F443825

General Info

Members Datasets Scaffolds Average Seq Length
437 261 874 117

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0967867|Ga0451855_0967867_79_504
Length 141
Sequence MAPDEYDDELDEXXXXEQPSEPEVTIEISGLSLYTHVGVSDAEREVGQRLLLDIRLDVGECDATVTDRIEDTVDYREVVRCVREVSDSRQFHLLEAMAAAVAEALLERFRLDGVRARVRKPAVRLEAPVEWTAATAERRRP

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
205 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
206 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
213 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 11.9
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0967867 3300041511 Bacteria 1447
2 JGI24738J21930_10002351 3300002075 Bacteria 4980
3 Ga0070676_10133809 3300005328 Bacteria 1571
4 Ga0070683_100071588 3300005329 Bacteria 3235
5 Ga0070670_101091398 3300005331 Bacteria 728
6 Ga0068869_100079390 3300005334 Bacteria 2446
7 Ga0068869_100225036 3300005334 Bacteria 1488
8 Ga0070680_100145325 3300005336 Bacteria 1989
9 Ga0070680_100217623 3300005336 Bacteria 1612
10 Ga0070682_100013825 3300005337 Bacteria 4653
11 Ga0070682_100028511 3300005337 Bacteria 3358
12 Ga0068868_100049579 3300005338 Bacteria 3295
13 Ga0068868_100746588 3300005338 Bacteria 879
14 Ga0070660_100031422 3300005339 Bacteria 3987
15 Ga0070660_100173085 3300005339 Bacteria 1744
16 Ga0070689_100483155 3300005340 Bacteria 1058
17 Ga0070691_10009032 3300005341 Bacteria 4560
18 Ga0070661_100949148 3300005344 Bacteria 712
19 Ga0070692_10246173 3300005345 Bacteria 1068
20 Ga0070675_100045423 3300005354 Bacteria 3594
21 Ga0070675_100877745 3300005354 Bacteria 822
22 Ga0070671_100115614 3300005355 Bacteria 2255
23 Ga0070674_100025799 3300005356 Bacteria 3830
24 Ga0070674_100898841 3300005356 Bacteria 771
25 Ga0070673_100543987 3300005364 Bacteria 1054
26 Ga0070688_100050749 3300005365 Bacteria 2585
27 Ga0070659_100014917 3300005366 Bacteria 5812
28 Ga0070659_100118982 3300005366 Bacteria 2138
29 Ga0070703_10003797 3300005406 Bacteria 4275
30 Ga0070709_10275169 3300005434 Bacteria 1221
31 Ga0070714_100048152 3300005435 Bacteria 3624
32 Ga0070714_100670902 3300005435 Unclassified 999
33 Ga0070713_100164008 3300005436 Bacteria 1986
34 Ga0070710_10022815 3300005437 Bacteria 3280
35 Ga0070701_10014614 3300005438 Bacteria 3604
36 Ga0070711_100464908 3300005439 Bacteria 1037
37 Ga0070705_100014117 3300005440 Bacteria 4101
38 Ga0070705_100035389 3300005440 Bacteria 2799
39 Ga0070705_100079715 3300005440 Bacteria 2006
40 Ga0070705_100204081 3300005440 Bacteria 1358
41 Ga0070705_101365084 3300005440 Bacteria 590
42 Ga0070700_100149370 3300005441 Bacteria 1596
43 Ga0070700_100552755 3300005441 Bacteria 894
44 Ga0070700_101891028 3300005441 Bacteria 516
45 Ga0070694_100006955 3300005444 Bacteria 6874
46 Ga0070694_100059646 3300005444 Bacteria 2599
47 Ga0070694_100310159 3300005444 Bacteria 1211
48 Ga0070708_100531049 3300005445 Bacteria 1110
49 Ga0070663_100225312 3300005455 Bacteria 1474
50 Ga0070678_100009863 3300005456 Bacteria 5805
51 Ga0070678_100035166 3300005456 Bacteria 3496
52 Ga0070678_100161363 3300005456 Bacteria 1816
53 Ga0070678_100674543 3300005456 Bacteria 929
54 Ga0070662_100169678 3300005457 Bacteria 1713
55 Ga0070681_10690931 3300005458 Unclassified 936
56 Ga0070681_11597082 3300005458 Bacteria 578
57 Ga0068867_100025363 3300005459 Bacteria 4254
58 Ga0070685_10010049 3300005466 Bacteria 4909
59 Ga0070706_100027782 3300005467 Bacteria 5203
