F446146

General Info

Members Datasets Scaffolds Average Seq Length
448 161 896 71

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10002657|Ga0105245_100026573
Length 82
Sequence MKLLERELGERLMNKMLGIILIVVGIVGLAWGGFSYTTREKVVDIGPIHASRDKNHSVPLPPIAGALALVGGVALLVAGKNG

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.78
Stem 0
Stem Tuber 0
Unclassified 35.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10002657 3300009098 Bacteria 16090
2 Ga0058863_10149037 3300004799 Unclassified 535
3 Ga0058861_10900485 3300004800 Unclassified 731
4 Ga0058862_12843382 3300004803 Unclassified 800
5 Ga0070658_10011854 3300005327 Bacteria 6999
6 Ga0070683_100021164 3300005329 Bacteria 5800
7 Ga0070683_100653494 3300005329 Bacteria 1007
8 Ga0070690_100077175 3300005330 Bacteria 2174
9 Ga0070670_101403714 3300005331 Unclassified 640
10 Ga0068869_100038905 3300005334 Unclassified 3393
11 Ga0068869_100470934 3300005334 Unclassified 1044
12 Ga0068869_101525666 3300005334 Unclassified 594
13 Ga0068869_101528734 3300005334 Bacteria 593
14 Ga0070666_10012638 3300005335 Bacteria 5333
15 Ga0070666_10522953 3300005335 Unclassified 861
16 Ga0070666_10661714 3300005335 Unclassified 764
17 Ga0070680_100531374 3300005336 Bacteria 1007
18 Ga0068868_100008778 3300005338 Bacteria 7243
19 Ga0068868_100073782 3300005338 Bacteria 2725
20 Ga0068868_100107734 3300005338 Bacteria 2261
21 Ga0070660_100328993 3300005339 Unclassified 1256
22 Ga0070660_100483294 3300005339 Unclassified 1029
23 Ga0070661_100103056 3300005344 Bacteria 2125
24 Ga0070692_11053403 3300005345 Bacteria 572
25 Ga0070671_100065147 3300005355 Bacteria 3035
26 Ga0070671_100226289 3300005355 Bacteria 1587
27 Ga0070671_100306905 3300005355 Bacteria 1351
28 Ga0070674_100969820 3300005356 Bacteria 744
29 Ga0070673_100101627 3300005364 Bacteria 2369
30 Ga0070673_101360661 3300005364 Bacteria 668
31 Ga0070667_100027308 3300005367 Bacteria 4749
32 Ga0070667_100300321 3300005367 Unclassified 1446
33 Ga0070667_100375063 3300005367 Bacteria 1291
34 Ga0070667_100868214 3300005367 Bacteria 839
35 Ga0070667_101239713 3300005367 Unclassified 698
36 Ga0070667_102233515 3300005367 Unclassified 515
37 Ga0070709_10225124 3300005434 Bacteria 1339
38 Ga0070714_100005934 3300005435 Bacteria 9377
39 Ga0070713_100014567 3300005436 Bacteria 5846
40 Ga0070713_100035238 3300005436 Bacteria 4027
41 Ga0070711_100057017 3300005439 Bacteria 2703
42 Ga0070711_100198035 3300005439 Bacteria 1548
43 Ga0070711_100410020 3300005439 Unclassified 1102
44 Ga0070711_100415564 3300005439 Bacteria 1095
45 Ga0070708_100534832 3300005445 Bacteria 1106
46 Ga0070678_100092766 3300005456 Bacteria 2320
47 Ga0070662_100082656 3300005457 Bacteria 2395
48 Ga0070681_10001538 3300005458 Bacteria 20422
49 Ga0070681_10247772 3300005458 Bacteria 1694
50 Ga0070681_11865218 3300005458 Unclassified 528
51 Ga0068867_100025033 3300005459 Bacteria 4280
52 Ga0068867_100119097 3300005459 Bacteria 2038
53 Ga0068867_100689201 3300005459 Unclassified 900
54 Ga0068867_101084290 3300005459 Unclassified 730
55 Ga0070707_101655604 3300005468 Bacteria 607
56 Ga0070679_100063946 3300005530 Unclassified 3667
57 Ga0070679_100606072 3300005530 Unclassified 1038
58 Ga0070679_100653097 3300005530 Bacteria 994
59 Ga0070679_101639026 3300005530 Bacteria 591
60 Ga0070684_100019914 3300005535 Bacteria 5560
61 Ga0070684_100064821 3300005535 Bacteria 3205
62 Ga0070684_100315902 3300005535 Bacteria 1435
63 Ga0070684_100368960 3300005535 Bacteria 1321
64 Ga0070684_100756165 3300005535 Unclassified 907
65 Ga0070684_101115668 3300005535 Unclassified 741
66 Ga0068853_100050719 3300005539 Bacteria 3571
67 Ga0068853_100051627 3300005539 Bacteria 3539
68 Ga0068853_100491232 3300005539 Bacteria 1158
69 Ga0068853_101353138 3300005539 Unclassified 688
70 Ga0070672_101178329 3300005543 Unclassified 682
71 Ga0070686_100271566 3300005544 Unclassified 1247
72 Ga0070686_100991810 3300005544 Unclassified 688
73 Ga0070693_100006486 3300005547 Bacteria 5675
74 Ga0070693_100107095 3300005547 Bacteria 1713
75 Ga0070693_100602357 3300005547 Bacteria 793
76 Ga0070665_100047262 3300005548 Bacteria 4321
77 Ga0070665_100049775 3300005548 Bacteria 4204
78 Ga0070665_100499317 3300005548 Unclassified 1228
79 Ga0070665_101942014 3300005548 Unclassified 594
80 Ga0068855_100008487 3300005563 Bacteria 12418
