F444831

General Info

Members Datasets Scaffolds Average Seq Length
442 193 884 261

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100597603|Ga0070713_1005976032
Length 281
Sequence MRSRQDGSHKSVRRGAACKHVTTRRTILALVLALVSGGVALAQFAFDSRDFYRPLPNTPYDGRFTFVRVRYNPAPGGFWPGRRPSWIHGYPLAERNLMKIMNEVSLLGAHEDINTVTLDDPALFKYPVAYIIEVGWWTVNDHEAAALRDYLLKGGFLFVDDFKTEGWRGIPGGGWEPFAENMQRVLPGVQFFDMSPNDSVFHSFFEINDLKHFPQAYVGGDPVFKGIXXDNDPSKRLMAIINYNTDVSQFWEWSGRGLRPFDQTNEAYKLGVNYLIYGLTH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 22.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100597603 3300005436 Unclassified 1048
2 Ga0065712_10005986 3300005290 Bacteria 4707
3 Ga0070676_10077394 3300005328 Bacteria 2010
4 Ga0070690_100044533 3300005330 Bacteria 2817
5 Ga0070690_100246920 3300005330 Bacteria 1261
6 Ga0070670_100030601 3300005331 Bacteria 4635
7 Ga0070670_100150257 3300005331 Bacteria 2016
8 Ga0070670_100211087 3300005331 Bacteria 1688
9 Ga0068869_100096647 3300005334 Bacteria 2230
10 Ga0070666_10116063 3300005335 Bacteria 1854
11 Ga0070666_10151990 3300005335 Bacteria 1615
12 Ga0070682_100228397 3300005337 Bacteria 1329
13 Ga0068868_100127053 3300005338 Unclassified 2084
14 Ga0070660_100008529 3300005339 Bacteria 7176
15 Ga0070660_100021793 3300005339 Bacteria 4729
16 Ga0070660_100158282 3300005339 Bacteria 1824
17 Ga0070660_100458577 3300005339 Unclassified 1058
18 Ga0070691_10023391 3300005341 Bacteria 2869
19 Ga0070668_100464410 3300005347 Unclassified 1090
20 Ga0070669_100002793 3300005353 Bacteria 12599
21 Ga0070669_100080633 3300005353 Bacteria 2422
22 Ga0070675_100001182 3300005354 Bacteria 18959
23 Ga0070671_100064431 3300005355 Unclassified 3052
24 Ga0070671_100126831 3300005355 Unclassified 2149
25 Ga0070671_100416683 3300005355 Bacteria 1150
26 Ga0070674_100064038 3300005356 Bacteria 2575
27 Ga0070673_100012892 3300005364 Bacteria 5758
28 Ga0070673_100020743 3300005364 Bacteria 4744
29 Ga0070659_100030723 3300005366 Bacteria 4158
30 Ga0070659_100181720 3300005366 Bacteria 1726
31 Ga0070667_100027806 3300005367 Bacteria 4706
32 Ga0070667_100384672 3300005367 Unclassified 1275
33 Ga0070701_10039039 3300005438 Bacteria 2407
34 Ga0070700_100013954 3300005441 Bacteria 4527
35 Ga0070708_100088227 3300005445 Unclassified 2820
36 Ga0070678_100001647 3300005456 Bacteria 11963
37 Ga0070678_100090079 3300005456 Unclassified 2350
38 Ga0070662_100598025 3300005457 Unclassified 928
39 Ga0070681_10004809 3300005458 Bacteria 12945
40 Ga0070681_10134373 3300005458 Bacteria 2405
41 Ga0070681_10240354 3300005458 Bacteria 1725
42 Ga0068867_100082317 3300005459 Bacteria 2428
43 Ga0068867_100419607 3300005459 Bacteria 1133
44 Ga0070685_10316124 3300005466 Unclassified 1057
45 Ga0070707_100090082 3300005468 Bacteria 2969
46 Ga0070707_100728567 3300005468 Bacteria 955
47 Ga0070698_100056457 3300005471 Bacteria 3978
48 Ga0070698_100229926 3300005471 Unclassified 1788
49 Ga0070699_100022806 3300005518 Bacteria 5394
50 Ga0070699_100510973 3300005518 Bacteria 1092
51 Ga0070679_100017057 3300005530 Bacteria 7020
52 Ga0070679_100028804 3300005530 Bacteria 5478
53 Ga0070697_100312649 3300005536 Bacteria 1352
54 Ga0068853_100242242 3300005539 Bacteria 1653
55 Ga0068853_100469811 3300005539 Unclassified 1185
56 Ga0070672_100299641 3300005543 Bacteria 1362
57 Ga0070686_100037068 3300005544 Bacteria 3023
58 Ga0070686_100183382 3300005544 Unclassified 1489
59 Ga0070686_100516939 3300005544 Bacteria 929
60 Ga0070695_100052755 3300005545 Unclassified 2614
61 Ga0070695_100077300 3300005545 Bacteria 2193
62 Ga0070696_100014977 3300005546 Bacteria 5206
63 Ga0070665_100003017 3300005548 Bacteria 18158
64 Ga0070665_100004686 3300005548 Bacteria 14275
65 Ga0070665_100044478 3300005548 Bacteria 4459
66 Ga0070665_100100944 3300005548 Bacteria 2889
67 Ga0070704_100012111 3300005549 Bacteria 5320
68 Ga0068855_100041220 3300005563 Bacteria 5473
69 Ga0068859_100088057 3300005617 Bacteria 3154
70 Ga0068859_100154213 3300005617 Bacteria 2373
71 Ga0068859_100193066 3300005617 Unclassified 2121
72 Ga0068864_100071148 3300005618 Bacteria 3028
73 Ga0068866_10057285 3300005718 Unclassified 2007
74 Ga0068861_100012719 3300005719 Bacteria 5873
75 Ga0068863_100000867 3300005841 Bacteria 30266
76 Ga0068863_100060332 3300005841 Unclassified 3587