60 Ga0070706_100447643 3300005467 Bacteria 1202
61 Ga0070706_101365098 3300005467 Unclassified 649
62 Ga0070707_100029981 3300005468 Bacteria 5177
63 Ga0070707_100406913 3300005468 Bacteria 1321
64 Ga0070707_100891403 3300005468 Bacteria 854
65 Ga0070698_101228767 3300005471 Bacteria 699
66 Ga0070699_100336523 3300005518 Bacteria 1358
67 Ga0070679_101562513 3300005530 Bacteria 607
68 Ga0070684_100791052 3300005535 Bacteria 886
69 Ga0070684_101613023 3300005535 Bacteria 612
70 Ga0070697_100026565 3300005536 Bacteria 4627
71 Ga0070697_100149430 3300005536 Bacteria 1969
72 Ga0070697_100560008 3300005536 Bacteria 1003
73 Ga0070697_101610787 3300005536 Unclassified 581
74 Ga0068853_100040173 3300005539 Bacteria 3990
75 Ga0068853_101055151 3300005539 Unclassified 783
76 Ga0070672_100018453 3300005543 Bacteria 5044
77 Ga0070672_101100743 3300005543 Bacteria 706
78 Ga0070695_100004638 3300005545 Bacteria 8078
79 Ga0070695_100037465 3300005545 Bacteria 3056
80 Ga0070695_100202316 3300005545 Bacteria 1420
81 Ga0070696_100014346 3300005546 Bacteria 5315
82 Ga0070696_100045460 3300005546 Bacteria 3042
83 Ga0070696_100318902 3300005546 Bacteria 1195
84 Ga0070696_101009357 3300005546 Bacteria 695
85 Ga0070693_100044933 3300005547 Bacteria 2501
86 Ga0070665_100030651 3300005548 Bacteria 5411
87 Ga0070704_100007670 3300005549 Bacteria 6431
88 Ga0068855_100464366 3300005563 Bacteria 1380
89 Ga0070664_100095218 3300005564 Bacteria 2582
90 Ga0070664_101277816 3300005564 Bacteria 693
91 Ga0070664_101726662 3300005564 Unclassified 593
92 Ga0070702_100089134 3300005615 Bacteria 1867
93 Ga0070702_101190779 3300005615 Bacteria 613
94 Ga0068852_100057766 3300005616 Bacteria 3358
95 Ga0068859_100035134 3300005617 Bacteria 5029
96 Ga0068866_10014754 3300005718 Bacteria 3457
97 Ga0068866_10552469 3300005718 Bacteria 770
98 Ga0068861_100401933 3300005719 Bacteria 1216
99 Ga0068851_10051135 3300005834 Bacteria 2099
100 Ga0068851_10963126 3300005834 Unclassified 537
101 Ga0068870_10019479 3300005840 Bacteria 3291
102 Ga0068870_10023058 3300005840 Bacteria 3065
103 Ga0068863_100039417 3300005841 Bacteria 4494
104 Ga0068860_101266965 3300005843 Bacteria 758
105 Ga0068862_100081876 3300005844 Bacteria 2801
106 Ga0081538_10023392 3300005981 Bacteria 4443
107 Ga0081538_10171680 3300005981 Bacteria 945
108 Ga0075365_10785002 3300006038 Bacteria 672
109 Ga0070715_10004124 3300006163 Bacteria 4724
110 Ga0070716_100302870 3300006173 Unclassified 1113
111 Ga0070716_101746411 3300006173 Bacteria 514
112 Ga0070712_100089164 3300006175 Bacteria 2255
113 Ga0070712_100893745 3300006175 Bacteria 765
114 Ga0097621_100142721 3300006237 Bacteria 2047
115 Ga0097621_100332907 3300006237 Bacteria 1347
116 Ga0068871_100215027 3300006358 Bacteria 1664
117 Ga0068871_100236491 3300006358 Bacteria 1587
118 Ga0068871_101795700 3300006358 Bacteria 582
119 Ga0075428_100885698 3300006844 Bacteria 947
120 Ga0075431_101888141 3300006847 Unclassified 553
121 Ga0075433_10010135 3300006852 Bacteria 7555
122 Ga0075433_10431418 3300006852 Bacteria 1162
123 Ga0075434_100022573 3300006871 Bacteria 6128
124 Ga0075434_100193818 3300006871 Bacteria 2052
125 Ga0075434_100343953 3300006871 Bacteria 1513
126 Ga0075429_101390986 3300006880 Unclassified 611
127 Ga0068865_100028727 3300006881 Bacteria 3683
128 Ga0075436_100032912 3300006914 Bacteria 3572
129 Ga0097620_100035134 3300006931 Bacteria 5029
