F445493

General Info

Members Datasets Scaffolds Average Seq Length
445 186 890 149

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10281019|Ga0105248_102810192
Length 168
Sequence LVDHAFTGEWRVPLDERRMTGDEIYMRRAIFLAAEAEQAGEIPVGAVLVVGDRLLGEGCNSPIASNDPTAHAEMIALRAAAQAAGNYRLEAATLYVTLEPCVMCAGALVAARIRRLVFGARDLRFGGVRSKFRLADSELLNHRVEIVEGVLAAECTQLLQRFFESRRK

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.9
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10281019 3300009177 Bacteria 1874
2 Ga0070658_10254830 3300005327 Bacteria 1489
3 Ga0070658_10705230 3300005327 Bacteria 876
4 Ga0070683_100010896 3300005329 Bacteria 7827
5 Ga0070683_100011675 3300005329 Bacteria 7606
6 Ga0070683_100019099 3300005329 Bacteria 6082
7 Ga0070683_100262692 3300005329 Bacteria 1642
8 Ga0070683_100715547 3300005329 Bacteria 959
9 Ga0070670_100198448 3300005331 Bacteria 1743
10 Ga0068869_100256651 3300005334 Bacteria 1398
11 Ga0068869_101222271 3300005334 Bacteria 661
12 Ga0070666_10354521 3300005335 Bacteria 1050
13 Ga0070666_10864605 3300005335 Bacteria 668
14 Ga0070680_100007980 3300005336 Bacteria 8082
15 Ga0070682_100886794 3300005337 Bacteria 732
16 Ga0068868_100023870 3300005338 Bacteria 4633
17 Ga0068868_100157606 3300005338 Bacteria 1873
18 Ga0068868_100603736 3300005338 Bacteria 973
19 Ga0068868_102240663 3300005338 Bacteria 521
20 Ga0070660_100087901 3300005339 Bacteria 2446
21 Ga0070660_100439261 3300005339 Bacteria 1082
22 Ga0070691_10148395 3300005341 Bacteria 1200
23 Ga0070687_100172699 3300005343 Bacteria 1288
24 Ga0070661_100723693 3300005344 Bacteria 812
25 Ga0070661_101027529 3300005344 Bacteria 684
26 Ga0070673_100048246 3300005364 Bacteria 3319
27 Ga0070673_100828801 3300005364 Bacteria 855
28 Ga0070659_100076234 3300005366 Bacteria 2674
29 Ga0070659_100234668 3300005366 Bacteria 1516
30 Ga0070709_10030560 3300005434 Bacteria 3233
31 Ga0070714_100002328 3300005435 Bacteria 13968
32 Ga0070713_100015304 3300005436 Bacteria 5727
33 Ga0070713_100105392 3300005436 Bacteria 2449
34 Ga0070701_10132068 3300005438 Bacteria 1419
35 Ga0070701_10806313 3300005438 Bacteria 641
36 Ga0070711_100095185 3300005439 Bacteria 2155
37 Ga0070711_100267287 3300005439 Unclassified 1348
38 Ga0070662_100212393 3300005457 Bacteria 1540
39 Ga0070662_100742072 3300005457 Bacteria 832
40 Ga0070681_10001630 3300005458 Bacteria 20007
41 Ga0070681_10106549 3300005458 Bacteria 2744
42 Ga0070681_10220501 3300005458 Bacteria 1812
43 Ga0070681_10359517 3300005458 Bacteria 1366
44 Ga0070681_10479972 3300005458 Bacteria 1156
45 Ga0068867_100053615 3300005459 Bacteria 2979
46 Ga0068867_100136966 3300005459 Bacteria 1910
47 Ga0068867_102097299 3300005459 Bacteria 535
48 Ga0070685_10001743 3300005466 Bacteria 11404
49 Ga0070679_100001659 3300005530 Bacteria 20069
50 Ga0070684_100002002 3300005535 Bacteria 14988
51 Ga0070684_100009887 3300005535 Bacteria 7537
52 Ga0070684_100089225 3300005535 Bacteria 2740
53 Ga0070684_100480394 3300005535 Bacteria 1150
54 Ga0070697_100191837 3300005536 Bacteria 1734
55 Ga0068853_100089560 3300005539 Bacteria 2703
56 Ga0068853_100145488 3300005539 Bacteria 2130
57 Ga0068853_100411523 3300005539 Bacteria 1267
58 Ga0068853_100677129 3300005539 Bacteria 983
59 Ga0068853_101006920 3300005539 Bacteria 802
60 Ga0070686_100143989 3300005544 Bacteria 1662
61 Ga0070696_100004095 3300005546 Bacteria 9718
62 Ga0070693_100095922 3300005547 Bacteria 1797
63 Ga0070693_100103463 3300005547 Bacteria 1739
64 Ga0070665_100112408 3300005548 Bacteria 2726
65 Ga0070665_100182021 3300005548 Bacteria 2102
66 Ga0070665_100350967 3300005548 Bacteria 1481
67 Ga0070665_101233429 3300005548 Bacteria 758
68 Ga0070704_100995929 3300005549 Bacteria 758
69 Ga0068855_100007910 3300005563 Bacteria 12845
70 Ga0068855_100047175 3300005563 Bacteria 5090
71 Ga0068855_100171725 3300005563 Bacteria 2455
72 Ga0068855_100250581 3300005563 Bacteria 1975
73 Ga0068855_100281032 3300005563 Bacteria 1848
74 Ga0068855_100557567 3300005563 Bacteria 1240
75 Ga0068855_100932373 3300005563 Bacteria 916
76 Ga0070664_100116911 3300005564 Bacteria 2332
77 Ga0070664_100453062 3300005564 Bacteria 1178
78 Ga0070664_100579250 3300005564 Bacteria 1040