81 Ga0068855_100610259 3300005563 Bacteria 1176
82 Ga0068855_100710203 3300005563 Bacteria 1075
83 Ga0070664_100102394 3300005564 Bacteria 2491
84 Ga0070664_100353718 3300005564 Unclassified 1337
85 Ga0068857_100005030 3300005577 Bacteria 11239
86 Ga0068857_100006593 3300005577 Bacteria 9966
87 Ga0068857_100126871 3300005577 Bacteria 2300
88 Ga0068857_101326088 3300005577 Unclassified 699
89 Ga0068856_100059396 3300005614 Bacteria 3777
90 Ga0068856_100197288 3300005614 Bacteria 2027
91 Ga0068856_100491840 3300005614 Bacteria 1248
92 Ga0070702_100184741 3300005615 Bacteria 1367
93 Ga0068852_101728433 3300005616 Bacteria 648
94 Ga0068852_102784675 3300005616 Bacteria 507
95 Ga0068859_100240082 3300005617 Bacteria 1901
96 Ga0068859_100977402 3300005617 Unclassified 929
97 Ga0068859_101146734 3300005617 Bacteria 856
98 Ga0068859_101782628 3300005617 Bacteria 680
99 Ga0068859_102958830 3300005617 Unclassified 520
100 Ga0068864_100011885 3300005618 Bacteria 7187
101 Ga0068864_100786836 3300005618 Bacteria 934
102 Ga0068864_101259916 3300005618 Unclassified 739
103 Ga0068864_101672953 3300005618 Unclassified 641
104 Ga0068866_10027550 3300005718 Bacteria 2697
105 Ga0068863_100056253 3300005841 Unclassified 3725
106 Ga0068863_100437708 3300005841 Bacteria 1282
107 Ga0068863_100706556 3300005841 Bacteria 1002
108 Ga0068863_100854829 3300005841 Bacteria 909
109 Ga0068863_100954478 3300005841 Unclassified 859
110 Ga0068863_101851412 3300005841 Unclassified 613
111 Ga0068858_100003289 3300005842 Bacteria 16097
112 Ga0068858_100011141 3300005842 Bacteria 8502
113 Ga0068858_100250355 3300005842 Bacteria 1683
114 Ga0068858_100736112 3300005842 Unclassified 960
115 Ga0068858_101243509 3300005842 Unclassified 732
116 Ga0068858_101567721 3300005842 Unclassified 650
117 Ga0068860_100015158 3300005843 Bacteria 7530
118 Ga0068860_100017084 3300005843 Bacteria 7072
119 Ga0068860_100452090 3300005843 Bacteria 1277
120 Ga0068860_100673596 3300005843 Bacteria 1043
121 Ga0068860_101055051 3300005843 Bacteria 831
122 Ga0068862_101772191 3300005844 Bacteria 626
123 Ga0070717_10029192 3300006028 Bacteria 4422
124 Ga0070717_10044910 3300006028 Unclassified 3611
125 Ga0070717_10186385 3300006028 Bacteria 1811
126 Ga0070715_10535666 3300006163 Unclassified 676
127 Ga0070712_100211429 3300006175 Bacteria 1530
128 Ga0097621_100010718 3300006237 Bacteria 6721
129 Ga0097621_100017674 3300006237 Bacteria 5423
130 Ga0097621_100019597 3300006237 Bacteria 5196
131 Ga0097621_100027721 3300006237 Bacteria 4457
132 Ga0097621_100050841 3300006237 Bacteria 3371
133 Ga0097621_100096620 3300006237 Bacteria 2479
134 Ga0097621_100241235 3300006237 Bacteria 1580
135 Ga0097621_102158551 3300006237 Unclassified 533
136 Ga0068871_100004830 3300006358 Bacteria 9420
137 Ga0068871_100021445 3300006358 Bacteria 4965
138 Ga0068871_100029050 3300006358 Unclassified 4341
139 Ga0068871_100053438 3300006358 Unclassified 3274
140 Ga0068871_100097767 3300006358 Bacteria 2455
141 Ga0068871_100122081 3300006358 Bacteria 2202
142 Ga0068871_101667005 3300006358 Unclassified 604
143 Ga0068871_102241923 3300006358 Bacteria 521
144 Ga0068865_100081083 3300006881 Bacteria 2329
145 Ga0068865_100142368 3300006881 Bacteria 1809
146 Ga0068865_101456681 3300006881 Unclassified 612
147 Ga0075436_100383640 3300006914 Unclassified 1016
148 Ga0097620_100240064 3300006931 Bacteria 1901
149 Ga0097620_100977435 3300006931 Unclassified 929
150 Ga0097620_101146711 3300006931 Bacteria 856
151 Ga0097620_101782554 3300006931 Bacteria 680
152 Ga0097620_102958889 3300006931 Unclassified 520
153 Ga0105240_10104780 3300009093 Bacteria 3434
154 Ga0105240_10288572 3300009093 Bacteria 1882
155 Ga0105240_10345740 3300009093 Bacteria 1688
156 Ga0105240_10632265 3300009093 Unclassified 1175
157 Ga0105240_10946973 3300009093 Unclassified 924
158 Ga0105245_10000428 3300009098 Bacteria 39167
159 Ga0105245_10018200 3300009098 Bacteria 6143
160 Ga0105245_10036603 3300009098 Bacteria 4361
161 Ga0105245_10055879 3300009098 Bacteria 3547
162 Ga0105245_10077852 3300009098 Bacteria 3024
163 Ga0105245_10265663 3300009098 Bacteria 1671
164 Ga0105245_11125484 3300009098 Unclassified 832
165 Ga0105245_12561801 3300009098 Bacteria 563
166 Ga0105247_10018046 3300009101 Bacteria 4232
167 Ga0105247_10033479 3300009101 Bacteria 3126