77 Ga0068863_100344207 3300005841 Bacteria 1451
78 Ga0068863_100385920 3300005841 Bacteria 1368
79 Ga0068863_100460712 3300005841 Bacteria 1248
80 Ga0068863_100538633 3300005841 Bacteria 1152
81 Ga0068863_100856612 3300005841 Unclassified 908
82 Ga0068858_100008152 3300005842 Bacteria 10071
83 Ga0068858_100097638 3300005842 Bacteria 2739
84 Ga0068858_100254644 3300005842 Bacteria 1668
85 Ga0068858_100265739 3300005842 Bacteria 1632
86 Ga0068858_100304996 3300005842 Bacteria 1519
87 Ga0068858_100419039 3300005842 Unclassified 1288
88 Ga0068858_100478645 3300005842 Bacteria 1201
89 Ga0068858_100563787 3300005842 Unclassified 1103
90 Ga0068860_100093251 3300005843 Bacteria 2870
91 Ga0068860_100125130 3300005843 Unclassified 2464
92 Ga0068860_100216729 3300005843 Bacteria 1858
93 Ga0081455_10074371 3300005937 Bacteria 2806
94 Ga0081539_10059109 3300005985 Bacteria 2112
95 Ga0075366_10347630 3300006195 Bacteria 910
96 Ga0097621_100000957 3300006237 Bacteria 20258
97 Ga0097621_100008566 3300006237 Bacteria 7372
98 Ga0097621_100162800 3300006237 Bacteria 1919
99 Ga0097621_100190254 3300006237 Bacteria 1777
100 Ga0097621_100297411 3300006237 Bacteria 1425
101 Ga0068871_100015073 3300006358 Bacteria 5777
102 Ga0068871_100034017 3300006358 Bacteria 4040
103 Ga0068871_100049232 3300006358 Unclassified 3405
104 Ga0068871_100140780 3300006358 Unclassified 2051
105 Ga0068871_100151663 3300006358 Bacteria 1977
106 Ga0068871_100154850 3300006358 Bacteria 1956
107 Ga0068871_100171906 3300006358 Bacteria 1858
108 Ga0068871_100463575 3300006358 Bacteria 1137
109 Ga0075428_100218170 3300006844 Bacteria 2060
110 Ga0075428_100332195 3300006844 Bacteria 1633
111 Ga0075433_10066638 3300006852 Bacteria 3159
112 Ga0075433_10118876 3300006852 Unclassified 2346
113 Ga0075433_10254276 3300006852 Bacteria 1558
114 Ga0075433_10383410 3300006852 Bacteria 1241
115 Ga0075433_10483200 3300006852 Bacteria 1091
116 Ga0075434_100017085 3300006871 Bacteria 6983
117 Ga0075434_100029464 3300006871 Bacteria 5402
118 Ga0075434_100067850 3300006871 Bacteria 3553
119 Ga0075434_100072883 3300006871 Bacteria 3426
120 Ga0075434_100124682 3300006871 Unclassified 2593
121 Ga0075434_100214564 3300006871 Bacteria 1944
122 Ga0075434_100364024 3300006871 Unclassified 1467
123 Ga0075434_100386338 3300006871 Bacteria 1421
124 Ga0075434_100405470 3300006871 Unclassified 1384
125 Ga0075429_100137935 3300006880 Bacteria 2135
126 Ga0075429_100335713 3300006880 Bacteria 1323
127 Ga0068865_100015229 3300006881 Bacteria 4901
128 Ga0068865_100124654 3300006881 Bacteria 1921
129 Ga0075436_100001798 3300006914 Bacteria 14696
130 Ga0075436_100019824 3300006914 Unclassified 4611
131 Ga0075436_100020162 3300006914 Unclassified 4575
132 Ga0075436_100070342 3300006914 Unclassified 2419
133 Ga0075436_100077965 3300006914 Bacteria 2295
134 Ga0097620_100088056 3300006931 Bacteria 3154
135 Ga0097620_100154225 3300006931 Bacteria 2373
136 Ga0097620_100193057 3300006931 Unclassified 2121
137 Ga0075435_100000537 3300007076 Bacteria 23203
138 Ga0075435_100013139 3300007076 Bacteria 6151
139 Ga0075435_100030685 3300007076 Bacteria 4229
140 Ga0075435_100032976 3300007076 Bacteria 4092
141 Ga0075435_100041835 3300007076 Unclassified 3664
142 Ga0075435_100126131 3300007076 Bacteria 2139
143 Ga0075435_100217103 3300007076 Bacteria 1623
144 Ga0075435_100309944 3300007076 Bacteria 1350
145 Ga0075435_100383468 3300007076 Unclassified 1207
146 Ga0105240_10708691 3300009093 Unclassified 1098
147 Ga0111539_10005108 3300009094 Bacteria 17020
148 Ga0111539_10010685 3300009094 Bacteria 11561
149 Ga0111539_10022650 3300009094 Bacteria 7717
150 Ga0111539_10194904 3300009094 Bacteria 2363
151 Ga0111539_10280955 3300009094 Unclassified 1937
152 Ga0105245_10036056 3300009098 Bacteria 4391
153 Ga0105247_10007095 3300009101 Bacteria 6882
154 Ga0105247_10010988 3300009101 Bacteria 5465
155 Ga0105247_10040049 3300009101 Bacteria 2863
156 Ga0114129_10001454 3300009147 Bacteria 31988
157 Ga0114129_10030401 3300009147 Bacteria 7642
158 Ga0114129_10457424 3300009147 Bacteria 1673
159 Ga0114129_10803930 3300009147 Bacteria 1199
160 Ga0105243_10013461 3300009148 Bacteria 6186
161 Ga0105242_10013660 3300009176 Bacteria 6280
162 Ga0105242_10026573 3300009176 Bacteria 4588
