F444363

General Info

Members Datasets Scaffolds Average Seq Length
440 231 880 161

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100547790|Ga0070713_1005477902
Length 177
Sequence MKSDCNCDEIRELMPDLAAGLSTVTPAMKAHLDSCAECAGKLEAFRQTMALLDEWQAPEPSPYFDVRLNARLREEVEAESAKPAGGWLRWLRTPALAVSFALLMVASVTLFRMNGRNGNGSADTATTAPVVAAAIQTSAEPGTAVGDLQALDRNQSLFSDFDVLDDLEVQHDVTANP

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 4.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.41
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 28.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100547790 3300005436 Bacteria 1095
2 Ga0058863_11691543 3300004799 Bacteria 1597
3 Ga0058863_11772320 3300004799 Bacteria 1686
4 Ga0058861_11755001 3300004800 Bacteria 1666
5 Ga0058862_12319575 3300004803 Bacteria 2059
6 Ga0070658_10259116 3300005327 Bacteria 1477
7 Ga0070676_10032621 3300005328 Bacteria 2985
8 Ga0070683_100491973 3300005329 Bacteria 1171
9 Ga0070690_100045162 3300005330 Bacteria 2797
10 Ga0070690_100723231 3300005330 Bacteria 766
11 Ga0070670_100049228 3300005331 Bacteria 3623
12 Ga0068869_100004754 3300005334 Bacteria 8475
13 Ga0068869_100127699 3300005334 Bacteria 1951
14 Ga0068869_100634964 3300005334 Bacteria 905
15 Ga0070680_100298860 3300005336 Bacteria 1365
16 Ga0070682_100031907 3300005337 Bacteria 3190
17 Ga0070682_100534191 3300005337 Unclassified 915
18 Ga0068868_100021790 3300005338 Bacteria 4828
19 Ga0068868_100039977 3300005338 Bacteria 3648
20 Ga0070660_100362950 3300005339 Bacteria 1194
21 Ga0070691_10022935 3300005341 Bacteria 2897
22 Ga0070687_100353983 3300005343 Unclassified 948
23 Ga0070661_100011631 3300005344 Bacteria 6135
24 Ga0070661_100022055 3300005344 Bacteria 4556
25 Ga0070692_10053586 3300005345 Bacteria 2104
26 Ga0070669_100928986 3300005353 Unclassified 744
27 Ga0070671_100329648 3300005355 Bacteria 1301
28 Ga0070671_100435098 3300005355 Unclassified 1124
29 Ga0070674_100240633 3300005356 Bacteria 1417
30 Ga0070659_100056145 3300005366 Bacteria 3104
31 Ga0070659_100071469 3300005366 Bacteria 2759
32 Ga0070667_100009884 3300005367 Bacteria 7909
33 Ga0070667_100877961 3300005367 Unclassified 834
34 Ga0070709_10025942 3300005434 Bacteria 3468
35 Ga0070709_10337095 3300005434 Unclassified 1111
36 Ga0070709_11166521 3300005434 Unclassified 618
37 Ga0070714_100042894 3300005435 Bacteria 3823
38 Ga0070714_101934672 3300005435 Unclassified 575
39 Ga0070713_100002538 3300005436 Bacteria 11938
40 Ga0070713_100005650 3300005436 Bacteria 8577
41 Ga0070713_100132821 3300005436 Bacteria 2197
42 Ga0070713_100213210 3300005436 Unclassified 1749
43 Ga0070710_10030633 3300005437 Bacteria 2896
44 Ga0070711_100058185 3300005439 Bacteria 2679
45 Ga0070711_100193883 3300005439 Unclassified 1563
46 Ga0070711_100330365 3300005439 Bacteria 1220
47 Ga0070705_100156553 3300005440 Unclassified 1518
48 Ga0070700_100321588 3300005441 Bacteria 1137
49 Ga0070708_100019060 3300005445 Bacteria 5755
50 Ga0070708_100033497 3300005445 Bacteria 4464
51 Ga0070708_100127195 3300005445 Bacteria 2356
52 Ga0070708_100224158 3300005445 Bacteria 1763
53 Ga0070708_100253638 3300005445 Unclassified 1653
54 Ga0070708_100288927 3300005445 Bacteria 1544
55 Ga0070708_100720124 3300005445 Bacteria 939
56 Ga0070708_100721679 3300005445 Unclassified 938
57 Ga0070708_100829525 3300005445 Unclassified 869
58 Ga0070663_100037699 3300005455 Bacteria 3367
59 Ga0070662_100002651 3300005457 Bacteria 11037
60 Ga0070662_100362102 3300005457 Bacteria 1190
61 Ga0070681_10052493 3300005458 Bacteria 4066
62 Ga0070681_10069468 3300005458 Bacteria 3489
63 Ga0070681_10236555 3300005458 Unclassified 1740
64 Ga0070681_10759908 3300005458 Bacteria 886
65 Ga0068867_100071273 3300005459 Bacteria 2599
66 Ga0068867_100200680 3300005459 Bacteria 1597
67 Ga0068867_100350048 3300005459 Bacteria 1232
68 Ga0070685_10094278 3300005466 Unclassified 1818
69 Ga0070706_100000188 3300005467 Bacteria 78186
70 Ga0070706_100008535 3300005467 Bacteria 9552
71 Ga0070706_100104608 3300005467 Bacteria 2633