168 Ga0105247_11544555 3300009101 Bacteria 543
169 Ga0105243_10068085 3300009148 Unclassified 2869
170 Ga0105243_10634367 3300009148 Bacteria 1033
171 Ga0105243_10655267 3300009148 Bacteria 1018
172 Ga0105243_10730493 3300009148 Unclassified 968
173 Ga0105243_11022946 3300009148 Unclassified 830
174 Ga0105243_12833677 3300009148 Unclassified 525
175 Ga0105243_13107241 3300009148 Unclassified 503
176 Ga0105241_10012444 3300009174 Bacteria 6237
177 Ga0105241_10016966 3300009174 Bacteria 5344
178 Ga0105241_10025054 3300009174 Unclassified 4433
179 Ga0105241_10046584 3300009174 Bacteria 3293
180 Ga0105241_10061599 3300009174 Bacteria 2890
181 Ga0105241_10104087 3300009174 Bacteria 2261
182 Ga0105241_10964284 3300009174 Bacteria 796
183 Ga0105241_11705543 3300009174 Bacteria 612
184 Ga0105241_11815878 3300009174 Unclassified 595
185 Ga0105241_12063259 3300009174 Unclassified 563
186 Ga0105242_10005574 3300009176 Bacteria 9713
187 Ga0105242_10015555 3300009176 Bacteria 5911
188 Ga0105242_10019799 3300009176 Bacteria 5273
189 Ga0105242_10133958 3300009176 Bacteria 2142
190 Ga0105242_10158200 3300009176 Bacteria 1981
191 Ga0105242_10195327 3300009176 Unclassified 1794
192 Ga0105242_10558180 3300009176 Bacteria 1099
193 Ga0105242_10684600 3300009176 Unclassified 1001
194 Ga0105248_10013591 3300009177 Bacteria 8962
195 Ga0105248_10024050 3300009177 Bacteria 6771
196 Ga0105248_10025541 3300009177 Bacteria 6567
197 Ga0105248_10122249 3300009177 Bacteria 2936
198 Ga0105248_10128033 3300009177 Bacteria 2865
199 Ga0105248_10303714 3300009177 Bacteria 1797
200 Ga0105248_10341023 3300009177 Bacteria 1687
201 Ga0105248_10492816 3300009177 Bacteria 1381
202 Ga0105248_10662927 3300009177 Bacteria 1177
203 Ga0105248_11815476 3300009177 Unclassified 691
204 Ga0105248_12107425 3300009177 Bacteria 641
205 Ga0105237_10060041 3300009545 Bacteria 3804
206 Ga0105237_10234924 3300009545 Bacteria 1834
207 Ga0105237_10277500 3300009545 Bacteria 1678
208 Ga0105237_10519593 3300009545 Bacteria 1197
209 Ga0105237_11139464 3300009545 Unclassified 787
210 Ga0105237_11168359 3300009545 Bacteria 776
211 Ga0105237_12382047 3300009545 Bacteria 539
212 Ga0105238_10017828 3300009551 Bacteria 7218
213 Ga0105238_10027230 3300009551 Bacteria 5824
214 Ga0105238_10048889 3300009551 Bacteria 4261
215 Ga0105238_10053463 3300009551 Bacteria 4058
216 Ga0105238_10358639 3300009551 Bacteria 1447
217 Ga0105238_10918986 3300009551 Unclassified 894
218 Ga0105238_11187559 3300009551 Unclassified 787
219 Ga0105249_10149813 3300009553 Bacteria 2245
220 Ga0105249_10961441 3300009553 Unclassified 922
221 Ga0105249_11704220 3300009553 Unclassified 703
222 Ga0105239_10006385 3300010375 Bacteria 13697
223 Ga0105239_10041270 3300010375 Bacteria 5057
224 Ga0105239_10065168 3300010375 Bacteria 4001
225 Ga0105239_10852692 3300010375 Unclassified 1045
226 Ga0105239_10875516 3300010375 Unclassified 1030
227 Ga0105239_11028010 3300010375 Unclassified 948
228 Ga0105246_10003330 3300011119 Bacteria 9724
229 Ga0105246_10029548 3300011119 Bacteria 3611
230 Ga0105246_10062949 3300011119 Bacteria 2586
231 Ga0105246_10280159 3300011119 Bacteria 1337
232 Ga0105246_10984571 3300011119 Unclassified 762
233 Ga0105246_11899521 3300011119 Unclassified 572
234 Ga0157370_10048079 3300013104 Bacteria 4087
235 Ga0157370_10070729 3300013104 Bacteria 3293
236 Ga0157369_10057424 3300013105 Bacteria 4199
237 Ga0157369_12016229 3300013105 Unclassified 585
238 Ga0157369_12394645 3300013105 Bacteria 535
239 Ga0157374_10032469 3300013296 Bacteria 4753
240 Ga0157374_10082542 3300013296 Bacteria 3052
241 Ga0157374_10152592 3300013296 Bacteria 2247
242 Ga0157374_10447169 3300013296 Unclassified 1293
243 Ga0157374_10729091 3300013296 Bacteria 1005
244 Ga0157374_10885917 3300013296 Bacteria 910
245 Ga0157378_10000890 3300013297 Bacteria 27558
246 Ga0157378_10065415 3300013297 Unclassified 3254
247 Ga0157378_10069881 3300013297 Bacteria 3151
248 Ga0157378_10208305 3300013297 Bacteria 1853
249 Ga0157378_10948669 3300013297 Unclassified 893
250 Ga0157378_11089842 3300013297 Unclassified 835
251 Ga0163162_10194847 3300013306 Bacteria 2155
252 Ga0163162_10617533 3300013306 Bacteria 1209
253 Ga0163162_11147415 3300013306 Bacteria 881
254 Ga0163162_12525473 3300013306 Unclassified 591
255 Ga0157372_10020899 3300013307 Bacteria 7066
