F444091

General Info

Members Datasets Scaffolds Average Seq Length
438 185 876 360

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_127606_c1|nmdc:mga06r32_127606_c1_206_1456
Length 393
Sequence MVRSERTTRRFYEHCGKVHAPVSMLFPPIDPNERFRERRALGMGAQFVGTDEGAQPVTDLATLAAIPSSGPRTLPIELRGVHVTMGLASLPGKLDEYLDLERDGLTALELDVKDENGEIGFVTPAVPRLAVSIGAARDYYEAHKAAKRVHDRGIYLVGRVVVFEDPVLSHARPDLAVRTSGGGVWRDAAGLGWTNPYDRRVWDYNVDVAVAAAKSGFDEIMFDYVRFPSDGDVDGAVYRNERSLAKRTAIPQFLRYAKSRLEPYGVRISAAVFGLSGARDLGIGQLPRKMAPYLDTVYAMTYPSLFGAGELGLQDPSTAPGATVARALRRFELALRGQDALVVPWVQDFSFSVPYDLDEVRAQIDAARLSGAKGYMLWNAEGLYTDGALAPAS

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 4.57
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 4.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_127606_c1 3300050510 Bacteria 2513
2 ARCol0yngRDRAFT_1000918 3300000652 Bacteria 2645
3 Ga0070683_100057004 3300005329 Bacteria 3629
4 Ga0070690_100028640 3300005330 Bacteria 3451
5 Ga0070690_100084585 3300005330 Bacteria 2080
6 Ga0070670_100004186 3300005331 Bacteria 12074
7 Ga0070670_100025637 3300005331 Bacteria 5072
8 Ga0068869_100089683 3300005334 Bacteria 2309
9 Ga0070680_100001439 3300005336 Bacteria 17241
10 Ga0068868_100037044 3300005338 Bacteria 3779
11 Ga0068868_100106961 3300005338 Bacteria 2269
12 Ga0068868_100111667 3300005338 Bacteria 2222
13 Ga0070689_100014123 3300005340 Bacteria 5794
14 Ga0070661_100216785 3300005344 Bacteria 1467
15 Ga0070692_10002531 3300005345 Bacteria 7111
16 Ga0070668_100228450 3300005347 Bacteria 1537
17 Ga0070675_100023311 3300005354 Bacteria 4948
18 Ga0070675_100201425 3300005354 Bacteria 1728
19 Ga0070671_100010783 3300005355 Bacteria 7332
20 Ga0070671_100304209 3300005355 Bacteria 1358
21 Ga0070674_100008245 3300005356 Bacteria 6192
22 Ga0070674_100022938 3300005356 Bacteria 4030
23 Ga0070674_100059220 3300005356 Bacteria 2666
24 Ga0070673_100134460 3300005364 Bacteria 2080
25 Ga0070688_100003997 3300005365 Bacteria 7645
26 Ga0070688_100097160 3300005365 Bacteria 1935
27 Ga0070659_100164779 3300005366 Bacteria 1813
28 Ga0070659_100264871 3300005366 Bacteria 1427
29 Ga0070713_100037760 3300005436 Bacteria 3906
30 Ga0070701_10008989 3300005438 Bacteria 4355
31 Ga0070701_10020995 3300005438 Bacteria 3109
32 Ga0070705_100113560 3300005440 Bacteria 1736
33 Ga0070700_100086817 3300005441 Bacteria 2032
34 Ga0070663_100033893 3300005455 Bacteria 3531
35 Ga0070678_100033436 3300005456 Bacteria 3570
36 Ga0070662_100013464 3300005457 Bacteria 5444
37 Ga0070662_100032163 3300005457 Bacteria 3685
38 Ga0070662_100127500 3300005457 Bacteria 1958
39 Ga0070681_10110340 3300005458 Bacteria 2691
40 Ga0068867_100077648 3300005459 Bacteria 2496
41 Ga0068867_100154390 3300005459 Bacteria 1805
42 Ga0070685_10004772 3300005466 Bacteria 6864
43 Ga0070685_10066709 3300005466 Bacteria 2121
44 Ga0070699_100045411 3300005518 Bacteria 3802
45 Ga0070679_100030712 3300005530 Bacteria 5306
46 Ga0070679_100073918 3300005530 Bacteria 3400
47 Ga0070679_100108072 3300005530 Bacteria 2767
48 Ga0070684_100011152 3300005535 Bacteria 7155
49 Ga0070684_100041555 3300005535 Bacteria 3965
50 Ga0070684_100218251 3300005535 Bacteria 1740
51 Ga0068853_100011384 3300005539 Bacteria 7225
52 Ga0068853_100212966 3300005539 Bacteria 1762
53 Ga0070672_100171817 3300005543 Bacteria 1803
54 Ga0070686_100016719 3300005544 Bacteria 4272
55 Ga0070693_100086308 3300005547 Bacteria 1883
56 Ga0070693_100112844 3300005547 Bacteria 1675
57 Ga0070665_100121490 3300005548 Bacteria 2613
58 Ga0070665_100286076 3300005548 Bacteria 1650
59 Ga0070704_100011285 3300005549 Bacteria 5473
60 Ga0070704_100081208 3300005549 Bacteria 2387
61 Ga0068855_100155775 3300005563 Bacteria 2596
62 Ga0068857_100011548 3300005577 Bacteria 7685
63 Ga0068856_100026978 3300005614 Bacteria 5603
64 Ga0070702_100021295 3300005615 Bacteria 3409
65 Ga0068852_100057296 3300005616 Bacteria 3371
66 Ga0068851_10139437 3300005834 Unclassified 1318
67 Ga0068870_10001334 3300005840 Bacteria 9947
68 Ga0068870_10028024 3300005840 Bacteria 2824
69 Ga0068863_100100300 3300005841 Bacteria 2752
70 Ga0068858_100027442 3300005842 Bacteria 5289
71 Ga0068860_100037378 3300005843 Bacteria 4648
72 Ga0081455_10008727 3300005937 Bacteria 10499