72 Ga0070707_100177981 3300005468 Bacteria 2073
73 Ga0070698_100008014 3300005471 Bacteria 11423
74 Ga0070699_100019091 3300005518 Bacteria 5898
75 Ga0070699_100020261 3300005518 Bacteria 5734
76 Ga0070699_100102702 3300005518 Bacteria 2507
77 Ga0070679_100246899 3300005530 Bacteria 1742
78 Ga0070679_100775375 3300005530 Unclassified 902
79 Ga0070684_100044260 3300005535 Bacteria 3849
80 Ga0070684_100077475 3300005535 Bacteria 2936
81 Ga0070684_100490851 3300005535 Bacteria 1137
82 Ga0070697_100000146 3300005536 Bacteria 57392
83 Ga0070697_100003243 3300005536 Bacteria 12489
84 Ga0070697_100007340 3300005536 Bacteria 8575
85 Ga0070697_100016459 3300005536 Bacteria 5816
86 Ga0070697_100057821 3300005536 Unclassified 3155
87 Ga0068853_100034418 3300005539 Bacteria 4300
88 Ga0068853_100894793 3300005539 Bacteria 852
89 Ga0070686_100074617 3300005544 Bacteria 2229
90 Ga0070695_100071571 3300005545 Bacteria 2271
91 Ga0070696_100379286 3300005546 Unclassified 1102
92 Ga0070665_100086213 3300005548 Bacteria 3146
93 Ga0070665_100216806 3300005548 Bacteria 1914
94 Ga0070665_100320891 3300005548 Bacteria 1553
95 Ga0068855_100002442 3300005563 Bacteria 22946
96 Ga0068855_100222890 3300005563 Bacteria 2114
97 Ga0068855_100923999 3300005563 Unclassified 921
98 Ga0070664_100017382 3300005564 Bacteria 5905
99 Ga0070664_100100842 3300005564 Bacteria 2510
100 Ga0070664_100642356 3300005564 Bacteria 986
101 Ga0068857_100004113 3300005577 Bacteria 12260
102 Ga0068857_100039831 3300005577 Bacteria 4164
103 Ga0068854_100009419 3300005578 Bacteria 6305
104 Ga0068854_100056323 3300005578 Bacteria 2833
105 Ga0068856_100014573 3300005614 Bacteria 7596
106 Ga0068856_100060967 3300005614 Bacteria 3726
107 Ga0068856_100112465 3300005614 Bacteria 2721
108 Ga0068856_100161552 3300005614 Bacteria 2250
109 Ga0068852_100022711 3300005616 Bacteria 5037
110 Ga0068852_100089291 3300005616 Bacteria 2754
111 Ga0068859_100020515 3300005617 Bacteria 6632
112 Ga0068864_100002826 3300005618 Bacteria 14324
113 Ga0068864_100045671 3300005618 Unclassified 3757
114 Ga0068864_100168828 3300005618 Unclassified 1994
115 Ga0068866_10063480 3300005718 Bacteria 1926
116 Ga0068866_10129401 3300005718 Bacteria 1434
117 Ga0068851_10036284 3300005834 Bacteria 2468
118 Ga0068863_100167853 3300005841 Bacteria 2105
119 Ga0068863_100395208 3300005841 Bacteria 1351
120 Ga0068858_100001259 3300005842 Bacteria 26209
121 Ga0068858_100018380 3300005842 Bacteria 6545
122 Ga0068858_100320961 3300005842 Unclassified 1480
123 Ga0068858_100597694 3300005842 Bacteria 1070
124 Ga0068858_100734658 3300005842 Unclassified 961
125 Ga0068860_100532869 3300005843 Bacteria 1175
126 Ga0068862_100401754 3300005844 Bacteria 1282
127 Ga0068862_101392364 3300005844 Bacteria 704
128 Ga0081540_1105058 3300005983 Bacteria 1207
129 Ga0070717_10006550 3300006028 Bacteria 8576
130 Ga0070717_10020122 3300006028 Bacteria 5245
131 Ga0070717_10040753 3300006028 Bacteria 3785
132 Ga0070717_10167410 3300006028 Bacteria 1910
133 Ga0070717_10235879 3300006028 Unclassified 1612
134 Ga0070717_10323584 3300006028 Bacteria 1374
135 Ga0070717_10326841 3300006028 Bacteria 1367
136 Ga0070715_10072301 3300006163 Bacteria 1544
137 Ga0070715_10099840 3300006163 Unclassified 1352
138 Ga0070716_100422596 3300006173 Unclassified 964
139 Ga0070716_100926862 3300006173 Unclassified 684
140 Ga0070712_100000450 3300006175 Bacteria 23564
141 Ga0070712_100218433 3300006175 Bacteria 1507
142 Ga0097621_100004894 3300006237 Bacteria 9390
143 Ga0068871_100075773 3300006358 Bacteria 2777
144 Ga0068871_100240890 3300006358 Unclassified 1572
145 Ga0068871_100596618 3300006358 Bacteria 1004
146 Ga0068871_100660262 3300006358 Unclassified 955
147 Ga0075433_10004953 3300006852 Bacteria 10430
148 Ga0075434_100000053 3300006871 Bacteria 56307
149 Ga0075434_100153496 3300006871 Bacteria 2323
150 Ga0068865_100300045 3300006881 Unclassified 1285
151 Ga0075436_100111689 3300006914 Bacteria 1908
152 Ga0097620_100020515 3300006931 Bacteria 6632
153 Ga0075435_100000246 3300007076 Bacteria 33511