163 Ga0105242_10132103 3300009176 Bacteria 2156
164 Ga0105242_10133516 3300009176 Bacteria 2146
165 Ga0105242_10136230 3300009176 Unclassified 2125
166 Ga0105242_10387652 3300009176 Bacteria 1300
167 Ga0105248_10006608 3300009177 Bacteria 12706
168 Ga0105248_10008197 3300009177 Bacteria 11477
169 Ga0105248_10010786 3300009177 Bacteria 10088
170 Ga0105248_10018030 3300009177 Bacteria 7792
171 Ga0105248_10089449 3300009177 Unclassified 3466
172 Ga0105248_10116565 3300009177 Bacteria 3012
173 Ga0105248_10181294 3300009177 Bacteria 2373
174 Ga0105248_10336787 3300009177 Bacteria 1699
175 Ga0105248_10339049 3300009177 Bacteria 1692
176 Ga0105248_10375989 3300009177 Bacteria 1599
177 Ga0105248_10385793 3300009177 Bacteria 1577
178 Ga0105238_10207391 3300009551 Bacteria 1936
179 Ga0105238_10516907 3300009551 Unclassified 1196
180 Ga0105238_10664460 3300009551 Unclassified 1053
181 Ga0105249_10165305 3300009553 Bacteria 2141
182 Ga0105249_10331090 3300009553 Bacteria 1537
183 Ga0105246_10284021 3300011119 Bacteria 1329
184 Ga0105246_10547506 3300011119 Bacteria 991
185 Ga0157369_10222279 3300013105 Bacteria 1976
186 Ga0157374_10030616 3300013296 Bacteria 4888
187 Ga0157374_10384808 3300013296 Bacteria 1398
188 Ga0157378_10297839 3300013297 Bacteria 1560
189 Ga0157378_10364536 3300013297 Unclassified 1415
190 Ga0163162_10110671 3300013306 Bacteria 2844
191 Ga0163162_10239322 3300013306 Bacteria 1946
192 Ga0163162_10699366 3300013306 Bacteria 1135
193 Ga0163162_11084042 3300013306 Unclassified 907
194 Ga0157372_10502026 3300013307 Bacteria 1415
195 Ga0157375_10132836 3300013308 Bacteria 2610
196 Ga0157375_10216550 3300013308 Bacteria 2073
197 Ga0157375_11030573 3300013308 Unclassified 961
198 Ga0163163_10005599 3300014325 Bacteria 10882
199 Ga0163163_10010488 3300014325 Bacteria 8335
200 Ga0163163_10311189 3300014325 Unclassified 1628
201 Ga0157380_10040420 3300014326 Bacteria 3632
202 Ga0157380_10258223 3300014326 Unclassified 1581
203 Ga0157379_10016061 3300014968 Bacteria 6583
204 Ga0157379_10017929 3300014968 Bacteria 6237
205 Ga0157379_10025415 3300014968 Bacteria 5261
206 Ga0157379_10026159 3300014968 Bacteria 5193
207 Ga0157379_10076647 3300014968 Bacteria 2994
208 Ga0157379_10270304 3300014968 Bacteria 1546
209 Ga0157379_10380697 3300014968 Bacteria 1295
210 Ga0157376_10003771 3300014969 Bacteria 10476
211 Ga0157376_10008999 3300014969 Bacteria 7231
212 Ga0157376_10030765 3300014969 Unclassified 4291
213 Ga0157376_10035538 3300014969 Bacteria 4031
214 Ga0157376_10089377 3300014969 Bacteria 2663
215 Ga0157376_10172872 3300014969 Bacteria 1969
216 Ga0157376_10244396 3300014969 Bacteria 1673
217 Ga0157376_10268086 3300014969 Bacteria 1603
218 Ga0157376_10418162 3300014969 Bacteria 1300
219 Ga0207642_10056619 3300025899 Bacteria 1799
220 Ga0207710_10037942 3300025900 Unclassified 2129
221 Ga0207710_10088627 3300025900 Unclassified 1445
222 Ga0207680_10108357 3300025903 Bacteria 1797
223 Ga0207699_10061283 3300025906 Unclassified 2263
224 Ga0207645_10002378 3300025907 Bacteria 14820
225 Ga0207643_10388820 3300025908 Unclassified 880
226 Ga0207684_10466787 3300025910 Bacteria 1083
227 Ga0207707_10014087 3300025912 Bacteria 6970
228 Ga0207695_10502464 3300025913 Bacteria 1095
229 Ga0207663_10033094 3300025916 Unclassified 3076
230 Ga0207660_10173941 3300025917 Bacteria 1668
231 Ga0207662_10316216 3300025918 Bacteria 1041
232 Ga0207657_10016487 3300025919 Bacteria 7125
233 Ga0207657_10194594 3300025919 Bacteria 1634
234 Ga0207657_10295410 3300025919 Bacteria 1284
235 Ga0207649_10099615 3300025920 Bacteria 1920
236 Ga0207649_10112294 3300025920 Bacteria 1823
237 Ga0207652_10008694 3300025921 Bacteria 8177
238 Ga0207646_10178963 3300025922 Bacteria 1915
239 Ga0207646_10266468 3300025922 Bacteria 1548
240 Ga0207681_10022561 3300025923 Bacteria 4016
241 Ga0207681_10042990 3300025923 Unclassified 3022
242 Ga0207681_10106687 3300025923 Bacteria 2030
243 Ga0207650_10064515 3300025925 Bacteria 2742
244 Ga0207650_10142012 3300025925 Bacteria 1889
245 Ga0207650_10231959 3300025925 Bacteria 1489
246 Ga0207659_10005643 3300025926 Bacteria 7611
247 Ga0207687_10024447 3300025927 Bacteria 4036
248 Ga0207687_10177628 3300025927 Bacteria 1647
249 Ga0207700_10034911 3300025928 Bacteria 3616