73 Ga0081455_10015740 3300005937 Bacteria 7325
74 Ga0081455_10056920 3300005937 Bacteria 3317
75 Ga0081538_10000059 3300005981 Bacteria 101468
76 Ga0081538_10001038 3300005981 Bacteria 29617
77 Ga0081538_10004092 3300005981 Bacteria 13560
78 Ga0081540_1001185 3300005983 Bacteria 22837
79 Ga0081539_10000041 3300005985 Bacteria 292660
80 Ga0081539_10006784 3300005985 Bacteria 10742
81 Ga0070717_10228194 3300006028 Bacteria 1639
82 Ga0075365_10008497 3300006038 Bacteria 5839
83 Ga0070712_100083351 3300006175 Bacteria 2321
84 Ga0068871_100070095 3300006358 Bacteria 2881
85 Ga0075428_100002710 3300006844 Bacteria 19287
86 Ga0075428_100072797 3300006844 Bacteria 3753
87 Ga0075428_100175576 3300006844 Bacteria 2320
88 Ga0075428_100203575 3300006844 Bacteria 2139
89 Ga0075428_100307793 3300006844 Bacteria 1703
90 Ga0075430_100004923 3300006846 Bacteria 11230
91 Ga0075431_100029053 3300006847 Bacteria 5688
92 Ga0075431_100133613 3300006847 Bacteria 2558
93 Ga0075433_10161121 3300006852 Bacteria 1997
94 Ga0075433_10163861 3300006852 Bacteria 1979
95 Ga0075434_100245317 3300006871 Bacteria 1811
96 Ga0075429_100034159 3300006880 Bacteria 4418
97 Ga0075429_100373446 3300006880 Bacteria 1248
98 Ga0068865_100004918 3300006881 Bacteria 8076
99 Ga0068865_100020999 3300006881 Bacteria 4243
100 Ga0068865_100022281 3300006881 Bacteria 4130
101 Ga0068865_100024408 3300006881 Bacteria 3966
102 Ga0068865_100035443 3300006881 Bacteria 3356
103 Ga0068865_100178400 3300006881 Bacteria 1634
104 Ga0075436_100013143 3300006914 Bacteria 5677
105 Ga0075435_100110436 3300007076 Bacteria 2287
106 Ga0111539_10013119 3300009094 Bacteria 10364
107 Ga0111539_10092283 3300009094 Bacteria 3558
108 Ga0111539_10125823 3300009094 Bacteria 3003
109 Ga0111539_10382642 3300009094 Unclassified 1638
110 Ga0105245_10024429 3300009098 Bacteria 5307
111 Ga0105245_10043540 3300009098 Bacteria 4004
112 Ga0105245_10116237 3300009098 Bacteria 2494
113 Ga0114129_10028013 3300009147 Bacteria 7979
114 Ga0114129_10053756 3300009147 Bacteria 5649
115 Ga0114129_10076752 3300009147 Bacteria 4651
116 Ga0114129_10118312 3300009147 Bacteria 3650
117 Ga0114129_10195977 3300009147 Bacteria 2739
118 Ga0114129_10210483 3300009147 Bacteria 2629
119 Ga0114129_10410450 3300009147 Bacteria 1783
120 Ga0114129_10452597 3300009147 Bacteria 1683
121 Ga0105243_10002886 3300009148 Bacteria 14242
122 Ga0105243_10013026 3300009148 Bacteria 6283
123 Ga0105243_10063395 3300009148 Bacteria 2962
124 Ga0105242_10103539 3300009176 Bacteria 2415
125 Ga0105242_10164348 3300009176 Bacteria 1946
126 Ga0105248_10046557 3300009177 Bacteria 4861
127 Ga0105248_10283309 3300009177 Unclassified 1866
128 Ga0105249_10070967 3300009553 Bacteria 3217
129 Ga0105239_10013046 3300010375 Bacteria 9236
130 Ga0105239_10259736 3300010375 Bacteria 1952
131 Ga0105246_10002150 3300011119 Bacteria 11883
132 Ga0157371_10067574 3300013102 Bacteria 2530
133 Ga0157371_10099323 3300013102 Bacteria 2064
134 Ga0157369_10055941 3300013105 Bacteria 4258
135 Ga0157374_10078527 3300013296 Bacteria 3126
136 Ga0157372_10373926 3300013307 Bacteria 1660
137 Ga0157375_10017505 3300013308 Bacteria 6469
138 Ga0157375_10099855 3300013308 Bacteria 2982
139 Ga0157375_10246626 3300013308 Unclassified 1946
140 Ga0163163_10149389 3300014325 Bacteria 2381
141 Ga0157380_10056964 3300014326 Bacteria 3110
142 Ga0157380_10213974 3300014326 Bacteria 1720
143 Ga0157380_10275473 3300014326 Bacteria 1536
144 Ga0157377_10008757 3300014745 Bacteria 4947
145 Ga0157377_10010749 3300014745 Bacteria 4541
146 Ga0157377_10090541 3300014745 Bacteria 1806
147 Ga0157377_10209876 3300014745 Unclassified 1241
148 Ga0157379_10007228 3300014968 Bacteria 9606
149 Ga0157379_10132303 3300014968 Bacteria 2245
150 Ga0157376_10022042 3300014969 Bacteria 4957
151 Ga0207688_10010574 3300025901 Bacteria 5017
152 Ga0207688_10016919 3300025901 Bacteria 3961
153 Ga0207688_10031092 3300025901 Bacteria 2946
154 Ga0207647_10097129 3300025904 Bacteria 1752
155 Ga0207645_10024069 3300025907 Bacteria 3951
156 Ga0207643_10003863 3300025908 Bacteria 8059
157 Ga0207643_10047096 3300025908 Bacteria 2438
158 Ga0207705_10187802 3300025909 Unclassified 1562