79 Ga0068857_100016483 3300005577 Bacteria 6474
80 Ga0068857_100021596 3300005577 Bacteria 5664
81 Ga0068857_100026821 3300005577 Bacteria 5080
82 Ga0068857_100458768 3300005577 Bacteria 1192
83 Ga0068857_101096796 3300005577 Bacteria 768
84 Ga0068854_100661044 3300005578 Bacteria 898
85 Ga0068856_100020534 3300005614 Bacteria 6415
86 Ga0068856_100069511 3300005614 Bacteria 3482
87 Ga0068856_100680940 3300005614 Bacteria 1049
88 Ga0070702_101312505 3300005615 Bacteria 588
89 Ga0068852_100002302 3300005616 Bacteria 13139
90 Ga0068852_100294030 3300005616 Bacteria 1570
91 Ga0068852_100474482 3300005616 Bacteria 1242
92 Ga0068852_101941284 3300005616 Bacteria 611
93 Ga0068859_100300074 3300005617 Unclassified 1700
94 Ga0068864_100030606 3300005618 Bacteria 4563
95 Ga0068864_100414412 3300005618 Bacteria 1282
96 Ga0068864_100770400 3300005618 Bacteria 944
97 Ga0068864_102003941 3300005618 Bacteria 585
98 Ga0068866_10478717 3300005718 Bacteria 820
99 Ga0068851_10504093 3300005834 Bacteria 726
100 Ga0068863_100178624 3300005841 Bacteria 2038
101 Ga0068863_100215846 3300005841 Bacteria 1847
102 Ga0068863_100690987 3300005841 Bacteria 1014
103 Ga0068858_100009638 3300005842 Bacteria 9205
104 Ga0068858_100045514 3300005842 Bacteria 4067
105 Ga0068858_100050816 3300005842 Bacteria 3836
106 Ga0068858_101790507 3300005842 Bacteria 607
107 Ga0068860_100109467 3300005843 Unclassified 2640
108 Ga0068860_100591983 3300005843 Bacteria 1114
109 Ga0068860_101369642 3300005843 Bacteria 729
110 Ga0070717_10017545 3300006028 Bacteria 5573
111 Ga0070717_10066446 3300006028 Bacteria 2999
112 Ga0070712_100328217 3300006175 Bacteria 1246
113 Ga0097621_100016318 3300006237 Bacteria 5610
114 Ga0097621_100038653 3300006237 Bacteria 3830
115 Ga0097621_100117990 3300006237 Bacteria 2249
116 Ga0097621_100186242 3300006237 Bacteria 1796
117 Ga0097621_100327685 3300006237 Unclassified 1358
118 Ga0068871_100013445 3300006358 Bacteria 6077
119 Ga0068871_100036310 3300006358 Bacteria 3923
120 Ga0068871_100103536 3300006358 Bacteria 2387
121 Ga0068871_100154670 3300006358 Bacteria 1958
122 Ga0068871_100743272 3300006358 Bacteria 901
123 Ga0068871_100870665 3300006358 Bacteria 834
124 Ga0068865_100013498 3300006881 Bacteria 5163
125 Ga0068865_100120203 3300006881 Bacteria 1952
126 Ga0097620_100300083 3300006931 Unclassified 1700
127 Ga0105240_10000894 3300009093 Bacteria 53314
128 Ga0105240_10001454 3300009093 Bacteria 40497
129 Ga0105240_10032577 3300009093 Bacteria 6747
130 Ga0105240_10383974 3300009093 Bacteria 1585
131 Ga0105240_10490280 3300009093 Bacteria 1368
132 Ga0105240_10572402 3300009093 Bacteria 1247
133 Ga0105245_10005203 3300009098 Bacteria 11424
134 Ga0105245_10013697 3300009098 Bacteria 7064
135 Ga0105245_10016346 3300009098 Bacteria 6471
136 Ga0105245_10062802 3300009098 Bacteria 3352
137 Ga0105245_10132677 3300009098 Unclassified 2338
138 Ga0105245_10256414 3300009098 Bacteria 1701
139 Ga0105245_10690962 3300009098 Unclassified 1053
140 Ga0105243_10084084 3300009148 Unclassified 2605
141 Ga0105243_10618074 3300009148 Bacteria 1045
142 Ga0105243_10798530 3300009148 Bacteria 930
143 Ga0105241_10023388 3300009174 Bacteria 4583
144 Ga0105241_10087446 3300009174 Bacteria 2453
145 Ga0105241_10459640 3300009174 Bacteria 1128
146 Ga0105241_10494601 3300009174 Bacteria 1089
147 Ga0105241_10690192 3300009174 Bacteria 931
148 Ga0105241_10963408 3300009174 Bacteria 796
149 Ga0105242_10008498 3300009176 Bacteria 7885
150 Ga0105242_10184029 3300009176 Bacteria 1845
151 Ga0105242_10216463 3300009176 Bacteria 1709
152 Ga0105242_10275330 3300009176 Bacteria 1526
153 Ga0105242_10284189 3300009176 Bacteria 1504
154 Ga0105242_11069103 3300009176 Unclassified 819
155 Ga0105242_11654691 3300009176 Bacteria 675
156 Ga0105248_10006805 3300009177 Bacteria 12531
157 Ga0105248_10017627 3300009177 Bacteria 7877
158 Ga0105248_10032270 3300009177 Bacteria 5855
159 Ga0105248_10111507 3300009177 Bacteria 3085
160 Ga0105248_10435979 3300009177 Bacteria 1476
161 Ga0105248_10676280 3300009177 Bacteria 1165
162 Ga0105248_10878448 3300009177 Bacteria 1012
163 Ga0105237_10025667 3300009545 Bacteria 6024
164 Ga0105237_10059623 3300009545 Bacteria 3818
165 Ga0105237_10131612 3300009545 Bacteria 2496