256 Ga0157372_10108624 3300013307 Unclassified 3175
257 Ga0157372_11210102 3300013307 Unclassified 873
258 Ga0157375_10005565 3300013308 Bacteria 10960
259 Ga0157375_10284538 3300013308 Unclassified 1817
260 Ga0157375_10668678 3300013308 Bacteria 1194
261 Ga0157375_10962090 3300013308 Unclassified 995
262 Ga0157375_11521436 3300013308 Bacteria 790
263 Ga0163163_10002043 3300014325 Bacteria 17051
264 Ga0163163_10008728 3300014325 Bacteria 9018
265 Ga0163163_10034807 3300014325 Bacteria 4881
266 Ga0163163_10042043 3300014325 Bacteria 4473
267 Ga0163163_10114256 3300014325 Unclassified 2730
268 Ga0163163_10369913 3300014325 Bacteria 1490
269 Ga0163163_10734174 3300014325 Bacteria 1051
270 Ga0157377_11422395 3300014745 Unclassified 548
271 Ga0157379_10328340 3300014968 Unclassified 1397
272 Ga0157379_10363522 3300014968 Unclassified 1326
273 Ga0157379_10994322 3300014968 Bacteria 799
274 Ga0157379_12176438 3300014968 Unclassified 551
275 Ga0157379_12327439 3300014968 Bacteria 534
276 Ga0157376_10033213 3300014969 Bacteria 4151
277 Ga0157376_10109356 3300014969 Bacteria 2430
278 Ga0157376_10714418 3300014969 Unclassified 1008
279 Ga0157376_11443042 3300014969 Unclassified 720
280 Ga0157376_12339337 3300014969 Bacteria 574
281 Ga0157376_12976507 3300014969 Bacteria 513
282 Ga0206356_11502722 3300020070 Bacteria 727
283 Ga0206350_11369935 3300020080 Unclassified 699
284 Ga0206353_11685216 3300020082 Unclassified 582
285 Ga0224712_10408127 3300022467 Unclassified 648
286 Ga0207642_10856542 3300025899 Bacteria 580
287 Ga0207642_10959902 3300025899 Bacteria 549
288 Ga0207710_10030869 3300025900 Bacteria 2340
289 Ga0207710_10153400 3300025900 Bacteria 1118
290 Ga0207680_10392158 3300025903 Bacteria 980
291 Ga0207680_10535844 3300025903 Unclassified 835
292 Ga0207680_10571625 3300025903 Bacteria 808
293 Ga0207699_10159928 3300025906 Bacteria 1498
294 Ga0207705_10056015 3300025909 Unclassified 2842
295 Ga0207654_10015019 3300025911 Bacteria 4010
296 Ga0207654_10042998 3300025911 Bacteria 2559
297 Ga0207654_10124146 3300025911 Bacteria 1625
298 Ga0207654_10376430 3300025911 Unclassified 983
299 Ga0207654_10936312 3300025911 Unclassified 629
300 Ga0207654_11043619 3300025911 Unclassified 595
301 Ga0207707_10116141 3300025912 Bacteria 2338
302 Ga0207707_10119495 3300025912 Bacteria 2303
303 Ga0207707_11510319 3300025912 Unclassified 532
304 Ga0207695_10269634 3300025913 Bacteria 1598
305 Ga0207695_10918956 3300025913 Bacteria 755
306 Ga0207671_10058774 3300025914 Bacteria 2851
307 Ga0207671_10214163 3300025914 Unclassified 1508
308 Ga0207693_10207298 3300025915 Bacteria 1541
309 Ga0207663_10190566 3300025916 Unclassified 1472
310 Ga0207660_10134750 3300025917 Bacteria 1883
311 Ga0207657_10251529 3300025919 Bacteria 1408
312 Ga0207657_10369280 3300025919 Unclassified 1130
313 Ga0207649_10253092 3300025920 Unclassified 1269
314 Ga0207652_10250067 3300025921 Bacteria 1599
315 Ga0207652_10257683 3300025921 Unclassified 1573
316 Ga0207694_10011788 3300025924 Bacteria 6595
317 Ga0207694_10039983 3300025924 Bacteria 3610
318 Ga0207694_10060723 3300025924 Bacteria 2942
319 Ga0207694_10100188 3300025924 Bacteria 2295
320 Ga0207650_11562346 3300025925 Unclassified 560
321 Ga0207687_10010590 3300025927 Bacteria 6028
322 Ga0207687_10021860 3300025927 Bacteria 4252
323 Ga0207687_10027609 3300025927 Bacteria 3810
324 Ga0207687_10385650 3300025927 Unclassified 1149
325 Ga0207687_10523992 3300025927 Bacteria 992
326 Ga0207687_10841688 3300025927 Bacteria 784
327 Ga0207687_10874397 3300025927 Unclassified 768
328 Ga0207687_11843300 3300025927 Bacteria 517
329 Ga0207700_10069690 3300025928 Unclassified 2700
330 Ga0207664_10008455 3300025929 Bacteria 7181
331 Ga0207644_10090772 3300025931 Bacteria 2277
332 Ga0207644_10180903 3300025931 Unclassified 1652
333 Ga0207690_10085572 3300025932 Unclassified 2213
334 Ga0207690_10549826 3300025932 Bacteria 938
335 Ga0207706_10949455 3300025933 Unclassified 724
336 Ga0207686_10015384 3300025934 Bacteria 4278
337 Ga0207686_10023520 3300025934 Bacteria 3560
338 Ga0207686_10070541 3300025934 Bacteria 2246
339 Ga0207686_10115435 3300025934 Unclassified 1818
340 Ga0207686_11109702 3300025934 Bacteria 645
341 Ga0207709_10046378 3300025935 Unclassified 2637
342 Ga0207709_10056738 3300025935 Unclassified 2425
343 Ga0207709_10399872 3300025935 Unclassified 1050