154 Ga0105240_10516121 3300009093 Unclassified 1327
155 Ga0105245_10778830 3300009098 Unclassified 994
156 Ga0105247_10111333 3300009101 Bacteria 1763
157 Ga0105247_10444580 3300009101 Unclassified 933
158 Ga0114129_11618058 3300009147 Unclassified 792
159 Ga0105241_10009527 3300009174 Bacteria 7136
160 Ga0105241_10068549 3300009174 Bacteria 2749
161 Ga0105241_10694326 3300009174 Unclassified 928
162 Ga0105241_11031244 3300009174 Unclassified 771
163 Ga0105242_10007777 3300009176 Bacteria 8247
164 Ga0105242_10288522 3300009176 Bacteria 1493
165 Ga0105248_10206207 3300009177 Bacteria 2215
166 Ga0105248_10224774 3300009177 Bacteria 2113
167 Ga0105248_10293021 3300009177 Bacteria 1832
168 Ga0105248_10679778 3300009177 Unclassified 1161
169 Ga0105248_11375496 3300009177 Bacteria 799
170 Ga0105237_10124382 3300009545 Unclassified 2574
171 Ga0105237_10519892 3300009545 Bacteria 1197
172 Ga0105237_10907086 3300009545 Unclassified 888
173 Ga0105238_10101011 3300009551 Bacteria 2867
174 Ga0105238_10257404 3300009551 Unclassified 1724
175 Ga0105249_10021081 3300009553 Bacteria 5832
176 Ga0105249_10150470 3300009553 Bacteria 2240
177 Ga0105249_11516945 3300009553 Bacteria 743
178 Ga0105239_10114219 3300010375 Bacteria 2995
179 Ga0105239_12104271 3300010375 Bacteria 656
180 Ga0105246_10084151 3300011119 Bacteria 2275
181 Ga0105246_10089540 3300011119 Unclassified 2214
182 Ga0157373_10032301 3300013100 Bacteria 3768
183 Ga0157373_10103953 3300013100 Bacteria 1998
184 Ga0157371_10017776 3300013102 Bacteria 5275
185 Ga0157369_10040665 3300013105 Bacteria 5075
186 Ga0157369_10462920 3300013105 Bacteria 1313
187 Ga0157374_10002567 3300013296 Bacteria 15319
188 Ga0157374_10006396 3300013296 Bacteria 9999
189 Ga0157378_10001807 3300013297 Bacteria 19219
190 Ga0157378_10105892 3300013297 Unclassified 2572
191 Ga0157378_10146996 3300013297 Unclassified 2193
192 Ga0157378_10217656 3300013297 Bacteria 1814
193 Ga0157378_11312016 3300013297 Unclassified 765
194 Ga0163162_10007066 3300013306 Bacteria 10889
195 Ga0163162_10036999 3300013306 Bacteria 4868
196 Ga0157372_10000982 3300013307 Bacteria 31143
197 Ga0157372_10415877 3300013307 Bacteria 1567
198 Ga0157375_10098462 3300013308 Bacteria 3001
199 Ga0157375_10112779 3300013308 Bacteria 2819
200 Ga0163163_10008176 3300014325 Bacteria 9280
201 Ga0163163_10054505 3300014325 Bacteria 3951
202 Ga0163163_10209478 3300014325 Bacteria 1998
203 Ga0163163_10324026 3300014325 Bacteria 1594
204 Ga0157380_10797834 3300014326 Unclassified 961
205 Ga0157379_10000875 3300014968 Bacteria 24376
206 Ga0157379_10110865 3300014968 Bacteria 2464
207 Ga0157379_10358466 3300014968 Bacteria 1336
208 Ga0157376_10132413 3300014969 Unclassified 2227
209 Ga0157376_10271024 3300014969 Bacteria 1595
210 Ga0157376_10326059 3300014969 Unclassified 1461
211 Ga0157376_11626769 3300014969 Bacteria 680
212 Ga0184595_114471 3300019166 Bacteria 1041
213 Ga0206356_11068435 3300020070 Unclassified 1362
214 Ga0206352_10993572 3300020078 Bacteria 987
215 Ga0206350_10384784 3300020080 Bacteria 1521
216 Ga0206350_11517439 3300020080 Bacteria 1469
217 Ga0206354_10056647 3300020081 Bacteria 893
218 Ga0213873_10010222 3300021358 Bacteria 1973
219 Ga0213876_10101424 3300021384 Bacteria 1526
220 Ga0224712_10034230 3300022467 Unclassified 1867
221 Ga0224712_10037703 3300022467 Bacteria 1800
222 Ga0247553_101723 3300023672 Unclassified 958
223 Ga0207682_10238373 3300025893 Unclassified 845
224 Ga0207642_10046189 3300025899 Bacteria 1939
225 Ga0207642_10545308 3300025899 Bacteria 715
226 Ga0207710_10101497 3300025900 Unclassified 1357
227 Ga0207647_10094407 3300025904 Bacteria 1782
228 Ga0207685_10092957 3300025905 Unclassified 1274
229 Ga0207685_10096212 3300025905 Bacteria 1257
230 Ga0207685_10206593 3300025905 Unclassified 926
231 Ga0207685_10419369 3300025905 Unclassified 690
232 Ga0207699_10045272 3300025906 Bacteria 2568
233 Ga0207645_10042125 3300025907 Bacteria 2922
234 Ga0207684_10000478 3300025910 Bacteria 51768
235 Ga0207684_10028402 3300025910 Bacteria 4766
236 Ga0207684_10221247 3300025910 Bacteria 1634