166 Ga0105237_10597102 3300009545 Bacteria 1111
167 Ga0105237_10616049 3300009545 Bacteria 1092
168 Ga0105237_11548075 3300009545 Unclassified 670
169 Ga0105238_10010809 3300009551 Bacteria 9172
170 Ga0105238_10011328 3300009551 Bacteria 8972
171 Ga0105238_10012826 3300009551 Bacteria 8455
172 Ga0105238_10015631 3300009551 Bacteria 7681
173 Ga0105238_10037663 3300009551 Bacteria 4916
174 Ga0105238_10051921 3300009551 Bacteria 4123
175 Ga0105238_10440097 3300009551 Bacteria 1300
176 Ga0105249_10031590 3300009553 Bacteria 4789
177 Ga0105249_10452372 3300009553 Bacteria 1323
178 Ga0105239_10004288 3300010375 Bacteria 17105
179 Ga0105239_10030157 3300010375 Bacteria 5963
180 Ga0105239_10055413 3300010375 Bacteria 4348
181 Ga0105239_10072657 3300010375 Bacteria 3782
182 Ga0105239_10133647 3300010375 Bacteria 2761
183 Ga0105239_10505333 3300010375 Bacteria 1374
184 Ga0105246_10011152 3300011119 Bacteria 5572
185 Ga0105246_10035013 3300011119 Bacteria 3352
186 Ga0157370_10049265 3300013104 Bacteria 4032
187 Ga0157370_10101540 3300013104 Bacteria 2694
188 Ga0157369_10004427 3300013105 Bacteria 16588
189 Ga0157369_10015903 3300013105 Bacteria 8472
190 Ga0157369_10333469 3300013105 Bacteria 1576
191 Ga0157374_10002548 3300013296 Bacteria 15366
192 Ga0157374_10248488 3300013296 Bacteria 1750
193 Ga0157374_10402751 3300013296 Bacteria 1365
194 Ga0157378_10043503 3300013297 Bacteria 3988
195 Ga0157378_11000157 3300013297 Bacteria 870
196 Ga0163162_10036642 3300013306 Bacteria 4891
197 Ga0163162_10107809 3300013306 Bacteria 2881
198 Ga0163162_10276813 3300013306 Bacteria 1810
199 Ga0163162_10407650 3300013306 Bacteria 1492
200 Ga0157372_10006626 3300013307 Bacteria 12328
201 Ga0157372_10022237 3300013307 Bacteria 6861
202 Ga0157372_10038602 3300013307 Bacteria 5270
203 Ga0157372_10040623 3300013307 Bacteria 5139
204 Ga0157372_10471308 3300013307 Bacteria 1464
205 Ga0157375_10281194 3300013308 Bacteria 1827
206 Ga0157375_10541643 3300013308 Bacteria 1326
207 Ga0157375_10872009 3300013308 Unclassified 1045
208 Ga0163163_10005777 3300014325 Bacteria 10750
209 Ga0163163_10097408 3300014325 Bacteria 2961
210 Ga0163163_10124915 3300014325 Bacteria 2610
211 Ga0163163_10134150 3300014325 Bacteria 2516
212 Ga0163163_10530309 3300014325 Unclassified 1240
213 Ga0163163_10854433 3300014325 Bacteria 973
214 Ga0163163_11278774 3300014325 Bacteria 796
215 Ga0157379_10069655 3300014968 Bacteria 3146
216 Ga0157379_10442657 3300014968 Bacteria 1198
217 Ga0157379_11161948 3300014968 Bacteria 741
218 Ga0157376_10041268 3300014969 Bacteria 3777
219 Ga0157376_10100585 3300014969 Bacteria 2525
220 Ga0157376_10582950 3300014969 Bacteria 1111
221 Ga0157376_10622590 3300014969 Bacteria 1077
222 Ga0157376_11497811 3300014969 Bacteria 708
223 Ga0213876_10387275 3300021384 Bacteria 743
224 Ga0213875_10028521 3300021388 Bacteria 2650
225 Ga0213875_10034739 3300021388 Bacteria 2380
226 Ga0213875_10052681 3300021388 Bacteria 1906
227 Ga0213875_10403466 3300021388 Bacteria 652
228 Ga0207680_10314980 3300025903 Bacteria 1093
229 Ga0207699_10095025 3300025906 Bacteria 1879
230 Ga0207645_10393404 3300025907 Bacteria 931
231 Ga0207645_10500143 3300025907 Bacteria 823
232 Ga0207684_10627743 3300025910 Bacteria 916
233 Ga0207654_10010429 3300025911 Bacteria 4731
234 Ga0207654_10053617 3300025911 Bacteria 2328
235 Ga0207654_10062171 3300025911 Bacteria 2186
236 Ga0207707_10001605 3300025912 Bacteria 20849
237 Ga0207707_10247718 3300025912 Bacteria 1548
238 Ga0207707_10299372 3300025912 Bacteria 1391
239 Ga0207707_10450739 3300025912 Bacteria 1101
240 Ga0207695_10000504 3300025913 Bacteria 83019
241 Ga0207695_10001887 3300025913 Bacteria 32776
242 Ga0207695_10030536 3300025913 Bacteria 5931
243 Ga0207695_10272024 3300025913 Bacteria 1589
244 Ga0207671_10182655 3300025914 Bacteria 1633
245 Ga0207671_10575797 3300025914 Bacteria 898
246 Ga0207671_10863683 3300025914 Bacteria 716
247 Ga0207693_10311209 3300025915 Bacteria 1233
248 Ga0207663_10057971 3300025916 Bacteria 2442
249 Ga0207660_10012191 3300025917 Bacteria 5618
250 Ga0207657_10042002 3300025919 Bacteria 4038
251 Ga0207657_10339467 3300025919 Bacteria 1186
252 Ga0207657_10619355 3300025919 Bacteria 844