130 Ga0075435_100580564 3300007076 Bacteria 971
131 Ga0111539_10017892 3300009094 Bacteria 8778
132 Ga0111539_10103326 3300009094 Bacteria 3344
133 Ga0111539_10922796 3300009094 Bacteria 1015
134 Ga0105245_10014329 3300009098 Bacteria 6907
135 Ga0105245_10086732 3300009098 Bacteria 2871
136 Ga0105245_10138025 3300009098 Bacteria 2293
137 Ga0105245_10320465 3300009098 Bacteria 1527
138 Ga0105247_10094690 3300009101 Bacteria 1900
139 Ga0114129_10081109 3300009147 Bacteria 4509
140 Ga0114129_10109426 3300009147 Bacteria 3815
141 Ga0105243_10005317 3300009148 Bacteria 10064
142 Ga0105243_10045328 3300009148 Bacteria 3455
143 Ga0105243_11845228 3300009148 Bacteria 636
144 Ga0105241_10108447 3300009174 Bacteria 2219
145 Ga0105242_10010026 3300009176 Bacteria 7254
146 Ga0105248_10075193 3300009177 Bacteria 3796
147 Ga0105248_11087340 3300009177 Bacteria 904
148 Ga0105249_10137539 3300009553 Bacteria 2340
149 Ga0105239_10035143 3300010375 Bacteria 5504
150 Ga0105239_10933642 3300010375 Bacteria 996
151 Ga0105246_10063839 3300011119 Bacteria 2570
152 Ga0105246_12426416 3300011119 Bacteria 515
153 Ga0157373_10157572 3300013100 Bacteria 1597
154 Ga0157371_10021612 3300013102 Bacteria 4722
155 Ga0157371_10106474 3300013102 Bacteria 1990
156 Ga0157374_11630311 3300013296 Bacteria 669
157 Ga0157378_10214020 3300013297 Bacteria 1829
158 Ga0157378_10304856 3300013297 Unclassified 1543
159 Ga0157372_10903365 3300013307 Bacteria 1025
160 Ga0163163_10201496 3300014325 Bacteria 2038
161 Ga0163163_11630344 3300014325 Bacteria 706
162 Ga0157380_10065818 3300014326 Bacteria 2914
163 Ga0182008_10963606 3300014497 Bacteria 506
164 Ga0157377_10252969 3300014745 Bacteria 1143
165 Ga0157379_10121081 3300014968 Bacteria 2354
166 Ga0163161_10186867 3300017792 Bacteria 1591
167 Ga0213874_10003987 3300021377 Bacteria 3325
168 Ga0213876_10027834 3300021384 Bacteria 2981
169 Ga0207656_10112301 3300025321 Bacteria 1260
170 Ga0207656_10407200 3300025321 Unclassified 684
171 Ga0207653_10001866 3300025885 Bacteria 6741
172 Ga0207692_10030196 3300025898 Bacteria 2582
173 Ga0207710_10090480 3300025900 Bacteria 1431
174 Ga0207685_10005207 3300025905 Bacteria 3407
175 Ga0207699_10117073 3300025906 Bacteria 1717
176 Ga0207699_10268435 3300025906 Unclassified 1182
177 Ga0207643_10020419 3300025908 Bacteria 3636
178 Ga0207643_10207122 3300025908 Bacteria 1196
179 Ga0207684_10210973 3300025910 Bacteria 1675
180 Ga0207684_10787852 3300025910 Bacteria 804
181 Ga0207654_10211494 3300025911 Bacteria 1282
182 Ga0207654_10468382 3300025911 Bacteria 886
183 Ga0207707_10156288 3300025912 Bacteria 1995
184 Ga0207707_10249659 3300025912 Bacteria 1541
185 Ga0207693_10001702 3300025915 Bacteria 19375
186 Ga0207693_10071453 3300025915 Unclassified 2716
187 Ga0207663_10165614 3300025916 Bacteria 1565
188 Ga0207663_10279507 3300025916 Bacteria 1239
189 Ga0207660_10389575 3300025917 Bacteria 1121
190 Ga0207660_10520730 3300025917 Bacteria 966
191 Ga0207657_10025378 3300025919 Bacteria 5466
192 Ga0207657_10038188 3300025919 Bacteria 4278
193 Ga0207649_10528445 3300025920 Bacteria 900
194 Ga0207652_10118537 3300025921 Bacteria 2353
195 Ga0207646_10045170 3300025922 Bacteria 3954
196 Ga0207646_10276492 3300025922 Bacteria 1518
197 Ga0207681_10123716 3300025923 Bacteria 1901
198 Ga0207650_10267446 3300025925 Bacteria 1389
199 Ga0207687_10056998 3300025927 Bacteria 2743
200 Ga0207687_10140930 3300025927 Bacteria 1829