237 Ga0207654_10031860 3300025911 Bacteria 2907
238 Ga0207654_11236306 3300025911 Unclassified 544
239 Ga0207707_10043951 3300025912 Bacteria 3896
240 Ga0207707_10081108 3300025912 Bacteria 2832
241 Ga0207695_10031542 3300025913 Bacteria 5809
242 Ga0207695_10347366 3300025913 Unclassified 1371
243 Ga0207695_10381020 3300025913 Unclassified 1296
244 Ga0207693_10000740 3300025915 Bacteria 29433
245 Ga0207693_10017049 3300025915 Bacteria 5798
246 Ga0207693_10084427 3300025915 Unclassified 2488
247 Ga0207663_10001920 3300025916 Bacteria 9844
248 Ga0207663_10144673 3300025916 Bacteria 1660
249 Ga0207660_10558439 3300025917 Bacteria 931
250 Ga0207660_10673129 3300025917 Bacteria 844
251 Ga0207657_10000626 3300025919 Bacteria 37555
252 Ga0207649_10084422 3300025920 Unclassified 2064
253 Ga0207649_10886709 3300025920 Unclassified 699
254 Ga0207652_10002977 3300025921 Bacteria 14157
255 Ga0207652_10775994 3300025921 Unclassified 852
256 Ga0207646_10006884 3300025922 Bacteria 11675
257 Ga0207646_11026940 3300025922 Unclassified 728
258 Ga0207681_10708714 3300025923 Bacteria 837
259 Ga0207694_10149339 3300025924 Bacteria 1882
260 Ga0207687_10006478 3300025927 Bacteria 7732
261 Ga0207687_10330031 3300025927 Bacteria 1237
262 Ga0207700_10017041 3300025928 Bacteria 4841
263 Ga0207700_10035081 3300025928 Bacteria 3609
264 Ga0207700_10202468 3300025928 Unclassified 1674
265 Ga0207700_10303459 3300025928 Unclassified 1379
266 Ga0207664_10047108 3300025929 Bacteria 3386
267 Ga0207664_11705132 3300025929 Bacteria 552
268 Ga0207644_10400260 3300025931 Bacteria 1122
269 Ga0207690_10295445 3300025932 Bacteria 1266
270 Ga0207706_10003049 3300025933 Bacteria 16140
271 Ga0207706_10455613 3300025933 Bacteria 1106
272 Ga0207686_10076670 3300025934 Unclassified 2168
273 Ga0207704_10135658 3300025938 Bacteria 1712
274 Ga0207704_10233694 3300025938 Bacteria 1369
275 Ga0207665_10013645 3300025939 Bacteria 5345
276 Ga0207665_10087036 3300025939 Bacteria 2159
277 Ga0207665_10129274 3300025939 Bacteria 1791
278 Ga0207665_10191758 3300025939 Unclassified 1485
279 Ga0207691_10679846 3300025940 Bacteria 869
280 Ga0207711_10521471 3300025941 Bacteria 1108
281 Ga0207711_11253085 3300025941 Unclassified 683
282 Ga0207689_10015430 3300025942 Bacteria 6467
283 Ga0207689_10030034 3300025942 Bacteria 4532
284 Ga0207689_10565912 3300025942 Bacteria 955
285 Ga0207679_10004451 3300025945 Bacteria 8732
286 Ga0207667_10016835 3300025949 Bacteria 8247
287 Ga0207667_10399120 3300025949 Bacteria 1400
288 Ga0207667_10688511 3300025949 Unclassified 1025
289 Ga0207712_10073845 3300025961 Bacteria 2461
290 Ga0207712_10191552 3300025961 Bacteria 1614
291 Ga0207712_11346315 3300025961 Bacteria 638
292 Ga0207668_10027088 3300025972 Bacteria 3731
293 Ga0207640_10006196 3300025981 Bacteria 6549
294 Ga0207640_10119304 3300025981 Bacteria 1886
295 Ga0207658_10013772 3300025986 Bacteria 5533
296 Ga0207677_10009246 3300026023 Bacteria 5536
297 Ga0207677_10014686 3300026023 Bacteria 4582
298 Ga0207703_10245884 3300026035 Bacteria 1610
299 Ga0207703_11584289 3300026035 Unclassified 630
300 Ga0207678_10006165 3300026067 Bacteria 10661
301 Ga0207708_10123922 3300026075 Bacteria 2016
302 Ga0207702_10086053 3300026078 Bacteria 2740
303 Ga0207702_10280509 3300026078 Bacteria 1575
304 Ga0207702_11280135 3300026078 Unclassified 727
305 Ga0207641_10030719 3300026088 Bacteria 4451
306 Ga0207641_10041169 3300026088 Bacteria 3871
307 Ga0207641_10236690 3300026088 Bacteria 1699
308 Ga0207641_10277253 3300026088 Bacteria 1575
309 Ga0207648_10008601 3300026089 Bacteria 9871
310 Ga0207648_10113699 3300026089 Bacteria 2378
311 Ga0207676_10004817 3300026095 Bacteria 9572
312 Ga0207676_10089223 3300026095 Bacteria 2526
313 Ga0207674_10002558 3300026116 Bacteria 22905
314 Ga0207674_10070951 3300026116 Bacteria 3502
315 Ga0207674_10310240 3300026116 Unclassified 1527
316 Ga0207675_100115864 3300026118 Bacteria 2532
317 Ga0207683_10023059 3300026121 Bacteria 5349
318 Ga0207698_10227430 3300026142 Unclassified 1691
319 Ga0207698_10292717 3300026142 Unclassified 1512