253 Ga0207649_10348266 3300025920 Bacteria 1096
254 Ga0207649_10856757 3300025920 Bacteria 711
255 Ga0207652_10002681 3300025921 Bacteria 14932
256 Ga0207694_10000543 3300025924 Bacteria 34172
257 Ga0207694_10011842 3300025924 Bacteria 6578
258 Ga0207694_10068338 3300025924 Bacteria 2774
259 Ga0207694_10082276 3300025924 Bacteria 2530
260 Ga0207694_10164172 3300025924 Bacteria 1795
261 Ga0207694_10305993 3300025924 Bacteria 1309
262 Ga0207694_10428642 3300025924 Bacteria 1102
263 Ga0207650_10150373 3300025925 Bacteria 1837
264 Ga0207687_10000735 3300025927 Bacteria 22239
265 Ga0207687_10003243 3300025927 Bacteria 11020
266 Ga0207687_10027667 3300025927 Bacteria 3806
267 Ga0207687_10076474 3300025927 Bacteria 2405
268 Ga0207687_10410926 3300025927 Bacteria 1115
269 Ga0207687_10547008 3300025927 Unclassified 971
270 Ga0207700_10001943 3300025928 Bacteria 11761
271 Ga0207700_10152850 3300025928 Bacteria 1909
272 Ga0207664_10003712 3300025929 Bacteria 10241
273 Ga0207690_10113277 3300025932 Bacteria 1957
274 Ga0207706_10888056 3300025933 Bacteria 753
275 Ga0207686_10005836 3300025934 Bacteria 6604
276 Ga0207686_10043790 3300025934 Bacteria 2745
277 Ga0207686_10049263 3300025934 Bacteria 2614
278 Ga0207686_10060564 3300025934 Bacteria 2396
279 Ga0207686_10101773 3300025934 Bacteria 1920
280 Ga0207686_10134345 3300025934 Bacteria 1701
281 Ga0207686_10728912 3300025934 Bacteria 790
282 Ga0207686_11170539 3300025934 Bacteria 629
283 Ga0207709_10373144 3300025935 Unclassified 1083
284 Ga0207704_10106292 3300025938 Bacteria 1885
285 Ga0207704_10204369 3300025938 Bacteria 1448
286 Ga0207711_10029318 3300025941 Bacteria 4641
287 Ga0207711_10095015 3300025941 Bacteria 2628
288 Ga0207711_10205558 3300025941 Bacteria 1798
289 Ga0207711_10253825 3300025941 Bacteria 1615
290 Ga0207711_10854886 3300025941 Bacteria 846
291 Ga0207689_10280808 3300025942 Bacteria 1379
292 Ga0207661_10002231 3300025944 Bacteria 13365
293 Ga0207661_10026056 3300025944 Bacteria 4451
294 Ga0207661_10591309 3300025944 Bacteria 1018
295 Ga0207679_10386659 3300025945 Bacteria 1228
296 Ga0207679_10724477 3300025945 Bacteria 904
297 Ga0207667_10000179 3300025949 Bacteria 92219
298 Ga0207667_10003013 3300025949 Bacteria 20887
299 Ga0207667_10051200 3300025949 Bacteria 4354
300 Ga0207667_10143096 3300025949 Bacteria 2462
301 Ga0207667_10196863 3300025949 Bacteria 2067
302 Ga0207667_11285717 3300025949 Bacteria 708
303 Ga0207651_10204190 3300025960 Bacteria 1586
304 Ga0207712_10038998 3300025961 Bacteria 3252
305 Ga0207712_10039543 3300025961 Bacteria 3232
306 Ga0207712_10292425 3300025961 Unclassified 1334
307 Ga0207640_10530051 3300025981 Bacteria 986
308 Ga0207658_10558121 3300025986 Bacteria 1025
309 Ga0207677_10015414 3300026023 Bacteria 4495
310 Ga0207677_10323851 3300026023 Bacteria 1282
311 Ga0207677_10406007 3300026023 Unclassified 1156
312 Ga0207677_11976600 3300026023 Bacteria 542
313 Ga0207703_10076074 3300026035 Bacteria 2784
314 Ga0207703_10206270 3300026035 Bacteria 1749
315 Ga0207703_10223270 3300026035 Bacteria 1686
316 Ga0207703_10330760 3300026035 Bacteria 1398
317 Ga0207703_11298809 3300026035 Bacteria 700
318 Ga0207703_11688085 3300026035 Bacteria 609
319 Ga0207703_12161010 3300026035 Bacteria 533
320 Ga0207639_10132315 3300026041 Bacteria 2067
321 Ga0207639_10509096 3300026041 Bacteria 1101
322 Ga0207639_10869091 3300026041 Bacteria 842
323 Ga0207702_10022379 3300026078 Bacteria 5240
324 Ga0207702_10027515 3300026078 Bacteria 4722
325 Ga0207702_10195109 3300026078 Bacteria 1874
326 Ga0207702_10783312 3300026078 Bacteria 942
327 Ga0207641_10140816 3300026088 Bacteria 2176
328 Ga0207641_10340169 3300026088 Bacteria 1428
329 Ga0207648_10034027 3300026089 Bacteria 4494
330 Ga0207648_10043398 3300026089 Bacteria 3947
331 Ga0207648_10178048 3300026089 Bacteria 1881
332 Ga0207676_10297556 3300026095 Bacteria 1472
333 Ga0207676_10413385 3300026095 Bacteria 1263
334 Ga0207676_11955053 3300026095 Bacteria 585
335 Ga0207674_10000936 3300026116 Bacteria 38032
336 Ga0207674_10003148 3300026116 Bacteria 20339
337 Ga0207674_10008621 3300026116 Bacteria 11754
338 Ga0207674_10027161 3300026116 Bacteria 6062
339 Ga0207674_10052451 3300026116 Bacteria 4160