250 Ga0207690_10019698 3300025932 Bacteria 4158
251 Ga0207706_10071809 3300025933 Bacteria 3045
252 Ga0207706_10093448 3300025933 Bacteria 2645
253 Ga0207706_10416299 3300025933 Unclassified 1164
254 Ga0207686_10012252 3300025934 Bacteria 4712
255 Ga0207686_10088069 3300025934 Unclassified 2043
256 Ga0207686_10108432 3300025934 Bacteria 1868
257 Ga0207709_10019320 3300025935 Bacteria 3829
258 Ga0207704_10001993 3300025938 Bacteria 9155
259 Ga0207704_10107548 3300025938 Bacteria 1876
260 Ga0207691_10012592 3300025940 Bacteria 8108
261 Ga0207691_10157620 3300025940 Archaea 1993
262 Ga0207711_10005678 3300025941 Bacteria 10541
263 Ga0207711_10010473 3300025941 Bacteria 7700
264 Ga0207711_10016453 3300025941 Bacteria 6146
265 Ga0207711_10033284 3300025941 Bacteria 4360
266 Ga0207711_10131626 3300025941 Bacteria 2243
267 Ga0207711_10390465 3300025941 Bacteria 1292
268 Ga0207689_10038250 3300025942 Bacteria 3975
269 Ga0207661_10288328 3300025944 Bacteria 1469
270 Ga0207667_10171554 3300025949 Bacteria 2229
271 Ga0207651_10038766 3300025960 Bacteria 3135
272 Ga0207651_10056816 3300025960 Bacteria 2696
273 Ga0207712_10213847 3300025961 Bacteria 1537
274 Ga0207668_10098061 3300025972 Bacteria 2171
275 Ga0207640_10178069 3300025981 Unclassified 1591
276 Ga0207658_10015669 3300025986 Bacteria 5203
277 Ga0207658_10328487 3300025986 Bacteria 1326
278 Ga0207658_10706761 3300025986 Bacteria 911
279 Ga0207677_10273719 3300026023 Bacteria 1383
280 Ga0207703_10002836 3300026035 Bacteria 14787
281 Ga0207703_10024710 3300026035 Bacteria 4727
282 Ga0207703_10106860 3300026035 Bacteria 2381
283 Ga0207703_10112399 3300026035 Bacteria 2327
284 Ga0207703_10148861 3300026035 Unclassified 2039
285 Ga0207703_10219996 3300026035 Bacteria 1697
286 Ga0207703_10231928 3300026035 Bacteria 1655
287 Ga0207703_10359888 3300026035 Unclassified 1342
288 Ga0207703_10430167 3300026035 Bacteria 1230
289 Ga0207639_10201576 3300026041 Bacteria 1707
290 Ga0207678_10157651 3300026067 Bacteria 1938
291 Ga0207708_10013759 3300026075 Bacteria 6047
292 Ga0207708_10493811 3300026075 Unclassified 1025
293 Ga0207641_10000259 3300026088 Bacteria 67298
294 Ga0207641_10000982 3300026088 Bacteria 29176
295 Ga0207641_10048421 3300026088 Bacteria 3588
296 Ga0207641_10436773 3300026088 Unclassified 1263
297 Ga0207648_10008282 3300026089 Bacteria 10095
298 Ga0207648_10156515 3300026089 Bacteria 2012
299 Ga0207648_10180507 3300026089 Unclassified 1868
300 Ga0207648_10209186 3300026089 Unclassified 1731
301 Ga0207648_10558387 3300026089 Bacteria 1052
302 Ga0207676_10275732 3300026095 Bacteria 1525
303 Ga0207676_10809307 3300026095 Bacteria 914
304 Ga0207674_10226381 3300026116 Bacteria 1818
305 Ga0207675_100007682 3300026118 Bacteria 10173
306 Ga0207675_100192902 3300026118 Bacteria 1954
307 Ga0207675_100259817 3300026118 Bacteria 1683
308 Ga0207675_100618663 3300026118 Unclassified 1087
309 Ga0207683_10032533 3300026121 Bacteria 4530
310 Ga0207683_10089594 3300026121 Bacteria 2738
311 Ga0207683_10191567 3300026121 Bacteria 1857
312 Ga0207428_10030993 3300027907 Bacteria 4418
313 Ga0268266_10017450 3300028379 Bacteria 6121
314 Ga0268266_10028746 3300028379 Bacteria 4726
315 Ga0268266_10055340 3300028379 Unclassified 3410
316 Ga0268266_10122294 3300028379 Bacteria 2317
317 Ga0268265_10017949 3300028380 Unclassified 4895
318 Ga0268265_10019313 3300028380 Bacteria 4734
319 Ga0268264_10011472 3300028381 Bacteria 7316
320 Ga0268264_10116837 3300028381 Bacteria 2345
321 Ga0268264_10284739 3300028381 Bacteria 1550
322 Ga0373926_0045409 3300035083 Bacteria 1575
323 Ga0373923_0019222 3300035111 Bacteria 2643
324 Ga0373941_0059668 3300035115 Bacteria 1238
325 Ga0373956_0099249 3300035119 Bacteria 1349
326 Ga0373943_0009153 3300035170 Bacteria 4439
327 Ga0373943_0105687 3300035170 Unclassified 1478
328 Ga0373946_0001957 3300035171 Bacteria 7205
329 Ga0373955_0010717 3300035172 Bacteria 4341
330 Ga0373961_0114291 3300035241 Bacteria 888
331 Ga0373924_0108422 3300035410 Bacteria 1198
332 Ga0373931_0181459 3300035691 Bacteria 1247
333 Ga0373935_0011426 3300035692 Bacteria 5331
334 Ga0373935_0281152 3300035692 Bacteria 1172
335 Ga0373927_0157623 3300035695 Unclassified 1487
336 Ga0373947_0076924 3300035725 Unclassified 2058