159 Ga0207707_10082131 3300025912 Bacteria 2813
160 Ga0207693_10102417 3300025915 Bacteria 2245
161 Ga0207660_10020089 3300025917 Bacteria 4478
162 Ga0207662_10024351 3300025918 Bacteria 3484
163 Ga0207657_10040322 3300025919 Bacteria 4138
164 Ga0207652_10043531 3300025921 Bacteria 3823
165 Ga0207681_10028072 3300025923 Bacteria 3644
166 Ga0207650_10001636 3300025925 Bacteria 15953
167 Ga0207659_10036759 3300025926 Bacteria 3395
168 Ga0207687_10093873 3300025927 Bacteria 2195
169 Ga0207700_10211223 3300025928 Bacteria 1641
170 Ga0207706_10068330 3300025933 Bacteria 3127
171 Ga0207706_10073483 3300025933 Bacteria 3007
172 Ga0207709_10089050 3300025935 Bacteria 2011
173 Ga0207709_10125862 3300025935 Bacteria 1738
174 Ga0207669_10022494 3300025937 Bacteria 3350
175 Ga0207669_10086901 3300025937 Bacteria 2023
176 Ga0207704_10054060 3300025938 Bacteria 2445
177 Ga0207691_10006191 3300025940 Bacteria 11559
178 Ga0207691_10030061 3300025940 Bacteria 5079
179 Ga0207691_10051487 3300025940 Bacteria 3764
180 Ga0207689_10040246 3300025942 Bacteria 3869
181 Ga0207661_10014827 3300025944 Bacteria 5716
182 Ga0207712_10081954 3300025961 Bacteria 2351
183 Ga0207639_10280067 3300026041 Bacteria 1466
184 Ga0207708_10008954 3300026075 Bacteria 7406
185 Ga0207708_10023773 3300026075 Bacteria 4632
186 Ga0207702_10032147 3300026078 Bacteria 4379
187 Ga0207641_10092653 3300026088 Bacteria 2647
188 Ga0207648_10014277 3300026089 Bacteria 7341
189 Ga0207648_10088100 3300026089 Bacteria 2710
190 Ga0207648_10181183 3300026089 Bacteria 1865
191 Ga0207676_10071562 3300026095 Bacteria 2785
192 Ga0207674_10019100 3300026116 Bacteria 7430
193 Ga0207674_10083504 3300026116 Bacteria 3194
194 Ga0207675_100012983 3300026118 Bacteria 7776
195 Ga0207698_10017055 3300026142 Bacteria 4917
196 Ga0207698_10039101 3300026142 Bacteria 3511
197 Ga0207428_10011660 3300027907 Bacteria 7755
198 Ga0207428_10025802 3300027907 Bacteria 4913
199 Ga0268265_10146796 3300028380 Bacteria 1983
200 Ga0307416_100181415 3300032002 Unclassified 1974
201 Ga0373948_0027941 3300034817 Unclassified 1120
202 Ga0373941_0004348 3300035115 Bacteria 3266
203 Ga0395898_0281930 3300037466 Unclassified 1585
204 Ga0395905_0167061 3300037471 Bacteria 2068
205 Ga0439448_0047368 3300042005 Unclassified 1402
206 Ga0495588_0112357 3300046674 Unclassified 1435
207 Ga0495657_0114940 3300046675 Bacteria 1700
208 Ga0495669_0112867 3300046684 Bacteria 1270
209 Ga0495589_0050981 3300046794 Bacteria 2047
210 Ga0495581_0090305 3300047315 Bacteria 1777
211 Ga0495604_0137914 3300047317 Bacteria 1746
212 Ga0495680_0028230 3300047322 Bacteria 4602
213 Ga0495684_0022817 3300047471 Bacteria 4813
214 Ga0496100_0004896 3300048903 Bacteria 7157
215 Ga0496104_0019693 3300048907 Bacteria 6179
216 Ga0496104_0020628 3300048907 Bacteria 6043
217 Ga0496104_0325931 3300048907 Bacteria 1449
218 Ga0496105_0001421 3300048908 Bacteria 16822
219 Ga0496105_0040567 3300048908 Bacteria 3838
220 Ga0496105_0156883 3300048908 Bacteria 1869
221 Ga0496106_0009515 3300048909 Bacteria 7179
222 Ga0496107_0048986 3300048910 Bacteria 3044
223 Ga0496108_0151807 3300048911 Bacteria 1999
224 Ga0496109_0011225 3300048912 Bacteria 7690
225 Ga0496109_0066312 3300048912 Bacteria 3305
226 Ga0496109_0072125 3300048912 Bacteria 3171
227 Ga0496109_0136087 3300048912 Bacteria 2296
228 Ga0496110_0008390 3300048913 Bacteria 8312
229 Ga0496110_0013256 3300048913 Bacteria 6807
230 Ga0496110_0241597 3300048913 Bacteria 1643
231 Ga0496111_0010934 3300048914 Bacteria 6105
232 Ga0496111_0274322 3300048914 Unclassified 1251
233 Ga0496113_0003267 3300048916 Bacteria 9670
234 Ga0501031_0004004 3300049568 Bacteria 9503
235 Ga0501031_0004843 3300049568 Bacteria 8746
236 Ga0501031_0022433 3300049568 Bacteria 4114
237 Ga0501031_0031222 3300049568 Bacteria 3475
238 Ga0501031_0054176 3300049568 Bacteria 2614
239 Ga0501031_0082012 3300049568 Bacteria 2102
240 Ga0501032_0037160 3300049569 Bacteria 3321
241 Ga0501033_0038881 3300049570 Bacteria 3554
242 Ga0501033_0046670 3300049570 Bacteria 3221
243 Ga0501033_0100639 3300049570 Bacteria 2109
244 Ga0501033_0119361 3300049570 Bacteria 1915
245 Ga0501034_0190395 3300049571 Bacteria 2014
246 Ga0501034_0245305 3300049571 Bacteria 1736