344 Ga0207709_11008469 3300025935 Unclassified 681
345 Ga0207669_11176866 3300025937 Bacteria 649
346 Ga0207704_10323536 3300025938 Bacteria 1190
347 Ga0207704_10433439 3300025938 Unclassified 1045
348 Ga0207665_10751939 3300025939 Bacteria 768
349 Ga0207711_10036812 3300025941 Unclassified 4153
350 Ga0207711_10039315 3300025941 Bacteria 4024
351 Ga0207711_10115197 3300025941 Unclassified 2395
352 Ga0207711_10520707 3300025941 Bacteria 1109
353 Ga0207711_10530930 3300025941 Unclassified 1097
354 Ga0207711_10531363 3300025941 Unclassified 1097
355 Ga0207711_11870007 3300025941 Unclassified 543
356 Ga0207689_10034921 3300025942 Unclassified 4177
357 Ga0207689_10251469 3300025942 Bacteria 1461
358 Ga0207689_10281458 3300025942 Unclassified 1377
359 Ga0207689_10334134 3300025942 Unclassified 1258
360 Ga0207689_11386545 3300025942 Unclassified 589
361 Ga0207661_10020080 3300025944 Bacteria 4990
362 Ga0207661_10056543 3300025944 Bacteria 3150
363 Ga0207679_10261892 3300025945 Unclassified 1475
364 Ga0207667_10072645 3300025949 Bacteria 3575
365 Ga0207667_10292492 3300025949 Bacteria 1664
366 Ga0207651_10420374 3300025960 Unclassified 1141
367 Ga0207651_11408874 3300025960 Bacteria 627
368 Ga0207712_10264488 3300025961 Bacteria 1396
369 Ga0207712_12001616 3300025961 Unclassified 518
370 Ga0207640_11450951 3300025981 Unclassified 616
371 Ga0207658_10040125 3300025986 Bacteria 3382
372 Ga0207658_10157877 3300025986 Unclassified 1856
373 Ga0207658_10330485 3300025986 Bacteria 1322
374 Ga0207658_10730237 3300025986 Bacteria 896
375 Ga0207677_10110968 3300026023 Bacteria 2042
376 Ga0207677_10153622 3300026023 Bacteria 1779
377 Ga0207677_10337925 3300026023 Bacteria 1257
378 Ga0207677_11397861 3300026023 Unclassified 645
379 Ga0207703_10007739 3300026035 Bacteria 8504
380 Ga0207703_10081296 3300026035 Bacteria 2700
381 Ga0207703_10389200 3300026035 Bacteria 1291
382 Ga0207703_10686938 3300026035 Unclassified 973
383 Ga0207639_10022573 3300026041 Bacteria 4534
384 Ga0207639_10028094 3300026041 Bacteria 4104
385 Ga0207639_10415465 3300026041 Bacteria 1215
386 Ga0207702_10572152 3300026078 Bacteria 1107
387 Ga0207641_10117109 3300026088 Unclassified 2372
388 Ga0207641_10284010 3300026088 Bacteria 1558
389 Ga0207641_10853865 3300026088 Bacteria 902
390 Ga0207641_10865560 3300026088 Unclassified 896
391 Ga0207648_10051195 3300026089 Bacteria 3609
392 Ga0207648_11079530 3300026089 Unclassified 753
393 Ga0207676_10175663 3300026095 Unclassified 1870
394 Ga0207676_10784619 3300026095 Bacteria 929
395 Ga0207676_11212156 3300026095 Bacteria 748
396 Ga0207674_10002339 3300026116 Bacteria 23974
397 Ga0207674_10008934 3300026116 Bacteria 11514
398 Ga0207674_10084573 3300026116 Bacteria 3170
399 Ga0207683_10080620 3300026121 Bacteria 2888
400 Ga0207698_12369621 3300026142 Bacteria 542
401 Ga0268266_10003783 3300028379 Bacteria 14818
402 Ga0268266_10155191 3300028379 Bacteria 2067
403 Ga0268266_10559141 3300028379 Unclassified 1097
404 Ga0268266_11112144 3300028379 Unclassified 764
405 Ga0268265_11566890 3300028380 Bacteria 663
406 Ga0268264_10004756 3300028381 Bacteria 11526
407 Ga0268264_10346284 3300028381 Bacteria 1413
408 Ga0265338_10086063 3300028800 Unclassified 2618
409 Ga0265338_10164739 3300028800 Bacteria 1708
410 Ga0265338_10969512 3300028800 Unclassified 577
411 Ga0265760_10083159 3300031090 Bacteria 994
412 Ga0265320_10503863 3300031240 Unclassified 535
413 Ga0265325_10070817 3300031241 Bacteria 1751
414 Ga0265331_10336718 3300031250 Unclassified 676
415 Ga0265331_10558823 3300031250 Unclassified 516
416 Ga0265316_10283222 3300031344 Bacteria 1211
417 Ga0265316_11298194 3300031344 Unclassified 503
418 Ga0265313_10002335 3300031595 Bacteria 16605
419 Ga0265313_10218923 3300031595 Unclassified 786
420 Ga0265314_10085767 3300031711 Bacteria 2064
421 Ga0265342_10048061 3300031712 Unclassified 2559
422 Ga0373934_0259873 3300035086 Unclassified 718
423 Ga0373934_0502356 3300035086 Unclassified 510
424 Ga0373957_0058067 3300035120 Bacteria 1494
425 Ga0373960_0224922 3300035121 Unclassified 673
426 Ga0373943_0492007 3300035170 Bacteria 716
427 Ga0373943_0752702 3300035170 Unclassified 579
428 Ga0373955_0457277 3300035172 Unclassified 778
429 Ga0373931_0166755 3300035691 Bacteria 1295
430 Ga0373935_1218598 3300035692 Unclassified 561