320 Ga0265356_1003228 3300028017 Unclassified 2078
321 Ga0268266_10169125 3300028379 Bacteria 1983
322 Ga0268266_10348446 3300028379 Bacteria 1391
323 Ga0268266_10900130 3300028379 Bacteria 856
324 Ga0268265_10016011 3300028380 Bacteria 5145
325 Ga0268265_10976957 3300028380 Unclassified 835
326 Ga0268264_10119824 3300028381 Unclassified 2318
327 Ga0268264_10190122 3300028381 Bacteria 1871
328 Ga0268264_11220257 3300028381 Unclassified 762
329 Ga0265762_1017269 3300030760 Unclassified 1312
330 Ga0265770_1006298 3300030878 Unclassified 1647
331 Ga0265773_1027994 3300031018 Unclassified 591
332 Ga0265760_10021808 3300031090 Bacteria 1855
333 Ga0265760_10090370 3300031090 Unclassified 958
334 Ga0265760_10097949 3300031090 Unclassified 924
335 Ga0265760_10110938 3300031090 Unclassified 874
336 Ga0373930_0006406 3300034816 Bacteria 1990
337 Ga0373958_0078566 3300034819 Unclassified 744
338 Ga0373940_0024989 3300035088 Unclassified 1553
339 Ga0373944_0111438 3300035089 Unclassified 935
340 Ga0373951_0022679 3300035091 Unclassified 1447
341 Ga0373952_0016861 3300035092 Bacteria 1492
342 Ga0373923_0068550 3300035111 Bacteria 1519
343 Ga0373941_0026374 3300035115 Bacteria 1687
344 Ga0373956_0144883 3300035119 Unclassified 1116
345 Ga0373960_0283021 3300035121 Unclassified 612
346 Ga0373955_0105611 3300035172 Bacteria 1622
347 Ga0373955_0367854 3300035172 Bacteria 872
348 Ga0373931_0789265 3300035691 Unclassified 632
349 Ga0373935_0411890 3300035692 Unclassified 972
350 Ga0373927_0289854 3300035695 Unclassified 1077
351 Ga0373937_0213496 3300036401 Bacteria 1816
352 Ga0373937_1027050 3300036401 Unclassified 773
353 Ga0373937_1218478 3300036401 Unclassified 701
354 Ga0373925_0376799 3300037068 Unclassified 1155
355 Ga0436365_1561172 3300039437 Unclassified 3125
356 Ga0436362_1305892 3300039453 Bacteria 2877
357 Ga0451577_0360047 3300042876 Unclassified 1320
358 Ga0466961_0015724 3300044693 Bacteria 4856
359 Ga0466963_0191108 3300044694 Bacteria 1430
360 Ga0466963_0210551 3300044694 Bacteria 1360
361 Ga0466957_0124608 3300044842 Unclassified 1645
362 Ga0466957_0328223 3300044842 Bacteria 1034
363 Ga0466957_0592818 3300044842 Bacteria 775
364 Ga0466959_0372777 3300045049 Bacteria 972
365 Ga0451576_0146820 3300045051 Bacteria 2459
366 Ga0451576_1249947 3300045051 Unclassified 775
367 Ga0466958_0336123 3300045836 Unclassified 971
368 Ga0466958_0340073 3300045836 Bacteria 965
369 Ga0495651_0719815 3300046462 Bacteria 621
370 Ga0495580_0044182 3300046472 Unclassified 3170
371 Ga0495580_0056741 3300046472 Bacteria 2757
372 Ga0495580_0062289 3300046472 Bacteria 2617
373 Ga0495580_0148867 3300046472 Bacteria 1622
374 Ga0495582_0052114 3300046473 Bacteria 2257
375 Ga0495639_0014551 3300046475 Bacteria 3407
376 Ga0495608_0508652 3300046511 Unclassified 729
377 Ga0495628_0305555 3300046516 Bacteria 1177
378 Ga0495586_0112385 3300046535 Bacteria 1517
379 Ga0495645_0300948 3300046543 Bacteria 1048
380 Ga0495667_0280598 3300046559 Bacteria 1057
381 Ga0495635_0103693 3300046663 Bacteria 1944
382 Ga0495635_0507205 3300046663 Bacteria 794
383 Ga0495588_0034579 3300046674 Bacteria 2558
384 Ga0495669_0100247 3300046684 Bacteria 1345
385 Ga0495669_0500973 3300046684 Unclassified 590
386 Ga0495624_0216283 3300046690 Unclassified 1162
387 Ga0495581_0019835 3300047315 Bacteria 3904
388 Ga0495604_0590385 3300047317 Unclassified 713
389 Ga0495593_0222834 3300047673 Unclassified 946
390 Ga0495602_0872008 3300048088 Bacteria 600
391 Ga0496100_0985363 3300048903 Unclassified 663
392 Ga0496100_1222826 3300048903 Unclassified 593
393 Ga0496101_0195760 3300048904 Unclassified 1561
394 Ga0496102_0000534 3300048905 Bacteria 41154
395 Ga0496102_0661669 3300048905 Unclassified 967
396 Ga0496102_0891081 3300048905 Bacteria 811
397 Ga0496102_0921112 3300048905 Unclassified 795
398 Ga0496103_0002384 3300048906 Bacteria 11846
399 Ga0496103_0169127 3300048906 Bacteria 1403
400 Ga0496104_0034182 3300048907 Unclassified 4738
401 Ga0496104_0234154 3300048907 Unclassified 1748