247 Ga0501036_0001775 3300049572 Bacteria 16746
248 Ga0501036_0016302 3300049572 Bacteria 6208
249 Ga0501036_0054177 3300049572 Bacteria 3397
250 Ga0501036_0087188 3300049572 Bacteria 2638
251 Ga0501036_0105547 3300049572 Bacteria 2383
252 Ga0501036_0134483 3300049572 Bacteria 2087
253 Ga0501036_0148289 3300049572 Bacteria 1979
254 Ga0501036_0152440 3300049572 Bacteria 1949
255 Ga0501037_0007784 3300049573 Bacteria 7844
256 Ga0501038_0063650 3300049574 Bacteria 3147
257 Ga0501039_0006457 3300049575 Bacteria 8912
258 Ga0501039_0029739 3300049575 Bacteria 4209
259 Ga0501039_0152013 3300049575 Bacteria 1818
260 Ga0501040_0004612 3300049576 Bacteria 8937
261 Ga0501040_0006969 3300049576 Bacteria 7320
262 Ga0501040_0017736 3300049576 Bacteria 4724
263 Ga0501040_0039545 3300049576 Bacteria 3207
264 Ga0501040_0085017 3300049576 Bacteria 2195
265 Ga0501040_0100750 3300049576 Bacteria 2014
266 Ga0501040_0133214 3300049576 Bacteria 1748
267 Ga0501040_0171599 3300049576 Bacteria 1536
268 Ga0501040_0193467 3300049576 Bacteria 1444
269 Ga0501040_0227891 3300049576 Bacteria 1326
270 Ga0501041_0002259 3300049577 Bacteria 10896
271 Ga0501041_0006249 3300049577 Bacteria 6964
272 Ga0501041_0032752 3300049577 Bacteria 3142
273 Ga0501041_0044897 3300049577 Bacteria 2685
274 Ga0501041_0066757 3300049577 Bacteria 2204
275 Ga0501042_0019090 3300049578 Bacteria 4757
276 Ga0501042_0029578 3300049578 Bacteria 3864
277 Ga0501042_0059699 3300049578 Bacteria 2723
278 Ga0501042_0089205 3300049578 Bacteria 2212
279 Ga0501042_0114112 3300049578 Bacteria 1945
280 Ga0501042_0140769 3300049578 Bacteria 1739
281 Ga0501042_0230647 3300049578 Bacteria 1335
282 Ga0501043_0016039 3300049579 Bacteria 5874
283 Ga0501043_0025145 3300049579 Bacteria 4671
284 Ga0501046_0002405 3300049580 Bacteria 17562
285 Ga0501046_0013675 3300049580 Bacteria 6863
286 Ga0501046_0058393 3300049580 Bacteria 3025
287 Ga0501046_0087873 3300049580 Bacteria 2394
288 Ga0501046_0095598 3300049580 Bacteria 2282
289 Ga0501048_0011760 3300049582 Bacteria 6525
290 Ga0501048_0015503 3300049582 Bacteria 5630
291 Ga0501048_0048832 3300049582 Bacteria 3017
292 Ga0501048_0066700 3300049582 Bacteria 2544
293 Ga0501048_0153166 3300049582 Unclassified 1631
294 Ga0501048_0231150 3300049582 Bacteria 1312
295 Ga0501067_0011477 3300049583 Bacteria 4907
296 Ga0501067_0026129 3300049583 Bacteria 3236
297 Ga0501067_0030881 3300049583 Bacteria 2973
298 Ga0501067_0052305 3300049583 Bacteria 2263
299 Ga0501068_0000451 3300049584 Bacteria 20910
300 Ga0501068_0003498 3300049584 Bacteria 8473
301 Ga0501068_0012529 3300049584 Bacteria 4812
302 Ga0501068_0050262 3300049584 Bacteria 2520
303 Ga0501068_0097953 3300049584 Bacteria 1815
304 Ga0501068_0164427 3300049584 Unclassified 1399
305 Ga0501069_0016923 3300049585 Bacteria 3918
306 Ga0501069_0023167 3300049585 Bacteria 3384
307 Ga0501069_0171104 3300049585 Bacteria 1253
308 Ga0501070_0010166 3300049586 Bacteria 7966
309 Ga0501070_0080581 3300049586 Unclassified 2694
310 Ga0501070_0100690 3300049586 Bacteria 2390
311 Ga0501071_0003854 3300049587 Bacteria 9442
312 Ga0501071_0004769 3300049587 Bacteria 8632
313 Ga0501071_0005105 3300049587 Bacteria 8403
314 Ga0501071_0011657 3300049587 Bacteria 5933
315 Ga0501071_0012653 3300049587 Bacteria 5732
316 Ga0501071_0013262 3300049587 Bacteria 5616
317 Ga0501071_0017516 3300049587 Bacteria 4942
318 Ga0501071_0065438 3300049587 Bacteria 2639
319 Ga0501071_0112191 3300049587 Unclassified 2016
320 Ga0501071_0137520 3300049587 Bacteria 1818
321 Ga0501072_0001334 3300049588 Bacteria 18489
322 Ga0501072_0019708 3300049588 Bacteria 5217
323 Ga0501072_0048400 3300049588 Bacteria 3348
324 Ga0501072_0080595 3300049588 Bacteria 2579
325 Ga0501072_0093159 3300049588 Bacteria 2393
326 Ga0501072_0138774 3300049588 Bacteria 1938
327 Ga0501072_0244879 3300049588 Bacteria 1428
328 Ga0501072_0394955 3300049588 Bacteria 1097
329 Ga0501072_0481807 3300049588 Unclassified 981
330 Ga0501073_0007238 3300049589 Bacteria 8263
331 Ga0501073_0007971 3300049589 Bacteria 7861
332 Ga0501073_0028920 3300049589 Bacteria 3960
333 Ga0501074_0003435 3300049590 Bacteria 11232
334 Ga0501074_0015654 3300049590 Bacteria 5513