340 Ga0207674_10418659 3300026116 Bacteria 1294
341 Ga0207674_10573180 3300026116 Bacteria 1090
342 Ga0207674_10817701 3300026116 Bacteria 899
343 Ga0207698_10212356 3300026142 Bacteria 1742
344 Ga0207698_10541060 3300026142 Bacteria 1140
345 Ga0207698_10791491 3300026142 Bacteria 950
346 Ga0268266_10056462 3300028379 Bacteria 3378
347 Ga0268266_10173853 3300028379 Bacteria 1956
348 Ga0268266_11042096 3300028379 Bacteria 792
349 Ga0268264_10059337 3300028381 Bacteria 3205
350 Ga0268264_10083513 3300028381 Unclassified 2736
351 Ga0268264_10472977 3300028381 Bacteria 1218
352 Ga0268264_10633451 3300028381 Bacteria 1057
353 Ga0268264_10943088 3300028381 Bacteria 868
354 Ga0265338_10109498 3300028800 Bacteria 2229
355 Ga0265338_10329822 3300028800 Unclassified 1102
356 Ga0265332_10160587 3300031238 Bacteria 939
357 Ga0265325_10063735 3300031241 Bacteria 1864
358 Ga0265339_10243803 3300031249 Bacteria 872
359 Ga0265316_10285652 3300031344 Bacteria 1205
360 Ga0265316_10336038 3300031344 Bacteria 1095
361 Ga0265313_10003265 3300031595 Bacteria 13319
362 Ga0265313_10060416 3300031595 Bacteria 1778
363 Ga0265313_10197910 3300031595 Bacteria 837
364 Ga0265314_10022206 3300031711 Bacteria 4863
365 Ga0265314_10135608 3300031711 Unclassified 1529
366 Ga0307416_100573250 3300032002 Bacteria 1205
367 Ga0307414_10539304 3300032004 Bacteria 1038
368 Ga0307411_10294327 3300032005 Bacteria 1299
369 Ga0373923_0067870 3300035111 Bacteria 1526
370 Ga0373954_0002555 3300035118 Bacteria 7646
371 Ga0373957_0047612 3300035120 Bacteria 1631
372 Ga0373943_0153477 3300035170 Bacteria 1249
373 Ga0373955_0252868 3300035172 Bacteria 1057
374 Ga0373931_0158840 3300035691 Bacteria 1324
375 Ga0373935_0388464 3300035692 Bacteria 1000
376 Ga0373927_0003509 3300035695 Bacteria 11223
377 Ga0373927_0107382 3300035695 Bacteria 1818
378 Ga0373933_0009630 3300035724 Bacteria 5278
379 Ga0373947_0109516 3300035725 Bacteria 1744
380 Ga0373947_0920822 3300035725 Bacteria 597
381 Ga0373937_0023353 3300036401 Bacteria 5568
382 Ga0373937_0028055 3300036401 Bacteria 5093
383 Ga0373937_0263432 3300036401 Unclassified 1626
384 Ga0373937_1826330 3300036401 Bacteria 554
385 Ga0316582_0335397 3300036647 Bacteria 1040
386 Ga0373925_0802050 3300037068 Bacteria 776
387 Ga0436364_0329470 3300037853 Unclassified 1205
388 Ga0436364_0637670 3300037853 Bacteria 3451
389 Ga0436364_1104266 3300037853 Bacteria 652
390 Ga0436364_1294560 3300037853 Bacteria 5517
391 Ga0436364_1380562 3300037853 Bacteria 7082
392 Ga0400489_45164 3300039093 Bacteria 22711
393 Ga0436365_0708725 3300039437 Bacteria 939
394 Ga0436363_0461936 3300039450 Bacteria 2073
395 Ga0436362_0040227 3300039453 Bacteria 1321
396 Ga0436362_0532889 3300039453 Bacteria 587
397 Ga0439448_0377055 3300042005 Bacteria 507
398 Ga0466971_0640371 3300044719 Bacteria 532
399 Ga0466957_0365509 3300044842 Bacteria 981
400 Ga0466959_0350472 3300045049 Bacteria 1007
401 Ga0495592_0590137 3300046454 Bacteria 679
402 Ga0495653_0069279 3300046463 Bacteria 2644
403 Ga0495580_0113315 3300046472 Bacteria 1884
404 Ga0495594_0091894 3300046499 Bacteria 1701
405 Ga0495608_0222162 3300046511 Bacteria 1185
406 Ga0495666_0068067 3300046526 Bacteria 1696
407 Ga0495657_0316583 3300046675 Bacteria 928
408 Ga0495623_0142399 3300046679 Bacteria 1425
409 Ga0495669_0129322 3300046684 Bacteria 1188
410 Ga0495636_0039672 3300047318 Bacteria 1951
411 Ga0495636_0333211 3300047318 Bacteria 714
412 Ga0495674_0655147 3300047319 Unclassified 828
413 Ga0495675_0067007 3300047444 Bacteria 2269
414 Ga0495675_0108414 3300047444 Bacteria 1735
415 Ga0495675_0402055 3300047444 Bacteria 798
416 Ga0495684_0275108 3300047471 Bacteria 1217
417 Ga0495602_0489917 3300048088 Bacteria 861
418 Ga0496108_0287010 3300048911 Unclassified 1433
419 Ga0496110_0640145 3300048913 Bacteria 963
420 Ga0496112_0243562 3300048915 Bacteria 1750
421 Ga0496114_1640725 3300048917 Unclassified 531
422 Ga0501032_0066131 3300049569 Bacteria 2416
423 Ga0501032_0106733 3300049569 Bacteria 1855
424 Ga0501033_0032630 3300049570 Bacteria 3911
425 Ga0501033_0082911 3300049570 Bacteria 2351
426 Ga0501034_0304844 3300049571 Bacteria 1528
427 Ga0501034_0948881 3300049571 Bacteria 746