402 Ga0496104_0360500 3300048907 Bacteria 1366
403 Ga0496105_0053627 3300048908 Unclassified 3330
404 Ga0496106_0022676 3300048909 Bacteria 4665
405 Ga0496106_0150756 3300048909 Bacteria 1834
406 Ga0496106_0266383 3300048909 Unclassified 1371
407 Ga0496106_0505175 3300048909 Bacteria 971
408 Ga0496106_1360569 3300048909 Bacteria 550
409 Ga0496107_0053609 3300048910 Unclassified 2909
410 Ga0496107_0067403 3300048910 Bacteria 2597
411 Ga0496107_0194794 3300048910 Bacteria 1506
412 Ga0496108_0043281 3300048911 Bacteria 3762
413 Ga0496108_0140314 3300048911 Bacteria 2082
414 Ga0496108_0457175 3300048911 Unclassified 1115
415 Ga0496109_0201019 3300048912 Unclassified 1873
416 Ga0496109_0386433 3300048912 Bacteria 1322
417 Ga0496109_0716061 3300048912 Bacteria 938
418 Ga0496111_0176255 3300048914 Bacteria 1589
419 Ga0496111_0305566 3300048914 Bacteria 1179
420 Ga0496112_0056770 3300048915 Bacteria 3854
421 Ga0496112_0118016 3300048915 Bacteria 2623
422 Ga0496113_0083345 3300048916 Bacteria 2453
423 Ga0496113_0304501 3300048916 Bacteria 1276
424 Ga0496113_0544509 3300048916 Unclassified 931
425 Ga0496113_0913901 3300048916 Unclassified 694
426 Ga0496114_0039596 3300048917 Bacteria 3900
427 Ga0496115_0131219 3300048918 Bacteria 2065
428 nmdc:mga05p37_1498019_c1 3300050507 Bacteria 672
429 nmdc:mga0n895_1191_c1 3300050512 Bacteria 19133
430 nmdc:mga0n895_281507_c1 3300050512 Bacteria 1686
431 nmdc:mga0n895_636081_c1 3300050512 Unclassified 1067
432 nmdc:mga0rr50_4233_c1 3300050513 Bacteria 8394
433 nmdc:mga0rr50_440198_c1 3300050513 Unclassified 1104
434 nmdc:mga08x19_53739_c1 3300050514 Bacteria 2592
435 nmdc:mga0a205_534_c1 3300050515 Bacteria 29998
436 Ga0495595_0106824 3300053084 Bacteria 1355
437 Ga0495619_0047205 3300053085 Bacteria 2835
438 Ga0495619_0591987 3300053085 Unclassified 759
439 Ga0587114_042701 3300059655 Unclassified 741
440 Ga0466962_0033025 3300061719 Bacteria 2476
441 Ga0070713_100547790
442 Ga0058863_11691543
443 Ga0058863_11772320
444 Ga0058861_11755001
445 Ga0058862_12319575
446 Ga0070658_10259116
447 Ga0070676_10032621
448 Ga0070683_100491973
449 Ga0070690_100045162
450 Ga0070690_100723231
451 Ga0070670_100049228
452 Ga0068869_100004754
453 Ga0068869_100127699
454 Ga0068869_100634964
455 Ga0070680_100298860
456 Ga0070682_100031907
457 Ga0070682_100534191
458 Ga0068868_100021790
459 Ga0068868_100039977
460 Ga0070660_100362950
461 Ga0070691_10022935
462 Ga0070687_100353983
463 Ga0070661_100011631
464 Ga0070661_100022055
465 Ga0070692_10053586
466 Ga0070669_100928986
467 Ga0070671_100329648
468 Ga0070671_100435098
469 Ga0070674_100240633
470 Ga0070659_100056145
471 Ga0070659_100071469
472 Ga0070667_100009884
473 Ga0070667_100877961
474 Ga0070709_10025942
475 Ga0070709_10337095
476 Ga0070709_11166521
477 Ga0070714_100042894
478 Ga0070714_101934672
479 Ga0070713_100002538
480 Ga0070713_100005650
481 Ga0070713_100132821
482 Ga0070713_100213210
483 Ga0070710_10030633
484 Ga0070711_100058185
485 Ga0070711_100193883
486 Ga0070711_100330365
487 Ga0070705_100156553
488 Ga0070700_100321588
489 Ga0070708_100019060
490 Ga0070708_100033497
491 Ga0070708_100127195
492 Ga0070708_100224158
493 Ga0070708_100253638
494 Ga0070708_100288927
495 Ga0070708_100720124
496 Ga0070708_100721679
497 Ga0070708_100829525
498 Ga0070663_100037699
499 Ga0070662_100002651
500 Ga0070662_100362102
501 Ga0070681_10052493
502 Ga0070681_10069468
503 Ga0070681_10236555
504 Ga0070681_10759908
505 Ga0068867_100071273
506 Ga0068867_100200680
507 Ga0068867_100350048
508 Ga0070685_10094278
509 Ga0070706_100000188
510 Ga0070706_100008535
511 Ga0070706_100104608
512 Ga0070707_100177981
513 Ga0070698_100008014
514 Ga0070699_100019091
515 Ga0070699_100020261
516 Ga0070699_100102702
517 Ga0070679_100246899
518 Ga0070679_100775375
519 Ga0070684_100044260
520 Ga0070684_100077475
521 Ga0070684_100490851
522 Ga0070697_100000146
523 Ga0070697_100003243
524 Ga0070697_100007340
525 Ga0070697_100016459
526 Ga0070697_100057821
527 Ga0068853_100034418
528 Ga0068853_100894793
529 Ga0070686_100074617
530 Ga0070695_100071571
