ga0496124_0000053 Ga0496124_0000053_107782_108135 117
432 3300048927 Ga0496124_0000147 Ga0496124_0000147_77093_77446 117
433 3300048927 Ga0496124_0001901 Ga0496124_0001901_12007_12360 117
434 3300048927 Ga0496124_0003341 Ga0496124_0003341_7613_7966 117
435 3300048927 Ga0496124_0006859 Ga0496124_0006859_1045_1398 117
436 3300048927 Ga0496124_0007018 Ga0496124_0007018_11152_11505 117
437 3300048927 Ga0496124_0256871 Ga0496124_0256871_696_1049 117
438 3300048927 Ga0496124_0498723 Ga0496124_0498723_281_634 117
439 3300048928 Ga0496125_0036930 Ga0496125_0036930_2360_2713 117
440 3300048928 Ga0496125_0043092 Ga0496125_0043092_966_1319 117
441 3300048928 Ga0496125_0055714 Ga0496125_0055714_51_428 117
442 3300048929 Ga0496126_0000387 Ga0496126_0000387_9348_9701 117
443 3300048929 Ga0496126_0000759 Ga0496126_0000759_44273_44626 117
444 3300048929 Ga0496126_0019693 Ga0496126_0019693_325_702 117
445 3300048929 Ga0496126_0107702 Ga0496126_0107702_1359_1712 117
446 3300048929 Ga0496126_0145758 Ga0496126_0145758_368_721 117
447 3300048929 Ga0496126_0649525 Ga0496126_0649525_430_783 117
448 3300048929 Ga0496126_1392704 Ga0496126_1392704_38_391 117
449 3300050491 nmdc:mga00v17_4369_c1 nmdc:mga00v17_4369_c1_1927_2280 117
450 3300050491 nmdc:mga00v17_522540_c1 nmdc:mga00v17_522540_c1_56_409 117
451 3300050493 nmdc:mga0k408_7167_c1 nmdc:mga0k408_7167_c1_3261_3614 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22818

ApeI-like

ApeI dehydratase

9

125

0.94

PF07977

FabA

FabA-like domain

4

114

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsr-assembly1.cif.gz_A the dehydratase heterocomplex apei:p from xenorhabdus doucetiae 0.9191 1 117
6qsr-assembly1.cif.gz_A the dehydratase heterocomplex apei:p from xenorhabdus doucetiae 0.9113 1 117
3esi-assembly1.cif.gz_C crystal structure of an uncharacterized protein from erwinia carotovora subsp. atroseptica. northeast structural genomics target ewr179 0.9014 1 116
3esi-assembly1.cif.gz_C crystal structure of an uncharacterized protein from erwinia carotovora subsp. atroseptica. northeast structural genomics target ewr179 0.8865 1 116
5hst-assembly2.cif.gz_A crystal structure of the dehydratase domain of mlnb from bacillus amyloliquefaciens 0.8067 14 117
ID Description Score Start End Superfamily
6qsrA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9191 1 117 3.10.129.10
6qsrA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9113 1 117 3.10.129.10
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8175 38 113 3.10.129.10
4o3zA02 Mainly Beta;Beta Barrel;Porin; 0.7926 75 107 2.40.160.90
af_A4I4M9_176_344_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.774 15 115 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7X2SXP0-F1-model_v4 Hydroxymyristoyl-ACP dehydratase 0.9553 32 116
AF-A0A855YNY4-F1-model_v4 deleted 0.9458 1 116
AF-A0A0L7T535-F1-model_v4 Hydroxymyristoyl-ACP dehydratase 0.9457 1 116
AF-W1IYQ8-F1-model_v4 Putative fatty acid degradation enzyme 0.9432 2 117
AF-A0A0A3Z7D9-F1-model_v4 deleted 0.9428 1 116

Feature Viewer

pLDDT pTM Quality
94.53 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map