431 Ga0373933_0022308 3300035724 Bacteria 3604
432 Ga0373933_0041522 3300035724 Bacteria 2716
433 Ga0373937_0023089 3300036401 Bacteria 5596
434 Ga0373937_0036105 3300036401 Bacteria 4503
435 Ga0373937_0300106 3300036401 Bacteria 1518
436 Ga0265778_042670 3300036457 Bacteria 607
437 Ga0265778_057026 3300036457 Unclassified 542
438 Ga0451577_0253639 3300042876 Bacteria 1593
439 Ga0451577_1374624 3300042876 Bacteria 627
440 Ga0453684_1565181 3300044712 Unclassified 678
441 Ga0495582_0410189 3300046473 Bacteria 781
442 Ga0495624_0624307 3300046690 Unclassified 642
443 Ga0495674_0989954 3300047319 Unclassified 645
444 Ga0495675_0207795 3300047444 Bacteria 1190
445 Ga0495675_0285084 3300047444 Bacteria 984
446 Ga0495684_0958017 3300047471 Unclassified 547
447 Ga0496112_0180361 3300048915 Bacteria 2076
448 nmdc:mga08x19_1164882_c1 3300050514 Unclassified 547
449 Ga0105245_10002657
450 Ga0058863_10149037
451 Ga0058861_10900485
452 Ga0058862_12843382
453 Ga0070658_10011854
454 Ga0070683_100021164
455 Ga0070683_100653494
456 Ga0070690_100077175
457 Ga0070670_101403714
458 Ga0068869_100038905
459 Ga0068869_100470934
460 Ga0068869_101525666
461 Ga0068869_101528734
462 Ga0070666_10012638
463 Ga0070666_10522953
464 Ga0070666_10661714
465 Ga0070680_100531374
466 Ga0068868_100008778
467 Ga0068868_100073782
468 Ga0068868_100107734
469 Ga0070660_100328993
470 Ga0070660_100483294
471 Ga0070661_100103056
472 Ga0070692_11053403
473 Ga0070671_100065147
474 Ga0070671_100226289
475 Ga0070671_100306905
476 Ga0070674_100969820
477 Ga0070673_100101627
478 Ga0070673_101360661
479 Ga0070667_100027308
480 Ga0070667_100300321
481 Ga0070667_100375063
482 Ga0070667_100868214
483 Ga0070667_101239713
484 Ga0070667_102233515
485 Ga0070709_10225124
486 Ga0070714_100005934
487 Ga0070713_100014567
488 Ga0070713_100035238
489 Ga0070711_100057017
490 Ga0070711_100198035
491 Ga0070711_100410020
492 Ga0070711_100415564
493 Ga0070708_100534832
494 Ga0070678_100092766
495 Ga0070662_100082656
496 Ga0070681_10001538
497 Ga0070681_10247772
498 Ga0070681_11865218
499 Ga0068867_100025033
500 Ga0068867_100119097
501 Ga0068867_100689201
502 Ga0068867_101084290
503 Ga0070707_101655604
504 Ga0070679_100063946
505 Ga0070679_100606072
506 Ga0070679_100653097
507 Ga0070679_101639026
508 Ga0070684_100019914
509 Ga0070684_100064821
510 Ga0070684_100315902
511 Ga0070684_100368960
512 Ga0070684_100756165
513 Ga0070684_101115668
514 Ga0068853_100050719
515 Ga0068853_100051627
516 Ga0068853_100491232
517 Ga0068853_101353138
518 Ga0070672_101178329
519 Ga0070686_100271566
520 Ga0070686_100991810
521 Ga0070693_100006486
522 Ga0070693_100107095
523 Ga0070693_100602357
524 Ga0070665_100047262
525 Ga0070665_100049775
526 Ga0070665_100499317
527 Ga0070665_101942014
528 Ga0068855_100008487
529 Ga0068855_100610259
530 Ga0068855_100710203
531 Ga0070664_100102394
532 Ga0070664_100353718
533 Ga0068857_100005030
534 Ga0068857_100006593
535 Ga0068857_100126871
536 Ga0068857_101326088
537 Ga0068856_100059396
538 Ga0068856_100197288
539 Ga0068856_100491840
540 Ga0070702_100184741
541 Ga0068852_101728433
542 Ga0068852_102784675
543 Ga0068859_100240082
544 Ga0068859_100977402
545 Ga0068859_101146734
546 Ga0068859_101782628
547 Ga0068859_102958830
548 Ga0068864_100011885
549 Ga0068864_100786836
550 Ga0068864_101259916
551 Ga0068864_101672953
552 Ga0068866_10027550
553 Ga0068863_100056253
554 Ga0068863_100437708
555 Ga0068863_100706556
556 Ga0068863_100854829
557 Ga0068863_100954478
558 Ga0068863_101851412
559 Ga0068858_100003289
560 Ga0068858_100011141
561 Ga0068858_100250355
562 Ga0068858_100736112
563 Ga0068858_101243509
564 Ga0068858_101567721
565 Ga0068860_100015158
566 Ga0068860_100017084
567 Ga0068860_100452090
568 Ga0068860_100673596
569 Ga0068860_101055051
570 Ga0068862_101772191
571 Ga0070717_10029192
572 Ga0070717_10044910
573 Ga0070717_10186385
574 Ga0070715_10535666
575 Ga0070712_100211429
576 Ga0097621_100010718
577 Ga0097621_100017674
578 Ga0097621_100019597
579 Ga0097621_100027721
580 Ga0097621_100050841
581 Ga0097621_100096620
582 Ga0097621_100241235
583 Ga0097621_102158551
584 Ga0068871_100004830
585 Ga0068871_100021445
586 Ga0068871_100029050
587 Ga0068871_100053438
588 Ga0068871_100097767
589 Ga0068871_100122081
590 Ga0068871_101667005
591 Ga0068871_102241923
592 Ga0068865_100081083