531 Ga0070696_100379286
532 Ga0070665_100086213
533 Ga0070665_100216806
534 Ga0070665_100320891
535 Ga0068855_100002442
536 Ga0068855_100222890
537 Ga0068855_100923999
538 Ga0070664_100017382
539 Ga0070664_100100842
540 Ga0070664_100642356
541 Ga0068857_100004113
542 Ga0068857_100039831
543 Ga0068854_100009419
544 Ga0068854_100056323
545 Ga0068856_100014573
546 Ga0068856_100060967
547 Ga0068856_100112465
548 Ga0068856_100161552
549 Ga0068852_100022711
550 Ga0068852_100089291
551 Ga0068859_100020515
552 Ga0068864_100002826
553 Ga0068864_100045671
554 Ga0068864_100168828
555 Ga0068866_10063480
556 Ga0068866_10129401
557 Ga0068851_10036284
558 Ga0068863_100167853
559 Ga0068863_100395208
560 Ga0068858_100001259
561 Ga0068858_100018380
562 Ga0068858_100320961
563 Ga0068858_100597694
564 Ga0068858_100734658
565 Ga0068860_100532869
566 Ga0068862_100401754
567 Ga0068862_101392364
568 Ga0081540_1105058
569 Ga0070717_10006550
570 Ga0070717_10020122
571 Ga0070717_10040753
572 Ga0070717_10167410
573 Ga0070717_10235879
574 Ga0070717_10323584
575 Ga0070717_10326841
576 Ga0070715_10072301
577 Ga0070715_10099840
578 Ga0070716_100422596
579 Ga0070716_100926862
580 Ga0070712_100000450
581 Ga0070712_100218433
582 Ga0097621_100004894
583 Ga0068871_100075773
584 Ga0068871_100240890
585 Ga0068871_100596618
586 Ga0068871_100660262
587 Ga0075433_10004953
588 Ga0075434_100000053
589 Ga0075434_100153496
590 Ga0068865_100300045
591 Ga0075436_100111689
592 Ga0097620_100020515
593 Ga0075435_100000246
594 Ga0105240_10516121
595 Ga0105245_10778830
596 Ga0105247_10111333
597 Ga0105247_10444580
598 Ga0114129_11618058
599 Ga0105241_10009527
600 Ga0105241_10068549
601 Ga0105241_10694326
602 Ga0105241_11031244
603 Ga0105242_10007777
604 Ga0105242_10288522
605 Ga0105248_10206207
606 Ga0105248_10224774
607 Ga0105248_10293021
608 Ga0105248_10679778
609 Ga0105248_11375496
610 Ga0105237_10124382
611 Ga0105237_10519892
612 Ga0105237_10907086
613 Ga0105238_10101011
614 Ga0105238_10257404
615 Ga0105249_10021081
616 Ga0105249_10150470
617 Ga0105249_11516945
618 Ga0105239_10114219
619 Ga0105239_12104271
620 Ga0105246_10084151
621 Ga0105246_10089540
622 Ga0157373_10032301
623 Ga0157373_10103953
624 Ga0157371_10017776
625 Ga0157369_10040665
626 Ga0157369_10462920
627 Ga0157374_10002567
628 Ga0157374_10006396
629 Ga0157378_10001807
630 Ga0157378_10105892
631 Ga0157378_10146996
632 Ga0157378_10217656
633 Ga0157378_11312016
634 Ga0163162_10007066
635 Ga0163162_10036999
636 Ga0157372_10000982
637 Ga0157372_10415877
638 Ga0157375_10098462
639 Ga0157375_10112779
640 Ga0163163_10008176
641 Ga0163163_10054505
642 Ga0163163_10209478
643 Ga0163163_10324026
644 Ga0157380_10797834
645 Ga0157379_10000875
646 Ga0157379_10110865
647 Ga0157379_10358466
648 Ga0157376_10132413
649 Ga0157376_10271024
650 Ga0157376_10326059
651 Ga0157376_11626769
652 Ga0184595_114471
653 Ga0206356_11068435
654 Ga0206352_10993572
655 Ga0206350_10384784
656 Ga0206350_11517439
657 Ga0206354_10056647
658 Ga0213873_10010222
659 Ga0213876_10101424
660 Ga0224712_10034230
661 Ga0224712_10037703
662 Ga0247553_101723
663 Ga0207682_10238373
664 Ga0207642_10046189
665 Ga0207642_10545308
666 Ga0207710_10101497
667 Ga0207647_10094407
668 Ga0207685_10092957
669 Ga0207685_10096212
670 Ga0207685_10206593
671 Ga0207685_10419369
672 Ga0207699_10045272
673 Ga0207645_10042125
674 Ga0207684_10000478
675 Ga0207684_10028402
676 Ga0207684_10221247
677 Ga0207654_10031860
678 Ga0207654_11236306
679 Ga0207707_10043951
680 Ga0207707_10081108
681 Ga0207695_10031542
682 Ga0207695_10347366
683 Ga0207695_10381020
684 Ga0207693_10000740
685 Ga0207693_10017049
686 Ga0207693_10084427
687 Ga0207663_10001920
688 Ga0207663_10144673
689 Ga0207660_10558439
690 Ga0207660_10673129
691 Ga0207657_10000626
692 Ga0207649_10084422
693 Ga0207649_10886709
694 Ga0207652_10002977
695 Ga0207652_10775994
696 Ga0207646_10006884
697 Ga0207646_11026940
698 Ga0207681_10708714
699 Ga0207694_10149339
700 Ga0207687_10006478
701 Ga0207687_10330031
702 Ga0207700_10017041
703 Ga0207700_10035081
704 Ga0207700_10202468