335 Ga0501074_0062318 3300049590 Bacteria 2686
336 Ga0501074_0069853 3300049590 Bacteria 2525
337 Ga0501075_0008849 3300049591 Bacteria 7020
338 Ga0501075_0013143 3300049591 Bacteria 5902
339 Ga0501075_0033028 3300049591 Bacteria 3848
340 Ga0501075_0046661 3300049591 Bacteria 3254
341 Ga0501075_0076048 3300049591 Bacteria 2539
342 Ga0501075_0151970 3300049591 Bacteria 1764
343 Ga0501075_0157801 3300049591 Bacteria 1730
344 Ga0501075_0255082 3300049591 Bacteria 1337
345 Ga0501076_0001453 3300049592 Bacteria 15933
346 Ga0501076_0006818 3300049592 Bacteria 8286
347 Ga0501076_0020883 3300049592 Bacteria 5014
348 Ga0501076_0030863 3300049592 Bacteria 4175
349 Ga0501076_0051184 3300049592 Bacteria 3268
350 Ga0501076_0060785 3300049592 Bacteria 3006
351 Ga0501076_0082031 3300049592 Bacteria 2589
352 Ga0501076_0104188 3300049592 Bacteria 2289
353 Ga0501076_0147169 3300049592 Bacteria 1915
354 Ga0501077_0012018 3300049593 Bacteria 5419
355 Ga0501077_0030569 3300049593 Bacteria 3426
356 Ga0501077_0033658 3300049593 Bacteria 3261
357 Ga0501077_0034848 3300049593 Bacteria 3204
358 Ga0501077_0177231 3300049593 Bacteria 1355
359 Ga0501079_0000883 3300049741 Bacteria 20558
360 Ga0501079_0002859 3300049741 Bacteria 12589
361 Ga0501079_0004813 3300049741 Bacteria 10003
362 Ga0501079_0083565 3300049741 Bacteria 2470
363 Ga0501079_0119029 3300049741 Bacteria 2053
364 Ga0501079_0349727 3300049741 Bacteria 1158
365 Ga0501080_0002398 3300049742 Bacteria 16359
366 Ga0501080_0025475 3300049742 Bacteria 5490
367 Ga0501080_0046501 3300049742 Bacteria 4040
368 Ga0501080_0142809 3300049742 Bacteria 2213
369 Ga0501080_0293659 3300049742 Bacteria 1475
370 Ga0501081_0000320 3300049743 Bacteria 25716
371 Ga0501081_0000761 3300049743 Bacteria 18895
372 Ga0501081_0005944 3300049743 Bacteria 7899
373 Ga0501081_0010443 3300049743 Bacteria 6057
374 Ga0501081_0011323 3300049743 Bacteria 5836
375 Ga0501081_0020000 3300049743 Bacteria 4462
376 Ga0501081_0031416 3300049743 Bacteria 3599
377 Ga0501081_0048415 3300049743 Bacteria 2925
378 Ga0501083_0005310 3300049744 Bacteria 9112
379 Ga0501083_0022203 3300049744 Bacteria 4404
380 Ga0501035_0126038 3300049822 Bacteria 2235
381 Ga0501035_0139016 3300049822 Bacteria 2112
382 Ga0501044_0013676 3300049823 Bacteria 8771
383 Ga0501044_0057767 3300049823 Bacteria 3981
384 Ga0501044_0068361 3300049823 Bacteria 3619
385 Ga0501045_0000615 3300049824 Bacteria 22479
386 Ga0501045_0004328 3300049824 Bacteria 9790
387 Ga0501045_0007355 3300049824 Bacteria 7656
388 Ga0501045_0017723 3300049824 Bacteria 5057
389 Ga0501045_0039192 3300049824 Bacteria 3448
390 Ga0501045_0080066 3300049824 Bacteria 2408
391 Ga0501045_0092003 3300049824 Bacteria 2242
392 Ga0501045_0157202 3300049824 Bacteria 1691
393 nmdc:mga00v17_9451_c1 3300050491 Bacteria 5278
394 nmdc:mga05p37_20572_c1 3300050507 Bacteria 7985
395 nmdc:mga05p37_253173_c1 3300050507 Bacteria 2111
396 nmdc:mga05p37_338221_c1 3300050507 Bacteria 1776
397 nmdc:mga05p37_470013_c1 3300050507 Bacteria 1451
398 nmdc:mga05p37_5169_c1 3300050507 Bacteria 15300
399 nmdc:mga05p37_619671_c1 3300050507 Bacteria 1218
400 nmdc:mga0qj67_228471_c1 3300050509 Bacteria 1510
401 nmdc:mga0qj67_67343_c1 3300050509 Bacteria 2853
402 nmdc:mga06r32_288892_c1 3300050510 Bacteria 1627
403 nmdc:mga06r32_579992_c1 3300050510 Bacteria 1094
404 nmdc:mga08y16_117153_c1 3300050511 Bacteria 2773
405 nmdc:mga08y16_216053_c1 3300050511 Bacteria 1986
406 nmdc:mga08y16_27126_c1 3300050511 Bacteria 6036
407 nmdc:mga08y16_462016_c1 3300050511 Bacteria 1294
408 nmdc:mga08y16_50086_c1 3300050511 Bacteria 4371
409 nmdc:mga0a205_236224_c1 3300050515 Unclassified 1710
410 Ga0495601_0031438 3300053077 Bacteria 3299
411 Ga0495612_0047188 3300053078 Bacteria 1765
412 Ga0495619_0051138 3300053085 Bacteria 2730
413 Ga0501084_0005284 3300054114 Bacteria 10567
414 Ga0501084_0007220 3300054114 Bacteria 9156
415 Ga0501084_0014050 3300054114 Bacteria 6629
416 Ga0501084_0032455 3300054114 Bacteria 4368
417 Ga0501084_0093989 3300054114 Bacteria 2517
418 Ga0501084_0145446 3300054114 Bacteria 1996
419 Ga0501084_0266907 3300054114 Bacteria 1445
420 Ga0501084_0338058 3300054114 Bacteria 1272
421 Ga0501082_0012587 3300060353 Bacteria 7270