428 Ga0501037_0042945 3300049573 Bacteria 3322
429 Ga0501038_0099060 3300049574 Bacteria 2430
430 Ga0501038_0504414 3300049574 Bacteria 925
431 Ga0501039_1238776 3300049575 Bacteria 576
432 Ga0501042_0538011 3300049578 Bacteria 849
433 Ga0501043_0038354 3300049579 Bacteria 3767
434 Ga0501046_0010000 3300049580 Bacteria 8171
435 Ga0501047_0000670 3300049581 Bacteria 35678
436 Ga0501047_0276860 3300049581 Bacteria 1523
437 Ga0501035_0011267 3300049822 Bacteria 8284
438 Ga0501044_0000456 3300049823 Bacteria 49762
439 Ga0501044_0032738 3300049823 Bacteria 5464
440 Ga0501045_0725767 3300049824 Bacteria 733
441 nmdc:mga06r32_1077366_c1 3300050510 Bacteria 753
442 nmdc:mga06r32_252762_c1 3300050510 Unclassified 1750
443 Ga0495601_0100497 3300053077 Bacteria 1868
444 Ga0500568_0001334 3300053139 Bacteria 16171
445 Ga0500616_0100286 3300053153 Bacteria 1417
446 Ga0105248_10281019
447 Ga0070658_10254830
448 Ga0070658_10705230
449 Ga0070683_100010896
450 Ga0070683_100011675
451 Ga0070683_100019099
452 Ga0070683_100262692
453 Ga0070683_100715547
454 Ga0070670_100198448
455 Ga0068869_100256651
456 Ga0068869_101222271
457 Ga0070666_10354521
458 Ga0070666_10864605
459 Ga0070680_100007980
460 Ga0070682_100886794
461 Ga0068868_100023870
462 Ga0068868_100157606
463 Ga0068868_100603736
464 Ga0068868_102240663
465 Ga0070660_100087901
466 Ga0070660_100439261
467 Ga0070691_10148395
468 Ga0070687_100172699
469 Ga0070661_100723693
470 Ga0070661_101027529
471 Ga0070673_100048246
472 Ga0070673_100828801
473 Ga0070659_100076234
474 Ga0070659_100234668
475 Ga0070709_10030560
476 Ga0070714_100002328
477 Ga0070713_100015304
478 Ga0070713_100105392
479 Ga0070701_10132068
480 Ga0070701_10806313
481 Ga0070711_100095185
482 Ga0070711_100267287
483 Ga0070662_100212393
484 Ga0070662_100742072
485 Ga0070681_10001630
486 Ga0070681_10106549
487 Ga0070681_10220501
488 Ga0070681_10359517
489 Ga0070681_10479972
490 Ga0068867_100053615
491 Ga0068867_100136966
492 Ga0068867_102097299
493 Ga0070685_10001743
494 Ga0070679_100001659
495 Ga0070684_100002002
496 Ga0070684_100009887
497 Ga0070684_100089225
498 Ga0070684_100480394
499 Ga0070697_100191837
500 Ga0068853_100089560
501 Ga0068853_100145488
502 Ga0068853_100411523
503 Ga0068853_100677129
504 Ga0068853_101006920
505 Ga0070686_100143989
506 Ga0070696_100004095
507 Ga0070693_100095922
508 Ga0070693_100103463
509 Ga0070665_100112408
510 Ga0070665_100182021
511 Ga0070665_100350967
512 Ga0070665_101233429
513 Ga0070704_100995929
514 Ga0068855_100007910
515 Ga0068855_100047175
516 Ga0068855_100171725
517 Ga0068855_100250581
518 Ga0068855_100281032
519 Ga0068855_100557567
520 Ga0068855_100932373
521 Ga0070664_100116911
522 Ga0070664_100453062
523 Ga0070664_100579250
524 Ga0068857_100016483
525 Ga0068857_100021596
526 Ga0068857_100026821
527 Ga0068857_100458768
528 Ga0068857_101096796
529 Ga0068854_100661044
530 Ga0068856_100020534
531 Ga0068856_100069511
532 Ga0068856_100680940
533 Ga0070702_101312505
534 Ga0068852_100002302
535 Ga0068852_100294030
536 Ga0068852_100474482
537 Ga0068852_101941284
538 Ga0068859_100300074
539 Ga0068864_100030606
540 Ga0068864_100414412
541 Ga0068864_100770400
542 Ga0068864_102003941
543 Ga0068866_10478717
544 Ga0068851_10504093
545 Ga0068863_100178624
546 Ga0068863_100215846
547 Ga0068863_100690987
548 Ga0068858_100009638
549 Ga0068858_100045514
550 Ga0068858_100050816
551 Ga0068858_101790507
552 Ga0068860_100109467
553 Ga0068860_100591983
554 Ga0068860_101369642
555 Ga0070717_10017545
556 Ga0070717_10066446
557 Ga0070712_100328217
558 Ga0097621_100016318
559 Ga0097621_100038653
560 Ga0097621_100117990
561 Ga0097621_100186242
562 Ga0097621_100327685
563 Ga0068871_100013445
564 Ga0068871_100036310
565 Ga0068871_100103536
566 Ga0068871_100154670
567 Ga0068871_100743272
568 Ga0068871_100870665
569 Ga0068865_100013498
570 Ga0068865_100120203
571 Ga0097620_100300083
572 Ga0105240_10000894
573 Ga0105240_10001454
574 Ga0105240_10032577
575 Ga0105240_10383974
576 Ga0105240_10490280
577 Ga0105240_10572402
578 Ga0105245_10005203
579 Ga0105245_10013697
580 Ga0105245_10016346
581 Ga0105245_10062802
582 Ga0105245_10132677
583 Ga0105245_10256414
584 Ga0105245_10690962
585 Ga0105243_10084084