593 Ga0068865_100142368
594 Ga0068865_101456681
595 Ga0075436_100383640
596 Ga0097620_100240064
597 Ga0097620_100977435
598 Ga0097620_101146711
599 Ga0097620_101782554
600 Ga0097620_102958889
601 Ga0105240_10104780
602 Ga0105240_10288572
603 Ga0105240_10345740
604 Ga0105240_10632265
605 Ga0105240_10946973
606 Ga0105245_10000428
607 Ga0105245_10018200
608 Ga0105245_10036603
609 Ga0105245_10055879
610 Ga0105245_10077852
611 Ga0105245_10265663
612 Ga0105245_11125484
613 Ga0105245_12561801
614 Ga0105247_10018046
615 Ga0105247_10033479
616 Ga0105247_11544555
617 Ga0105243_10068085
618 Ga0105243_10634367
619 Ga0105243_10655267
620 Ga0105243_10730493
621 Ga0105243_11022946
622 Ga0105243_12833677
623 Ga0105243_13107241
624 Ga0105241_10012444
625 Ga0105241_10016966
626 Ga0105241_10025054
627 Ga0105241_10046584
628 Ga0105241_10061599
629 Ga0105241_10104087
630 Ga0105241_10964284
631 Ga0105241_11705543
632 Ga0105241_11815878
633 Ga0105241_12063259
634 Ga0105242_10005574
635 Ga0105242_10015555
636 Ga0105242_10019799
637 Ga0105242_10133958
638 Ga0105242_10158200
639 Ga0105242_10195327
640 Ga0105242_10558180
641 Ga0105242_10684600
642 Ga0105248_10013591
643 Ga0105248_10024050
644 Ga0105248_10025541
645 Ga0105248_10122249
646 Ga0105248_10128033
647 Ga0105248_10303714
648 Ga0105248_10341023
649 Ga0105248_10492816
650 Ga0105248_10662927
651 Ga0105248_11815476
652 Ga0105248_12107425
653 Ga0105237_10060041
654 Ga0105237_10234924
655 Ga0105237_10277500
656 Ga0105237_10519593
657 Ga0105237_11139464
658 Ga0105237_11168359
659 Ga0105237_12382047
660 Ga0105238_10017828
661 Ga0105238_10027230
662 Ga0105238_10048889
663 Ga0105238_10053463
664 Ga0105238_10358639
665 Ga0105238_10918986
666 Ga0105238_11187559
667 Ga0105249_10149813
668 Ga0105249_10961441
669 Ga0105249_11704220
670 Ga0105239_10006385
671 Ga0105239_10041270
672 Ga0105239_10065168
673 Ga0105239_10852692
674 Ga0105239_10875516
675 Ga0105239_11028010
676 Ga0105246_10003330
677 Ga0105246_10029548
678 Ga0105246_10062949
679 Ga0105246_10280159
680 Ga0105246_10984571
681 Ga0105246_11899521
682 Ga0157370_10048079
683 Ga0157370_10070729
684 Ga0157369_10057424
685 Ga0157369_12016229
686 Ga0157369_12394645
687 Ga0157374_10032469
688 Ga0157374_10082542
689 Ga0157374_10152592
690 Ga0157374_10447169
691 Ga0157374_10729091
692 Ga0157374_10885917
693 Ga0157378_10000890
694 Ga0157378_10065415
695 Ga0157378_10069881
696 Ga0157378_10208305
697 Ga0157378_10948669
698 Ga0157378_11089842
699 Ga0163162_10194847
700 Ga0163162_10617533
701 Ga0163162_11147415
702 Ga0163162_12525473
703 Ga0157372_10020899
704 Ga0157372_10108624
705 Ga0157372_11210102
706 Ga0157375_10005565
707 Ga0157375_10284538
708 Ga0157375_10668678
709 Ga0157375_10962090
710 Ga0157375_11521436
711 Ga0163163_10002043
712 Ga0163163_10008728
713 Ga0163163_10034807
714 Ga0163163_10042043
715 Ga0163163_10114256
716 Ga0163163_10369913
717 Ga0163163_10734174
718 Ga0157377_11422395
719 Ga0157379_10328340
720 Ga0157379_10363522
721 Ga0157379_10994322
722 Ga0157379_12176438
723 Ga0157379_12327439
724 Ga0157376_10033213
725 Ga0157376_10109356
726 Ga0157376_10714418
727 Ga0157376_11443042
728 Ga0157376_12339337
729 Ga0157376_12976507
730 Ga0206356_11502722
731 Ga0206350_11369935
732 Ga0206353_11685216
733 Ga0224712_10408127
734 Ga0207642_10856542
735 Ga0207642_10959902
736 Ga0207710_10030869
737 Ga0207710_10153400
738 Ga0207680_10392158
739 Ga0207680_10535844
740 Ga0207680_10571625
741 Ga0207699_10159928
742 Ga0207705_10056015
743 Ga0207654_10015019
744 Ga0207654_10042998
745 Ga0207654_10124146
746 Ga0207654_10376430
747 Ga0207654_10936312
748 Ga0207654_11043619
749 Ga0207707_10116141
750 Ga0207707_10119495
751 Ga0207707_11510319
752 Ga0207695_10269634
753 Ga0207695_10918956
754 Ga0207671_10058774
755 Ga0207671_10214163
756 Ga0207693_10207298
757 Ga0207663_10190566
758 Ga0207660_10134750
759 Ga0207657_10251529
760 Ga0207657_10369280
761 Ga0207649_10253092
762 Ga0207652_10250067
763 Ga0207652_10257683
764 Ga0207694_10011788
765 Ga0207694_10039983
766 Ga0207694_10060723
767 Ga0207694_10100188
768 Ga0207650_11562346
769 Ga0207687_10010590
770 Ga0207687_10021860
771 Ga0207687_10027609
772 Ga0207687_10385650
773 Ga0207687_10523992
774 Ga0207687_10841688
775 Ga0207687_10874397
776 Ga0207687_11843300
777 Ga0207700_10069690
778 Ga0207664_10008455
779 Ga0207644_10090772