422 Ga0501082_0035875 3300060353 Bacteria 4273
423 Ga0501082_0063188 3300060353 Bacteria 3188
424 Ga0501082_0068456 3300060353 Bacteria 3056
425 Ga0501082_0069511 3300060353 Bacteria 3031
426 Ga0501082_0071244 3300060353 Bacteria 2993
427 Ga0501082_0261733 3300060353 Unclassified 1505
428 Ga0501082_0358625 3300060353 Bacteria 1271
429 Ga0530510_0001485 3300061734 Bacteria 15750
430 Ga0530510_0006739 3300061734 Bacteria 8005
431 Ga0530510_0030915 3300061734 Bacteria 3847
432 Ga0530510_0075602 3300061734 Bacteria 2446
433 Ga0530510_0090353 3300061734 Bacteria 2234
434 Ga0530510_0091967 3300061734 Bacteria 2214
435 Ga0530510_0100569 3300061734 Bacteria 2114
436 Ga0530510_0111154 3300061734 Bacteria 2007
437 Ga0530510_0149501 3300061734 Bacteria 1724
438 Ga0530510_0154877 3300061734 Bacteria 1693
439 nmdc:mga06r32_127606_c1
440 ARCol0yngRDRAFT_1000918
441 Ga0070683_100057004
442 Ga0070690_100028640
443 Ga0070690_100084585
444 Ga0070670_100004186
445 Ga0070670_100025637
446 Ga0068869_100089683
447 Ga0070680_100001439
448 Ga0068868_100037044
449 Ga0068868_100106961
450 Ga0068868_100111667
451 Ga0070689_100014123
452 Ga0070661_100216785
453 Ga0070692_10002531
454 Ga0070668_100228450
455 Ga0070675_100023311
456 Ga0070675_100201425
457 Ga0070671_100010783
458 Ga0070671_100304209
459 Ga0070674_100008245
460 Ga0070674_100022938
461 Ga0070674_100059220
462 Ga0070673_100134460
463 Ga0070688_100003997
464 Ga0070688_100097160
465 Ga0070659_100164779
466 Ga0070659_100264871
467 Ga0070713_100037760
468 Ga0070701_10008989
469 Ga0070701_10020995
470 Ga0070705_100113560
471 Ga0070700_100086817
472 Ga0070663_100033893
473 Ga0070678_100033436
474 Ga0070662_100013464
475 Ga0070662_100032163
476 Ga0070662_100127500
477 Ga0070681_10110340
478 Ga0068867_100077648
479 Ga0068867_100154390
480 Ga0070685_10004772
481 Ga0070685_10066709
482 Ga0070699_100045411
483 Ga0070679_100030712
484 Ga0070679_100073918
485 Ga0070679_100108072
486 Ga0070684_100011152
487 Ga0070684_100041555
488 Ga0070684_100218251
489 Ga0068853_100011384
490 Ga0068853_100212966
491 Ga0070672_100171817
492 Ga0070686_100016719
493 Ga0070693_100086308
494 Ga0070693_100112844
495 Ga0070665_100121490
496 Ga0070665_100286076
497 Ga0070704_100011285
498 Ga0070704_100081208
499 Ga0068855_100155775
500 Ga0068857_100011548
501 Ga0068856_100026978
502 Ga0070702_100021295
503 Ga0068852_100057296
504 Ga0068851_10139437
505 Ga0068870_10001334
506 Ga0068870_10028024
507 Ga0068863_100100300
508 Ga0068858_100027442
509 Ga0068860_100037378
510 Ga0081455_10008727
511 Ga0081455_10015740
512 Ga0081455_10056920
513 Ga0081538_10000059
514 Ga0081538_10001038
515 Ga0081538_10004092
516 Ga0081540_1001185
517 Ga0081539_10000041
518 Ga0081539_10006784
519 Ga0070717_10228194
520 Ga0075365_10008497
521 Ga0070712_100083351
522 Ga0068871_100070095
523 Ga0075428_100002710
524 Ga0075428_100072797
525 Ga0075428_100175576
526 Ga0075428_100203575
527 Ga0075428_100307793
528 Ga0075430_100004923
529 Ga0075431_100029053
530 Ga0075431_100133613
531 Ga0075433_10161121
532 Ga0075433_10163861
533 Ga0075434_100245317
534 Ga0075429_100034159
535 Ga0075429_100373446
536 Ga0068865_100004918
537 Ga0068865_100020999
538 Ga0068865_100022281
539 Ga0068865_100024408
540 Ga0068865_100035443
541 Ga0068865_100178400
542 Ga0075436_100013143
543 Ga0075435_100110436
544 Ga0111539_10013119
545 Ga0111539_10092283
546 Ga0111539_10125823
547 Ga0111539_10382642
548 Ga0105245_10024429
549 Ga0105245_10043540
550 Ga0105245_10116237
551 Ga0114129_10028013
552 Ga0114129_10053756
553 Ga0114129_10076752
554 Ga0114129_10118312
555 Ga0114129_10195977
556 Ga0114129_10210483
557 Ga0114129_10410450
558 Ga0114129_10452597
559 Ga0105243_10002886
560 Ga0105243_10013026
561 Ga0105243_10063395
562 Ga0105242_10103539
563 Ga0105242_10164348
564 Ga0105248_10046557
565 Ga0105248_10283309
566 Ga0105249_10070967
567 Ga0105239_10013046
568 Ga0105239_10259736
569 Ga0105246_10002150
570 Ga0157371_10067574
571 Ga0157371_10099323
572 Ga0157369_10055941
573 Ga0157374_10078527
574 Ga0157372_10373926
575 Ga0157375_10017505
576 Ga0157375_10099855
577 Ga0157375_10246626
578 Ga0163163_10149389
579 Ga0157380_10056964
580 Ga0157380_10213974
581 Ga0157380_10275473