586 Ga0105243_10618074
587 Ga0105243_10798530
588 Ga0105241_10023388
589 Ga0105241_10087446
590 Ga0105241_10459640
591 Ga0105241_10494601
592 Ga0105241_10690192
593 Ga0105241_10963408
594 Ga0105242_10008498
595 Ga0105242_10184029
596 Ga0105242_10216463
597 Ga0105242_10275330
598 Ga0105242_10284189
599 Ga0105242_11069103
600 Ga0105242_11654691
601 Ga0105248_10006805
602 Ga0105248_10017627
603 Ga0105248_10032270
604 Ga0105248_10111507
605 Ga0105248_10435979
606 Ga0105248_10676280
607 Ga0105248_10878448
608 Ga0105237_10025667
609 Ga0105237_10059623
610 Ga0105237_10131612
611 Ga0105237_10597102
612 Ga0105237_10616049
613 Ga0105237_11548075
614 Ga0105238_10010809
615 Ga0105238_10011328
616 Ga0105238_10012826
617 Ga0105238_10015631
618 Ga0105238_10037663
619 Ga0105238_10051921
620 Ga0105238_10440097
621 Ga0105249_10031590
622 Ga0105249_10452372
623 Ga0105239_10004288
624 Ga0105239_10030157
625 Ga0105239_10055413
626 Ga0105239_10072657
627 Ga0105239_10133647
628 Ga0105239_10505333
629 Ga0105246_10011152
630 Ga0105246_10035013
631 Ga0157370_10049265
632 Ga0157370_10101540
633 Ga0157369_10004427
634 Ga0157369_10015903
635 Ga0157369_10333469
636 Ga0157374_10002548
637 Ga0157374_10248488
638 Ga0157374_10402751
639 Ga0157378_10043503
640 Ga0157378_11000157
641 Ga0163162_10036642
642 Ga0163162_10107809
643 Ga0163162_10276813
644 Ga0163162_10407650
645 Ga0157372_10006626
646 Ga0157372_10022237
647 Ga0157372_10038602
648 Ga0157372_10040623
649 Ga0157372_10471308
650 Ga0157375_10281194
651 Ga0157375_10541643
652 Ga0157375_10872009
653 Ga0163163_10005777
654 Ga0163163_10097408
655 Ga0163163_10124915
656 Ga0163163_10134150
657 Ga0163163_10530309
658 Ga0163163_10854433
659 Ga0163163_11278774
660 Ga0157379_10069655
661 Ga0157379_10442657
662 Ga0157379_11161948
663 Ga0157376_10041268
664 Ga0157376_10100585
665 Ga0157376_10582950
666 Ga0157376_10622590
667 Ga0157376_11497811
668 Ga0213876_10387275
669 Ga0213875_10028521
670 Ga0213875_10034739
671 Ga0213875_10052681
672 Ga0213875_10403466
673 Ga0207680_10314980
674 Ga0207699_10095025
675 Ga0207645_10393404
676 Ga0207645_10500143
677 Ga0207684_10627743
678 Ga0207654_10010429
679 Ga0207654_10053617
680 Ga0207654_10062171
681 Ga0207707_10001605
682 Ga0207707_10247718
683 Ga0207707_10299372
684 Ga0207707_10450739
685 Ga0207695_10000504
686 Ga0207695_10001887
687 Ga0207695_10030536
688 Ga0207695_10272024
689 Ga0207671_10182655
690 Ga0207671_10575797
691 Ga0207671_10863683
692 Ga0207693_10311209
693 Ga0207663_10057971
694 Ga0207660_10012191
695 Ga0207657_10042002
696 Ga0207657_10339467
697 Ga0207657_10619355
698 Ga0207649_10348266
699 Ga0207649_10856757
700 Ga0207652_10002681
701 Ga0207694_10000543
702 Ga0207694_10011842
703 Ga0207694_10068338
704 Ga0207694_10082276
705 Ga0207694_10164172
706 Ga0207694_10305993
707 Ga0207694_10428642
708 Ga0207650_10150373
709 Ga0207687_10000735
710 Ga0207687_10003243
711 Ga0207687_10027667
712 Ga0207687_10076474
713 Ga0207687_10410926
714 Ga0207687_10547008
715 Ga0207700_10001943
716 Ga0207700_10152850
717 Ga0207664_10003712
718 Ga0207690_10113277
719 Ga0207706_10888056
720 Ga0207686_10005836
721 Ga0207686_10043790
722 Ga0207686_10049263
723 Ga0207686_10060564
724 Ga0207686_10101773
725 Ga0207686_10134345
726 Ga0207686_10728912
727 Ga0207686_11170539
728 Ga0207709_10373144
729 Ga0207704_10106292
730 Ga0207704_10204369
731 Ga0207711_10029318
732 Ga0207711_10095015
733 Ga0207711_10205558
734 Ga0207711_10253825
735 Ga0207711_10854886
736 Ga0207689_10280808
737 Ga0207661_10002231
738 Ga0207661_10026056
739 Ga0207661_10591309
740 Ga0207679_10386659
741 Ga0207679_10724477
742 Ga0207667_10000179
743 Ga0207667_10003013
744 Ga0207667_10051200
745 Ga0207667_10143096
746 Ga0207667_10196863
747 Ga0207667_11285717
748 Ga0207651_10204190
749 Ga0207712_10038998
750 Ga0207712_10039543
751 Ga0207712_10292425
752 Ga0207640_10530051
753 Ga0207658_10558121
754 Ga0207677_10015414
755 Ga0207677_10323851
756 Ga0207677_10406007
757 Ga0207677_11976600
758 Ga0207703_10076074
759 Ga0207703_10206270
760 Ga0207703_10223270
761 Ga0207703_10330760
762 Ga0207703_11298809
763 Ga0207703_11688085
764 Ga0207703_12161010
765 Ga0207639_10132315
766 Ga0207639_10509096
767 Ga0207639_10869091