337 Ga0373947_0237162 3300035725 Bacteria 1203
338 Ga0373947_0307753 3300035725 Bacteria 1058
339 Ga0373937_0113112 3300036401 Bacteria 2526
340 Ga0373937_0270149 3300036401 Unclassified 1605
341 Ga0373937_0279609 3300036401 Unclassified 1576
342 Ga0373937_0293627 3300036401 Bacteria 1536
343 Ga0373925_0115342 3300037068 Unclassified 2080
344 Ga0495592_0028608 3300046454 Bacteria 4220
345 Ga0495653_0170639 3300046463 Bacteria 1502
346 Ga0495580_0124677 3300046472 Unclassified 1788
347 Ga0495580_0304366 3300046472 Unclassified 1085
348 Ga0495639_0049449 3300046475 Unclassified 1908
349 Ga0495639_0199149 3300046475 Bacteria 980
350 Ga0495628_0222694 3300046516 Bacteria 1416
351 Ga0495630_0008197 3300046517 Bacteria 7503
352 Ga0495630_0176195 3300046517 Bacteria 1630
353 Ga0495630_0452805 3300046517 Unclassified 984
354 Ga0495640_0241165 3300046533 Unclassified 1135
355 Ga0495586_0035895 3300046535 Unclassified 2663
356 Ga0495587_0050731 3300046536 Unclassified 2455
357 Ga0495645_0014034 3300046543 Bacteria 5677
358 Ga0495645_0401410 3300046543 Bacteria 873
359 Ga0495667_0008059 3300046559 Bacteria 7149
360 Ga0495634_0075755 3300046642 Unclassified 2209
361 Ga0495634_0110024 3300046642 Unclassified 1772
362 Ga0495635_0251300 3300046663 Unclassified 1192
363 Ga0495658_0309480 3300046683 Unclassified 1000
364 Ga0495669_0004751 3300046684 Bacteria 5631
365 Ga0495613_0000651 3300046689 Bacteria 27530
366 Ga0495674_0054769 3300047319 Unclassified 3501
367 Ga0495680_0177986 3300047322 Unclassified 1537
368 Ga0495684_0001480 3300047471 Bacteria 18788
369 Ga0495684_0454806 3300047471 Unclassified 889
370 Ga0496100_0078040 3300048903 Unclassified 2228
371 Ga0496101_0003064 3300048904 Bacteria 10323
372 Ga0496101_0500297 3300048904 Unclassified 960
373 Ga0496104_0065740 3300048907 Bacteria 3442
374 Ga0496104_0080764 3300048907 Bacteria 3100
375 Ga0496104_0093452 3300048907 Bacteria 2877
376 Ga0496104_0318234 3300048907 Bacteria 1469
377 Ga0496105_0143084 3300048908 Bacteria 1968
378 Ga0496105_0185249 3300048908 Bacteria 1704
379 Ga0496106_0189409 3300048909 Unclassified 1635
380 Ga0496107_0190008 3300048910 Bacteria 1526
381 Ga0496108_0056674 3300048911 Bacteria 3293
382 Ga0496109_0101474 3300048912 Bacteria 2671
383 Ga0496109_0193564 3300048912 Bacteria 1911
384 Ga0496110_0073101 3300048913 Bacteria 3043
385 Ga0496110_0274777 3300048913 Unclassified 1534
386 Ga0496110_0411632 3300048913 Bacteria 1233
387 Ga0496112_0043778 3300048915 Bacteria 4383
388 Ga0496112_0062633 3300048915 Unclassified 3669
389 Ga0496113_0043928 3300048916 Bacteria 3309
390 Ga0496114_0000710 3300048917 Bacteria 24771
391 Ga0496114_0089525 3300048917 Bacteria 2612
392 Ga0496114_0131721 3300048917 Bacteria 2160
393 Ga0501034_0007926 3300049571 Bacteria 11285
394 Ga0501043_0144325 3300049579 Bacteria 1864
395 Ga0501083_0236018 3300049744 Bacteria 1191
396 Ga0501083_0307631 3300049744 Bacteria 1031
397 Ga0501044_0008877 3300049823 Bacteria 10988
398 nmdc:mga05p37_131396_c1 3300050507 Bacteria 3072
399 nmdc:mga05p37_204826_c1 3300050507 Unclassified 2387
400 nmdc:mga05p37_33640_c1 3300050507 Bacteria 6278
401 nmdc:mga05p37_54747_c1 3300050507 Bacteria 4908
402 nmdc:mga05p37_54954_c1 3300050507 Unclassified 4898
403 nmdc:mga09592_128707_c1 3300050508 Bacteria 2177
404 nmdc:mga09592_217922_c1 3300050508 Bacteria 1654
405 nmdc:mga09592_297478_c1 3300050508 Bacteria 1399
406 nmdc:mga06r32_309182_c1 3300050510 Bacteria 1566
407 nmdc:mga08y16_252555_c1 3300050511 Unclassified 1822
408 nmdc:mga08y16_45812_c1 3300050511 Bacteria 4581
409 nmdc:mga08y16_47977_c1 3300050511 Unclassified 4470
410 nmdc:mga08y16_671276_c1 3300050511 Unclassified 1039
411 nmdc:mga0n895_16734_c1 3300050512 Bacteria 6737
412 nmdc:mga0n895_191764_c1 3300050512 Bacteria 2075
413 nmdc:mga0n895_57204_c1 3300050512 Unclassified 3844
414 nmdc:mga0n895_78307_c1 3300050512 Bacteria 3290
415 nmdc:mga0n895_84368_c1 3300050512 Bacteria 3170
416 nmdc:mga0rr50_10272_c1 3300050513 Bacteria 5932
417 nmdc:mga0rr50_11579_c1 3300050513 Bacteria 5655
418 nmdc:mga0rr50_124828_c1 3300050513 Bacteria 2054
419 nmdc:mga0rr50_166050_c1 3300050513 Unclassified 1795
420 nmdc:mga0rr50_223014_c1 3300050513 Bacteria 1557
421 nmdc:mga0rr50_49687_c1 3300050513 Bacteria 3106