582 Ga0157377_10008757
583 Ga0157377_10010749
584 Ga0157377_10090541
585 Ga0157377_10209876
586 Ga0157379_10007228
587 Ga0157379_10132303
588 Ga0157376_10022042
589 Ga0207688_10010574
590 Ga0207688_10016919
591 Ga0207688_10031092
592 Ga0207647_10097129
593 Ga0207645_10024069
594 Ga0207643_10003863
595 Ga0207643_10047096
596 Ga0207705_10187802
597 Ga0207707_10082131
598 Ga0207693_10102417
599 Ga0207660_10020089
600 Ga0207662_10024351
601 Ga0207657_10040322
602 Ga0207652_10043531
603 Ga0207681_10028072
604 Ga0207650_10001636
605 Ga0207659_10036759
606 Ga0207687_10093873
607 Ga0207700_10211223
608 Ga0207706_10068330
609 Ga0207706_10073483
610 Ga0207709_10089050
611 Ga0207709_10125862
612 Ga0207669_10022494
613 Ga0207669_10086901
614 Ga0207704_10054060
615 Ga0207691_10006191
616 Ga0207691_10030061
617 Ga0207691_10051487
618 Ga0207689_10040246
619 Ga0207661_10014827
620 Ga0207712_10081954
621 Ga0207639_10280067
622 Ga0207708_10008954
623 Ga0207708_10023773
624 Ga0207702_10032147
625 Ga0207641_10092653
626 Ga0207648_10014277
627 Ga0207648_10088100
628 Ga0207648_10181183
629 Ga0207676_10071562
630 Ga0207674_10019100
631 Ga0207674_10083504
632 Ga0207675_100012983
633 Ga0207698_10017055
634 Ga0207698_10039101
635 Ga0207428_10011660
636 Ga0207428_10025802
637 Ga0268265_10146796
638 Ga0307416_100181415
639 Ga0373948_0027941
640 Ga0373941_0004348
641 Ga0395898_0281930
642 Ga0395905_0167061
643 Ga0439448_0047368
644 Ga0495588_0112357
645 Ga0495657_0114940
646 Ga0495669_0112867
647 Ga0495589_0050981
648 Ga0495581_0090305
649 Ga0495604_0137914
650 Ga0495680_0028230
651 Ga0495684_0022817
652 Ga0496100_0004896
653 Ga0496104_0019693
654 Ga0496104_0020628
655 Ga0496104_0325931
656 Ga0496105_0001421
657 Ga0496105_0040567
658 Ga0496105_0156883
659 Ga0496106_0009515
660 Ga0496107_0048986
661 Ga0496108_0151807
662 Ga0496109_0011225
663 Ga0496109_0066312
664 Ga0496109_0072125
665 Ga0496109_0136087
666 Ga0496110_0008390
667 Ga0496110_0013256
668 Ga0496110_0241597
669 Ga0496111_0010934
670 Ga0496111_0274322
671 Ga0496113_0003267
672 Ga0501031_0004004
673 Ga0501031_0004843
674 Ga0501031_0022433
675 Ga0501031_0031222
676 Ga0501031_0054176
677 Ga0501031_0082012
678 Ga0501032_0037160
679 Ga0501033_0038881
680 Ga0501033_0046670
681 Ga0501033_0100639
682 Ga0501033_0119361
683 Ga0501034_0190395
684 Ga0501034_0245305
685 Ga0501036_0001775
686 Ga0501036_0016302
687 Ga0501036_0054177
688 Ga0501036_0087188
689 Ga0501036_0105547
690 Ga0501036_0134483
691 Ga0501036_0148289
692 Ga0501036_0152440
693 Ga0501037_0007784
694 Ga0501038_0063650
695 Ga0501039_0006457
696 Ga0501039_0029739
697 Ga0501039_0152013
698 Ga0501040_0004612
699 Ga0501040_0006969
700 Ga0501040_0017736
701 Ga0501040_0039545
702 Ga0501040_0085017
703 Ga0501040_0100750
704 Ga0501040_0133214
705 Ga0501040_0171599
706 Ga0501040_0193467
707 Ga0501040_0227891
708 Ga0501041_0002259
709 Ga0501041_0006249
710 Ga0501041_0032752
711 Ga0501041_0044897
712 Ga0501041_0066757
713 Ga0501042_0019090
714 Ga0501042_0029578
715 Ga0501042_0059699
716 Ga0501042_0089205
717 Ga0501042_0114112
718 Ga0501042_0140769
719 Ga0501042_0230647
720 Ga0501043_0016039
721 Ga0501043_0025145
722 Ga0501046_0002405
723 Ga0501046_0013675
724 Ga0501046_0058393
725 Ga0501046_0087873
726 Ga0501046_0095598
727 Ga0501048_0011760
728 Ga0501048_0015503
729 Ga0501048_0048832
730 Ga0501048_0066700
731 Ga0501048_0153166
732 Ga0501048_0231150
733 Ga0501067_0011477
734 Ga0501067_0026129
735 Ga0501067_0030881
736 Ga0501067_0052305
737 Ga0501068_0000451
738 Ga0501068_0003498
739 Ga0501068_0012529
740 Ga0501068_0050262
741 Ga0501068_0097953
742 Ga0501068_0164427
743 Ga0501069_0016923
744 Ga0501069_0023167
745 Ga0501069_0171104
746 Ga0501070_0010166
747 Ga0501070_0080581
748 Ga0501070_0100690
749 Ga0501071_0003854
750 Ga0501071_0004769
751 Ga0501071_0005105
752 Ga0501071_0011657
753 Ga0501071_0012653
754 Ga0501071_0013262
755 Ga0501071_0017516
756 Ga0501071_0065438
757 Ga0501071_0112191
758 Ga0501071_0137520
759 Ga0501072_0001334
760 Ga0501072_0019708
761 Ga0501072_0048400
762 Ga0501072_0080595
763 Ga0501072_0093159
764 Ga0501072_0138774
765 Ga0501072_0244879
766 Ga0501072_0394955
767 Ga0501072_0481807
768 Ga0501073_0007238