705 Ga0207700_10303459
706 Ga0207664_10047108
707 Ga0207664_11705132
708 Ga0207644_10400260
709 Ga0207690_10295445
710 Ga0207706_10003049
711 Ga0207706_10455613
712 Ga0207686_10076670
713 Ga0207704_10135658
714 Ga0207704_10233694
715 Ga0207665_10013645
716 Ga0207665_10087036
717 Ga0207665_10129274
718 Ga0207665_10191758
719 Ga0207691_10679846
720 Ga0207711_10521471
721 Ga0207711_11253085
722 Ga0207689_10015430
723 Ga0207689_10030034
724 Ga0207689_10565912
725 Ga0207679_10004451
726 Ga0207667_10016835
727 Ga0207667_10399120
728 Ga0207667_10688511
729 Ga0207712_10073845
730 Ga0207712_10191552
731 Ga0207712_11346315
732 Ga0207668_10027088
733 Ga0207640_10006196
734 Ga0207640_10119304
735 Ga0207658_10013772
736 Ga0207677_10009246
737 Ga0207677_10014686
738 Ga0207703_10245884
739 Ga0207703_11584289
740 Ga0207678_10006165
741 Ga0207708_10123922
742 Ga0207702_10086053
743 Ga0207702_10280509
744 Ga0207702_11280135
745 Ga0207641_10030719
746 Ga0207641_10041169
747 Ga0207641_10236690
748 Ga0207641_10277253
749 Ga0207648_10008601
750 Ga0207648_10113699
751 Ga0207676_10004817
752 Ga0207676_10089223
753 Ga0207674_10002558
754 Ga0207674_10070951
755 Ga0207674_10310240
756 Ga0207675_100115864
757 Ga0207683_10023059
758 Ga0207698_10227430
759 Ga0207698_10292717
760 Ga0265356_1003228
761 Ga0268266_10169125
762 Ga0268266_10348446
763 Ga0268266_10900130
764 Ga0268265_10016011
765 Ga0268265_10976957
766 Ga0268264_10119824
767 Ga0268264_10190122
768 Ga0268264_11220257
769 Ga0265762_1017269
770 Ga0265770_1006298
771 Ga0265773_1027994
772 Ga0265760_10021808
773 Ga0265760_10090370
774 Ga0265760_10097949
775 Ga0265760_10110938
776 Ga0373930_0006406
777 Ga0373958_0078566
778 Ga0373940_0024989
779 Ga0373944_0111438
780 Ga0373951_0022679
781 Ga0373952_0016861
782 Ga0373923_0068550
783 Ga0373941_0026374
784 Ga0373956_0144883
785 Ga0373960_0283021
786 Ga0373955_0105611
787 Ga0373955_0367854
788 Ga0373931_0789265
789 Ga0373935_0411890
790 Ga0373927_0289854
791 Ga0373937_0213496
792 Ga0373937_1027050
793 Ga0373937_1218478
794 Ga0373925_0376799
795 Ga0436365_1561172
796 Ga0436362_1305892
797 Ga0451577_0360047
798 Ga0466961_0015724
799 Ga0466963_0191108
800 Ga0466963_0210551
801 Ga0466957_0124608
802 Ga0466957_0328223
803 Ga0466957_0592818
804 Ga0466959_0372777
805 Ga0451576_0146820
806 Ga0451576_1249947
807 Ga0466958_0336123
808 Ga0466958_0340073
809 Ga0495651_0719815
810 Ga0495580_0044182
811 Ga0495580_0056741
812 Ga0495580_0062289
813 Ga0495580_0148867
814 Ga0495582_0052114
815 Ga0495639_0014551
816 Ga0495608_0508652
817 Ga0495628_0305555
818 Ga0495586_0112385
819 Ga0495645_0300948
820 Ga0495667_0280598
821 Ga0495635_0103693
822 Ga0495635_0507205
823 Ga0495588_0034579
824 Ga0495669_0100247
825 Ga0495669_0500973
826 Ga0495624_0216283
827 Ga0495581_0019835
828 Ga0495604_0590385
829 Ga0495593_0222834
830 Ga0495602_0872008
831 Ga0496100_0985363
832 Ga0496100_1222826
833 Ga0496101_0195760
834 Ga0496102_0000534
835 Ga0496102_0661669
836 Ga0496102_0891081
837 Ga0496102_0921112
838 Ga0496103_0002384
839 Ga0496103_0169127
840 Ga0496104_0034182
841 Ga0496104_0234154
842 Ga0496104_0360500
843 Ga0496105_0053627
844 Ga0496106_0022676
845 Ga0496106_0150756
846 Ga0496106_0266383
847 Ga0496106_0505175
848 Ga0496106_1360569
849 Ga0496107_0053609
850 Ga0496107_0067403
851 Ga0496107_0194794
852 Ga0496108_0043281
853 Ga0496108_0140314
854 Ga0496108_0457175
855 Ga0496109_0201019
856 Ga0496109_0386433
857 Ga0496109_0716061
858 Ga0496111_0176255
859 Ga0496111_0305566
860 Ga0496112_0056770
861 Ga0496112_0118016
862 Ga0496113_0083345
863 Ga0496113_0304501
864 Ga0496113_0544509
865 Ga0496113_0913901
866 Ga0496114_0039596
867 Ga0496115_0131219
868 nmdc:mga05p37_1498019_c1
869 nmdc:mga0n895_1191_c1
870 nmdc:mga0n895_281507_c1
871 nmdc:mga0n895_636081_c1
872 nmdc:mga0rr50_4233_c1
873 nmdc:mga0rr50_440198_c1
874 nmdc:mga08x19_53739_c1
875 nmdc:mga0a205_534_c1
876 Ga0495595_0106824
877 Ga0495619_0047205
878 Ga0495619_0591987
879 Ga0587114_042701
880 Ga0466962_0033025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map