422 nmdc:mga08x19_20219_c1 3300050514 Unclassified 4099
423 nmdc:mga08x19_37659_c1 3300050514 Bacteria 3071
424 nmdc:mga08x19_6053_c1 3300050514 Bacteria 7147
425 nmdc:mga08x19_7472_c1 3300050514 Bacteria 6491
426 nmdc:mga08x19_78790_c1 3300050514 Bacteria 2160
427 nmdc:mga08x19_89444_c1 3300050514 Bacteria 2031
428 nmdc:mga0a205_152052_c1 3300050515 Bacteria 2214
429 nmdc:mga0a205_17917_c1 3300050515 Bacteria 4664
430 nmdc:mga0a205_20659_c1 3300050515 Bacteria 6217
431 nmdc:mga0a205_28911_c2 3300050515 Unclassified 2718
432 nmdc:mga0a205_536929_c1 3300050515 Bacteria 1025
433 nmdc:mga0a205_71914_c1 3300050515 Bacteria 3341
434 nmdc:mga0a205_96129_c1 3300050515 Bacteria 2861
435 Ga0495601_0007264 3300053077 Bacteria 6497
436 Ga0495601_0035015 3300053077 Bacteria 3133
437 Ga0495601_0189560 3300053077 Unclassified 1344
438 Ga0495619_0008337 3300053085 Bacteria 6552
439 Ga0495619_0017441 3300053085 Bacteria 4545
440 Ga0495619_0018018 3300053085 Bacteria 4478
441 Ga0495619_0020826 3300053085 Bacteria 4183
442 Ga0501084_0349067 3300054114 Bacteria 1250
443 Ga0070713_100597603
444 Ga0065712_10005986
445 Ga0070676_10077394
446 Ga0070690_100044533
447 Ga0070690_100246920
448 Ga0070670_100030601
449 Ga0070670_100150257
450 Ga0070670_100211087
451 Ga0068869_100096647
452 Ga0070666_10116063
453 Ga0070666_10151990
454 Ga0070682_100228397
455 Ga0068868_100127053
456 Ga0070660_100008529
457 Ga0070660_100021793
458 Ga0070660_100158282
459 Ga0070660_100458577
460 Ga0070691_10023391
461 Ga0070668_100464410
462 Ga0070669_100002793
463 Ga0070669_100080633
464 Ga0070675_100001182
465 Ga0070671_100064431
466 Ga0070671_100126831
467 Ga0070671_100416683
468 Ga0070674_100064038
469 Ga0070673_100012892
470 Ga0070673_100020743
471 Ga0070659_100030723
472 Ga0070659_100181720
473 Ga0070667_100027806
474 Ga0070667_100384672
475 Ga0070701_10039039
476 Ga0070700_100013954
477 Ga0070708_100088227
478 Ga0070678_100001647
479 Ga0070678_100090079
480 Ga0070662_100598025
481 Ga0070681_10004809
482 Ga0070681_10134373
483 Ga0070681_10240354
484 Ga0068867_100082317
485 Ga0068867_100419607
486 Ga0070685_10316124
487 Ga0070707_100090082
488 Ga0070707_100728567
489 Ga0070698_100056457
490 Ga0070698_100229926
491 Ga0070699_100022806
492 Ga0070699_100510973
493 Ga0070679_100017057
494 Ga0070679_100028804
495 Ga0070697_100312649
496 Ga0068853_100242242
497 Ga0068853_100469811
498 Ga0070672_100299641
499 Ga0070686_100037068
500 Ga0070686_100183382
501 Ga0070686_100516939
502 Ga0070695_100052755
503 Ga0070695_100077300
504 Ga0070696_100014977
505 Ga0070665_100003017
506 Ga0070665_100004686
507 Ga0070665_100044478
508 Ga0070665_100100944
509 Ga0070704_100012111
510 Ga0068855_100041220
511 Ga0068859_100088057
512 Ga0068859_100154213
513 Ga0068859_100193066
514 Ga0068864_100071148
515 Ga0068866_10057285
516 Ga0068861_100012719
517 Ga0068863_100000867
518 Ga0068863_100060332
519 Ga0068863_100344207
520 Ga0068863_100385920
521 Ga0068863_100460712
522 Ga0068863_100538633
523 Ga0068863_100856612
524 Ga0068858_100008152
525 Ga0068858_100097638
526 Ga0068858_100254644
527 Ga0068858_100265739
528 Ga0068858_100304996
529 Ga0068858_100419039
530 Ga0068858_100478645
531 Ga0068858_100563787
532 Ga0068860_100093251
533 Ga0068860_100125130
534 Ga0068860_100216729
535 Ga0081455_10074371
536 Ga0081539_10059109
537 Ga0075366_10347630
538 Ga0097621_100000957
539 Ga0097621_100008566
540 Ga0097621_100162800
541 Ga0097621_100190254
542 Ga0097621_100297411
543 Ga0068871_100015073
544 Ga0068871_100034017
545 Ga0068871_100049232
546 Ga0068871_100140780
547 Ga0068871_100151663
548 Ga0068871_100154850
549 Ga0068871_100171906
550 Ga0068871_100463575
551 Ga0075428_100218170
552 Ga0075428_100332195
553 Ga0075433_10066638
554 Ga0075433_10118876
555 Ga0075433_10254276
556 Ga0075433_10383410
557 Ga0075433_10483200
558 Ga0075434_100017085
559 Ga0075434_100029464
560 Ga0075434_100067850
561 Ga0075434_100072883
562 Ga0075434_100124682
563 Ga0075434_100214564
564 Ga0075434_100364024
565 Ga0075434_100386338
566 Ga0075434_100405470
567 Ga0075429_100137935
568 Ga0075429_100335713
569 Ga0068865_100015229
570 Ga0068865_100124654
571 Ga0075436_100001798
572 Ga0075436_100019824
573 Ga0075436_100020162
574 Ga0075436_100070342
575 Ga0075436_100077965
576 Ga0097620_100088056
577 Ga0097620_100154225