769 Ga0501073_0007971
770 Ga0501073_0028920
771 Ga0501074_0003435
772 Ga0501074_0015654
773 Ga0501074_0062318
774 Ga0501074_0069853
775 Ga0501075_0008849
776 Ga0501075_0013143
777 Ga0501075_0033028
778 Ga0501075_0046661
779 Ga0501075_0076048
780 Ga0501075_0151970
781 Ga0501075_0157801
782 Ga0501075_0255082
783 Ga0501076_0001453
784 Ga0501076_0006818
785 Ga0501076_0020883
786 Ga0501076_0030863
787 Ga0501076_0051184
788 Ga0501076_0060785
789 Ga0501076_0082031
790 Ga0501076_0104188
791 Ga0501076_0147169
792 Ga0501077_0012018
793 Ga0501077_0030569
794 Ga0501077_0033658
795 Ga0501077_0034848
796 Ga0501077_0177231
797 Ga0501079_0000883
798 Ga0501079_0002859
799 Ga0501079_0004813
800 Ga0501079_0083565
801 Ga0501079_0119029
802 Ga0501079_0349727
803 Ga0501080_0002398
804 Ga0501080_0025475
805 Ga0501080_0046501
806 Ga0501080_0142809
807 Ga0501080_0293659
808 Ga0501081_0000320
809 Ga0501081_0000761
810 Ga0501081_0005944
811 Ga0501081_0010443
812 Ga0501081_0011323
813 Ga0501081_0020000
814 Ga0501081_0031416
815 Ga0501081_0048415
816 Ga0501083_0005310
817 Ga0501083_0022203
818 Ga0501035_0126038
819 Ga0501035_0139016
820 Ga0501044_0013676
821 Ga0501044_0057767
822 Ga0501044_0068361
823 Ga0501045_0000615
824 Ga0501045_0004328
825 Ga0501045_0007355
826 Ga0501045_0017723
827 Ga0501045_0039192
828 Ga0501045_0080066
829 Ga0501045_0092003
830 Ga0501045_0157202
831 nmdc:mga00v17_9451_c1
832 nmdc:mga05p37_20572_c1
833 nmdc:mga05p37_253173_c1
834 nmdc:mga05p37_338221_c1
835 nmdc:mga05p37_470013_c1
836 nmdc:mga05p37_5169_c1
837 nmdc:mga05p37_619671_c1
838 nmdc:mga0qj67_228471_c1
839 nmdc:mga0qj67_67343_c1
840 nmdc:mga06r32_288892_c1
841 nmdc:mga06r32_579992_c1
842 nmdc:mga08y16_117153_c1
843 nmdc:mga08y16_216053_c1
844 nmdc:mga08y16_27126_c1
845 nmdc:mga08y16_462016_c1
846 nmdc:mga08y16_50086_c1
847 nmdc:mga0a205_236224_c1
848 Ga0495601_0031438
849 Ga0495612_0047188
850 Ga0495619_0051138
851 Ga0501084_0005284
852 Ga0501084_0007220
853 Ga0501084_0014050
854 Ga0501084_0032455
855 Ga0501084_0093989
856 Ga0501084_0145446
857 Ga0501084_0266907
858 Ga0501084_0338058
859 Ga0501082_0012587
860 Ga0501082_0035875
861 Ga0501082_0063188
862 Ga0501082_0068456
863 Ga0501082_0069511
864 Ga0501082_0071244
865 Ga0501082_0261733
866 Ga0501082_0358625
867 Ga0530510_0001485
868 Ga0530510_0006739
869 Ga0530510_0030915
870 Ga0530510_0075602
871 Ga0530510_0090353
872 Ga0530510_0091967
873 Ga0530510_0100569
874 Ga0530510_0111154
875 Ga0530510_0149501
876 Ga0530510_0154877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13200

DUF4015

Putative glycosyl hydrolase domain

80

384

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1a-assembly1.cif.gz_B crystal structure of a hypothetical protein cthe_0052 from ruminiclostridium thermocellum atcc 27405 0.9167 60 248
4s1a-assembly1.cif.gz_B crystal structure of a hypothetical protein cthe_0052 from ruminiclostridium thermocellum atcc 27405 0.8752 60 248
5tcb-assembly1.cif.gz_A structure of the glycoside hydrolase domain of pela from pseudomonas aeruginosa 0.7152 56 357
6au1-assembly2.cif.gz_B structure of the pgab (bpsb) glycoside hydrolase domain from bordetella bronchiseptica 0.7014 54 356
5tsy-assembly1.cif.gz_A structure of the glycoside hydrolase domain of pela variant e218a from pseudomonas aeruginosa 0.6988 56 357
ID Description Score Start End Superfamily
af_A4I7Y2_9_292_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7098 297 352 3.40.50.620
4s3kA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7077 56 363 3.20.20.80
af_Q20833_1_379_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7068 299 361 1.20.58.60
6au1B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7014 54 356 3.20.20.80
4wiwF01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.697 54 362 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7Y6CUT9-F1-model_v4 DUF4015 domain-containing protein 0.9928 74 367
AF-A0A538GJB4-F1-model_v4 DUF4015 domain-containing protein 0.9727 265 365
AF-A0A7C6UNZ1-F1-model_v4 Putative glycoside hydrolase 0.9682 62 364 GO:0016787
AF-A0A7Y6CUT9-F1-model_v4 DUF4015 domain-containing protein 0.9666 74 367
AF-A0A357D7A8-F1-model_v4 Sugar fermentation stimulation protein 0.9661 62 362

Map