780 Ga0207644_10180903
781 Ga0207690_10085572
782 Ga0207690_10549826
783 Ga0207706_10949455
784 Ga0207686_10015384
785 Ga0207686_10023520
786 Ga0207686_10070541
787 Ga0207686_10115435
788 Ga0207686_11109702
789 Ga0207709_10046378
790 Ga0207709_10056738
791 Ga0207709_10399872
792 Ga0207709_11008469
793 Ga0207669_11176866
794 Ga0207704_10323536
795 Ga0207704_10433439
796 Ga0207665_10751939
797 Ga0207711_10036812
798 Ga0207711_10039315
799 Ga0207711_10115197
800 Ga0207711_10520707
801 Ga0207711_10530930
802 Ga0207711_10531363
803 Ga0207711_11870007
804 Ga0207689_10034921
805 Ga0207689_10251469
806 Ga0207689_10281458
807 Ga0207689_10334134
808 Ga0207689_11386545
809 Ga0207661_10020080
810 Ga0207661_10056543
811 Ga0207679_10261892
812 Ga0207667_10072645
813 Ga0207667_10292492
814 Ga0207651_10420374
815 Ga0207651_11408874
816 Ga0207712_10264488
817 Ga0207712_12001616
818 Ga0207640_11450951
819 Ga0207658_10040125
820 Ga0207658_10157877
821 Ga0207658_10330485
822 Ga0207658_10730237
823 Ga0207677_10110968
824 Ga0207677_10153622
825 Ga0207677_10337925
826 Ga0207677_11397861
827 Ga0207703_10007739
828 Ga0207703_10081296
829 Ga0207703_10389200
830 Ga0207703_10686938
831 Ga0207639_10022573
832 Ga0207639_10028094
833 Ga0207639_10415465
834 Ga0207702_10572152
835 Ga0207641_10117109
836 Ga0207641_10284010
837 Ga0207641_10853865
838 Ga0207641_10865560
839 Ga0207648_10051195
840 Ga0207648_11079530
841 Ga0207676_10175663
842 Ga0207676_10784619
843 Ga0207676_11212156
844 Ga0207674_10002339
845 Ga0207674_10008934
846 Ga0207674_10084573
847 Ga0207683_10080620
848 Ga0207698_12369621
849 Ga0268266_10003783
850 Ga0268266_10155191
851 Ga0268266_10559141
852 Ga0268266_11112144
853 Ga0268265_11566890
854 Ga0268264_10004756
855 Ga0268264_10346284
856 Ga0265338_10086063
857 Ga0265338_10164739
858 Ga0265338_10969512
859 Ga0265760_10083159
860 Ga0265320_10503863
861 Ga0265325_10070817
862 Ga0265331_10336718
863 Ga0265331_10558823
864 Ga0265316_10283222
865 Ga0265316_11298194
866 Ga0265313_10002335
867 Ga0265313_10218923
868 Ga0265314_10085767
869 Ga0265342_10048061
870 Ga0373934_0259873
871 Ga0373934_0502356
872 Ga0373957_0058067
873 Ga0373960_0224922
874 Ga0373943_0492007
875 Ga0373943_0752702
876 Ga0373955_0457277
877 Ga0373931_0166755
878 Ga0373935_1218598
879 Ga0373933_0022308
880 Ga0373933_0041522
881 Ga0373937_0023089
882 Ga0373937_0036105
883 Ga0373937_0300106
884 Ga0265778_042670
885 Ga0265778_057026
886 Ga0451577_0253639
887 Ga0451577_1374624
888 Ga0453684_1565181
889 Ga0495582_0410189
890 Ga0495624_0624307
891 Ga0495674_0989954
892 Ga0495675_0207795
893 Ga0495675_0285084
894 Ga0495684_0958017
895 Ga0496112_0180361
896 nmdc:mga08x19_1164882_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hdi-assembly1.cif.gz_B crystal structure of the colicin i receptor cir from e.coli in complex with receptor binding domain of colicin ia. 0.5663 19 45
7qru-assembly1.cif.gz_B structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.566 5 68
2zdi-assembly1.cif.gz_B-2 crystal structure of prefoldin from pyrococcus horikoshii ot3 0.5603 2 68
2zqm-assembly1.cif.gz_A crystal structure of the prefoldin beta subunit from thermococcus strain ks-1 0.5548 2 68
8esw-assembly1.cif.gz_5 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.5515 3 68
ID Description Score Start End Superfamily
af_Q8BPZ8_3_169_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.729 20 42 3.40.140.10
af_K7MPA3_17_177_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.6874 20 45 1.25.40.20
af_Q4DCC1_415_704_1.10.840.10 Mainly Alpha;Orthogonal Bundle;Son of Sevenless (SoS) protein; Chain S, domain 2;Ras guanine-nucleotide exchange factors catalytic domain 0.6427 22 61 1.10.840.10
af_Q19007_108_291_3.30.1120.90 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;Nucleosome assembly protein 0.6269 22 46 3.30.1120.90
af_C6SW11_8_117_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5917 2 68 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A5J5IBM8-F1-model_v4 DUF3185 family protein 0.7287 1 69 GO:0016020
AF-A0A832WUF2-F1-model_v4 Uncharacterized protein 0.7206 2 68 GO:0016020
AF-A0A832WUF2-F1-model_v4 Uncharacterized protein 0.6959 2 68 GO:0016020
AF-A0A2U9IIH4-F1-model_v4 Uncharacterized protein 0.6442 1 68 GO:0016020
AF-A0A3R6W400-F1-model_v4 RNA polymerase subunit sigma-70 0.6426 2 68

Map