578 Ga0097620_100193057
579 Ga0075435_100000537
580 Ga0075435_100013139
581 Ga0075435_100030685
582 Ga0075435_100032976
583 Ga0075435_100041835
584 Ga0075435_100126131
585 Ga0075435_100217103
586 Ga0075435_100309944
587 Ga0075435_100383468
588 Ga0105240_10708691
589 Ga0111539_10005108
590 Ga0111539_10010685
591 Ga0111539_10022650
592 Ga0111539_10194904
593 Ga0111539_10280955
594 Ga0105245_10036056
595 Ga0105247_10007095
596 Ga0105247_10010988
597 Ga0105247_10040049
598 Ga0114129_10001454
599 Ga0114129_10030401
600 Ga0114129_10457424
601 Ga0114129_10803930
602 Ga0105243_10013461
603 Ga0105242_10013660
604 Ga0105242_10026573
605 Ga0105242_10132103
606 Ga0105242_10133516
607 Ga0105242_10136230
608 Ga0105242_10387652
609 Ga0105248_10006608
610 Ga0105248_10008197
611 Ga0105248_10010786
612 Ga0105248_10018030
613 Ga0105248_10089449
614 Ga0105248_10116565
615 Ga0105248_10181294
616 Ga0105248_10336787
617 Ga0105248_10339049
618 Ga0105248_10375989
619 Ga0105248_10385793
620 Ga0105238_10207391
621 Ga0105238_10516907
622 Ga0105238_10664460
623 Ga0105249_10165305
624 Ga0105249_10331090
625 Ga0105246_10284021
626 Ga0105246_10547506
627 Ga0157369_10222279
628 Ga0157374_10030616
629 Ga0157374_10384808
630 Ga0157378_10297839
631 Ga0157378_10364536
632 Ga0163162_10110671
633 Ga0163162_10239322
634 Ga0163162_10699366
635 Ga0163162_11084042
636 Ga0157372_10502026
637 Ga0157375_10132836
638 Ga0157375_10216550
639 Ga0157375_11030573
640 Ga0163163_10005599
641 Ga0163163_10010488
642 Ga0163163_10311189
643 Ga0157380_10040420
644 Ga0157380_10258223
645 Ga0157379_10016061
646 Ga0157379_10017929
647 Ga0157379_10025415
648 Ga0157379_10026159
649 Ga0157379_10076647
650 Ga0157379_10270304
651 Ga0157379_10380697
652 Ga0157376_10003771
653 Ga0157376_10008999
654 Ga0157376_10030765
655 Ga0157376_10035538
656 Ga0157376_10089377
657 Ga0157376_10172872
658 Ga0157376_10244396
659 Ga0157376_10268086
660 Ga0157376_10418162
661 Ga0207642_10056619
662 Ga0207710_10037942
663 Ga0207710_10088627
664 Ga0207680_10108357
665 Ga0207699_10061283
666 Ga0207645_10002378
667 Ga0207643_10388820
668 Ga0207684_10466787
669 Ga0207707_10014087
670 Ga0207695_10502464
671 Ga0207663_10033094
672 Ga0207660_10173941
673 Ga0207662_10316216
674 Ga0207657_10016487
675 Ga0207657_10194594
676 Ga0207657_10295410
677 Ga0207649_10099615
678 Ga0207649_10112294
679 Ga0207652_10008694
680 Ga0207646_10178963
681 Ga0207646_10266468
682 Ga0207681_10022561
683 Ga0207681_10042990
684 Ga0207681_10106687
685 Ga0207650_10064515
686 Ga0207650_10142012
687 Ga0207650_10231959
688 Ga0207659_10005643
689 Ga0207687_10024447
690 Ga0207687_10177628
691 Ga0207700_10034911
692 Ga0207690_10019698
693 Ga0207706_10071809
694 Ga0207706_10093448
695 Ga0207706_10416299
696 Ga0207686_10012252
697 Ga0207686_10088069
698 Ga0207686_10108432
699 Ga0207709_10019320
700 Ga0207704_10001993
701 Ga0207704_10107548
702 Ga0207691_10012592
703 Ga0207691_10157620
704 Ga0207711_10005678
705 Ga0207711_10010473
706 Ga0207711_10016453
707 Ga0207711_10033284
708 Ga0207711_10131626
709 Ga0207711_10390465
710 Ga0207689_10038250
711 Ga0207661_10288328
712 Ga0207667_10171554
713 Ga0207651_10038766
714 Ga0207651_10056816
715 Ga0207712_10213847
716 Ga0207668_10098061
717 Ga0207640_10178069
718 Ga0207658_10015669
719 Ga0207658_10328487
720 Ga0207658_10706761
721 Ga0207677_10273719
722 Ga0207703_10002836
723 Ga0207703_10024710
724 Ga0207703_10106860
725 Ga0207703_10112399
726 Ga0207703_10148861
727 Ga0207703_10219996
728 Ga0207703_10231928
729 Ga0207703_10359888
730 Ga0207703_10430167
731 Ga0207639_10201576
732 Ga0207678_10157651
733 Ga0207708_10013759
734 Ga0207708_10493811
735 Ga0207641_10000259
736 Ga0207641_10000982
737 Ga0207641_10048421
738 Ga0207641_10436773
739 Ga0207648_10008282
740 Ga0207648_10156515
741 Ga0207648_10180507
742 Ga0207648_10209186
743 Ga0207648_10558387
744 Ga0207676_10275732
745 Ga0207676_10809307
746 Ga0207674_10226381
747 Ga0207675_100007682
748 Ga0207675_100192902
749 Ga0207675_100259817
750 Ga0207675_100618663
751 Ga0207683_10032533
752 Ga0207683_10089594
753 Ga0207683_10191567
754 Ga0207428_10030993
755 Ga0268266_10017450
756 Ga0268266_10028746
757 Ga0268266_10055340
758 Ga0268266_10122294
759 Ga0268265_10017949
760 Ga0268265_10019313
761 Ga0268264_10011472