768 Ga0207702_10022379
769 Ga0207702_10027515
770 Ga0207702_10195109
771 Ga0207702_10783312
772 Ga0207641_10140816
773 Ga0207641_10340169
774 Ga0207648_10034027
775 Ga0207648_10043398
776 Ga0207648_10178048
777 Ga0207676_10297556
778 Ga0207676_10413385
779 Ga0207676_11955053
780 Ga0207674_10000936
781 Ga0207674_10003148
782 Ga0207674_10008621
783 Ga0207674_10027161
784 Ga0207674_10052451
785 Ga0207674_10418659
786 Ga0207674_10573180
787 Ga0207674_10817701
788 Ga0207698_10212356
789 Ga0207698_10541060
790 Ga0207698_10791491
791 Ga0268266_10056462
792 Ga0268266_10173853
793 Ga0268266_11042096
794 Ga0268264_10059337
795 Ga0268264_10083513
796 Ga0268264_10472977
797 Ga0268264_10633451
798 Ga0268264_10943088
799 Ga0265338_10109498
800 Ga0265338_10329822
801 Ga0265332_10160587
802 Ga0265325_10063735
803 Ga0265339_10243803
804 Ga0265316_10285652
805 Ga0265316_10336038
806 Ga0265313_10003265
807 Ga0265313_10060416
808 Ga0265313_10197910
809 Ga0265314_10022206
810 Ga0265314_10135608
811 Ga0307416_100573250
812 Ga0307414_10539304
813 Ga0307411_10294327
814 Ga0373923_0067870
815 Ga0373954_0002555
816 Ga0373957_0047612
817 Ga0373943_0153477
818 Ga0373955_0252868
819 Ga0373931_0158840
820 Ga0373935_0388464
821 Ga0373927_0003509
822 Ga0373927_0107382
823 Ga0373933_0009630
824 Ga0373947_0109516
825 Ga0373947_0920822
826 Ga0373937_0023353
827 Ga0373937_0028055
828 Ga0373937_0263432
829 Ga0373937_1826330
830 Ga0316582_0335397
831 Ga0373925_0802050
832 Ga0436364_0329470
833 Ga0436364_0637670
834 Ga0436364_1104266
835 Ga0436364_1294560
836 Ga0436364_1380562
837 Ga0400489_45164
838 Ga0436365_0708725
839 Ga0436363_0461936
840 Ga0436362_0040227
841 Ga0436362_0532889
842 Ga0439448_0377055
843 Ga0466971_0640371
844 Ga0466957_0365509
845 Ga0466959_0350472
846 Ga0495592_0590137
847 Ga0495653_0069279
848 Ga0495580_0113315
849 Ga0495594_0091894
850 Ga0495608_0222162
851 Ga0495666_0068067
852 Ga0495657_0316583
853 Ga0495623_0142399
854 Ga0495669_0129322
855 Ga0495636_0039672
856 Ga0495636_0333211
857 Ga0495674_0655147
858 Ga0495675_0067007
859 Ga0495675_0108414
860 Ga0495675_0402055
861 Ga0495684_0275108
862 Ga0495602_0489917
863 Ga0496108_0287010
864 Ga0496110_0640145
865 Ga0496112_0243562
866 Ga0496114_1640725
867 Ga0501032_0066131
868 Ga0501032_0106733
869 Ga0501033_0032630
870 Ga0501033_0082911
871 Ga0501034_0304844
872 Ga0501034_0948881
873 Ga0501037_0042945
874 Ga0501038_0099060
875 Ga0501038_0504414
876 Ga0501039_1238776
877 Ga0501042_0538011
878 Ga0501043_0038354
879 Ga0501046_0010000
880 Ga0501047_0000670
881 Ga0501047_0276860
882 Ga0501035_0011267
883 Ga0501044_0000456
884 Ga0501044_0032738
885 Ga0501045_0725767
886 nmdc:mga06r32_1077366_c1
887 nmdc:mga06r32_252762_c1
888 Ga0495601_0100497
889 Ga0500568_0001334
890 Ga0500616_0100286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

20

167

0.98

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

19

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9864 2 136
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9863 2 141
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9824 2 136
8e2p-assembly2.cif.gz_D crystal structure of tada*8.20 in a complex with ssdna 0.9766 2 136
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9766 2 142
ID Description Score Start End Superfamily
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9818 2 141 3.40.140.10
af_A0A1D6EFG6_210_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9814 66 121 3.40.140.10
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.98 36 92 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9776 2 141 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9727 2 141 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A143PGG8-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9907 2 140 GO:0002100
GO:0008270
GO:0052717
AF-A0A7C1ZT97-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9891 2 139 GO:0002100
GO:0008270
GO:0052717
AF-A0A7R7Y1J3-F1-model_v4 deleted 0.9891 2 139
AF-A0A2X3IWJ9-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9887 2 140 GO:0002100
GO:0008270
GO:0052717
AF-A0A3M0Z7W8-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9886 2 140 GO:0002100
GO:0008270
GO:0052717

Map