762 Ga0268264_10116837
763 Ga0268264_10284739
764 Ga0373926_0045409
765 Ga0373923_0019222
766 Ga0373941_0059668
767 Ga0373956_0099249
768 Ga0373943_0009153
769 Ga0373943_0105687
770 Ga0373946_0001957
771 Ga0373955_0010717
772 Ga0373961_0114291
773 Ga0373924_0108422
774 Ga0373931_0181459
775 Ga0373935_0011426
776 Ga0373935_0281152
777 Ga0373927_0157623
778 Ga0373947_0076924
779 Ga0373947_0237162
780 Ga0373947_0307753
781 Ga0373937_0113112
782 Ga0373937_0270149
783 Ga0373937_0279609
784 Ga0373937_0293627
785 Ga0373925_0115342
786 Ga0495592_0028608
787 Ga0495653_0170639
788 Ga0495580_0124677
789 Ga0495580_0304366
790 Ga0495639_0049449
791 Ga0495639_0199149
792 Ga0495628_0222694
793 Ga0495630_0008197
794 Ga0495630_0176195
795 Ga0495630_0452805
796 Ga0495640_0241165
797 Ga0495586_0035895
798 Ga0495587_0050731
799 Ga0495645_0014034
800 Ga0495645_0401410
801 Ga0495667_0008059
802 Ga0495634_0075755
803 Ga0495634_0110024
804 Ga0495635_0251300
805 Ga0495658_0309480
806 Ga0495669_0004751
807 Ga0495613_0000651
808 Ga0495674_0054769
809 Ga0495680_0177986
810 Ga0495684_0001480
811 Ga0495684_0454806
812 Ga0496100_0078040
813 Ga0496101_0003064
814 Ga0496101_0500297
815 Ga0496104_0065740
816 Ga0496104_0080764
817 Ga0496104_0093452
818 Ga0496104_0318234
819 Ga0496105_0143084
820 Ga0496105_0185249
821 Ga0496106_0189409
822 Ga0496107_0190008
823 Ga0496108_0056674
824 Ga0496109_0101474
825 Ga0496109_0193564
826 Ga0496110_0073101
827 Ga0496110_0274777
828 Ga0496110_0411632
829 Ga0496112_0043778
830 Ga0496112_0062633
831 Ga0496113_0043928
832 Ga0496114_0000710
833 Ga0496114_0089525
834 Ga0496114_0131721
835 Ga0501034_0007926
836 Ga0501043_0144325
837 Ga0501083_0236018
838 Ga0501083_0307631
839 Ga0501044_0008877
840 nmdc:mga05p37_131396_c1
841 nmdc:mga05p37_204826_c1
842 nmdc:mga05p37_33640_c1
843 nmdc:mga05p37_54747_c1
844 nmdc:mga05p37_54954_c1
845 nmdc:mga09592_128707_c1
846 nmdc:mga09592_217922_c1
847 nmdc:mga09592_297478_c1
848 nmdc:mga06r32_309182_c1
849 nmdc:mga08y16_252555_c1
850 nmdc:mga08y16_45812_c1
851 nmdc:mga08y16_47977_c1
852 nmdc:mga08y16_671276_c1
853 nmdc:mga0n895_16734_c1
854 nmdc:mga0n895_191764_c1
855 nmdc:mga0n895_57204_c1
856 nmdc:mga0n895_78307_c1
857 nmdc:mga0n895_84368_c1
858 nmdc:mga0rr50_10272_c1
859 nmdc:mga0rr50_11579_c1
860 nmdc:mga0rr50_124828_c1
861 nmdc:mga0rr50_166050_c1
862 nmdc:mga0rr50_223014_c1
863 nmdc:mga0rr50_49687_c1
864 nmdc:mga08x19_20219_c1
865 nmdc:mga08x19_37659_c1
866 nmdc:mga08x19_6053_c1
867 nmdc:mga08x19_7472_c1
868 nmdc:mga08x19_78790_c1
869 nmdc:mga08x19_89444_c1
870 nmdc:mga0a205_152052_c1
871 nmdc:mga0a205_17917_c1
872 nmdc:mga0a205_20659_c1
873 nmdc:mga0a205_28911_c2
874 nmdc:mga0a205_536929_c1
875 nmdc:mga0a205_71914_c1
876 nmdc:mga0a205_96129_c1
877 Ga0495601_0007264
878 Ga0495601_0035015
879 Ga0495601_0189560
880 Ga0495619_0008337
881 Ga0495619_0017441
882 Ga0495619_0018018
883 Ga0495619_0020826
884 Ga0501084_0349067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

65

279

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7742 50 266
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7635 50 266
5mfu-assembly1.cif.gz_A pa3825-eal mn-pgpg structure 0.6115 105 170
1r6v-assembly1.cif.gz_A crystal structure of fervidolysin from fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin 0.5829 99 153
6sua-assembly1.cif.gz_B structure of the high affinity engineered lipocalin c1b12 in complex with the mouse cd98 heavy chain ectodomain 0.549 113 147
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7494 50 266 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7393 50 266 3.40.50.12140
2ocdC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6636 115 145 3.40.50.40
1lvlA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5924 114 148 3.50.50.60
1o1zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.5872 112 172 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A2V7RTE6-F1-model_v4 DUF4159 domain-containing protein 0.9486 39 268
AF-A0A1Q7AMC7-F1-model_v4 DUF4159 domain-containing protein 0.9313 54 268
AF-A0A1Q7AMC7-F1-model_v4 DUF4159 domain-containing protein 0.923 54 268
AF-A0A1F2U8P8-F1-model_v4 DUF4159 domain-containing protein 0.9214 69 268
AF-A0A7V8WDT2-F1-model_v4 DUF4159 domain-containing protein 0.9204 72 268

Map