201 Ga0207687_10209762 3300025927 Bacteria 1528
202 Ga0207687_10901353 3300025927 Unclassified 757
203 Ga0207664_10885280 3300025929 Bacteria 802
204 Ga0207644_10628925 3300025931 Bacteria 892
205 Ga0207690_10111630 3300025932 Bacteria 1970
206 Ga0207690_10899661 3300025932 Unclassified 734
207 Ga0207706_10010156 3300025933 Bacteria 8616
208 Ga0207706_10069862 3300025933 Bacteria 3089
209 Ga0207706_10222367 3300025933 Bacteria 1653
210 Ga0207686_10048053 3300025934 Bacteria 2641
211 Ga0207709_10013976 3300025935 Bacteria 4433
212 Ga0207709_10074818 3300025935 Bacteria 2163
213 Ga0207709_10164011 3300025935 Bacteria 1553
214 Ga0207669_10026592 3300025937 Bacteria 3151
215 Ga0207669_11761849 3300025937 Bacteria 529
216 Ga0207704_10054340 3300025938 Bacteria 2441
217 Ga0207704_10831023 3300025938 Unclassified 773
218 Ga0207665_10006909 3300025939 Bacteria 7511
219 Ga0207665_10712545 3300025939 Bacteria 789
220 Ga0207711_10164716 3300025941 Bacteria 2009
221 Ga0207711_12092078 3300025941 Bacteria 509
222 Ga0207689_10057962 3300025942 Bacteria 3186
223 Ga0207689_10514299 3300025942 Bacteria 1004
224 Ga0207661_10015409 3300025944 Bacteria 5624
225 Ga0207661_11255343 3300025944 Bacteria 681
226 Ga0207661_11618112 3300025944 Bacteria 592
227 Ga0207679_11201255 3300025945 Unclassified 696
228 Ga0207679_11297375 3300025945 Unclassified 668
229 Ga0207667_10331547 3300025949 Bacteria 1554
230 Ga0207651_10582536 3300025960 Bacteria 976
231 Ga0207712_10317587 3300025961 Bacteria 1284
232 Ga0207668_10418625 3300025972 Bacteria 1137
233 Ga0207640_10187282 3300025981 Bacteria 1557
234 Ga0207640_10833899 3300025981 Bacteria 801
235 Ga0207658_10624878 3300025986 Bacteria 969
236 Ga0207677_10753233 3300026023 Bacteria 868
237 Ga0207677_11479254 3300026023 Bacteria 627
238 Ga0207639_10224310 3300026041 Bacteria 1625
239 Ga0207639_10395786 3300026041 Bacteria 1244
240 Ga0207639_10551307 3300026041 Unclassified 1058
241 Ga0207639_11179460 3300026041 Bacteria 719
242 Ga0207678_10017697 3300026067 Bacteria 6257
243 Ga0207708_10015442 3300026075 Bacteria 5727
244 Ga0207708_10302895 3300026075 Bacteria 1300
245 Ga0207641_10422052 3300026088 Bacteria 1284
246 Ga0207648_10031706 3300026089 Bacteria 4671
247 Ga0207676_10047199 3300026095 Bacteria 3336
248 Ga0207674_10072443 3300026116 Bacteria 3461
249 Ga0207675_100027462 3300026118 Bacteria 5301
250 Ga0207675_100377958 3300026118 Bacteria 1393
251 Ga0207683_10008677 3300026121 Bacteria 8691
252 Ga0207683_10060704 3300026121 Bacteria 3324
253 Ga0207683_10076337 3300026121 Bacteria 2967
254 Ga0207683_10213037 3300026121 Bacteria 1759
255 Ga0207428_10043514 3300027907 Bacteria 3626
256 Ga0265319_1020744 3300028563 Bacteria 2427
257 Ga0265334_10045428 3300028573 Bacteria 1701
258 Ga0265318_10009874 3300028577 Bacteria 4179
259 Ga0265322_10063502 3300028654 Bacteria 1047
260 Ga0265338_10029019 3300028800 Bacteria 5499
261 Ga0265338_10066434 3300028800 Bacteria 3121
262 Ga0265338_10258236 3300028800 Bacteria 1282
263 Ga0265338_10361444 3300028800 Bacteria 1042
264 Ga0265330_10094956 3300031235 Bacteria 1278
265 Ga0265320_10365278 3300031240 Bacteria 637
266 Ga0265320_10367476 3300031240 Unclassified 635
267 Ga0265320_10533054 3300031240 Bacteria 519
268 Ga0265325_10207988 3300031241 Bacteria 900
269 Ga0265329_10045967 3300031242 Bacteria 1395
270 Ga0265339_10103251 3300031249 Bacteria 1481
271 Ga0265327_10057140 3300031251 Bacteria 2008
272 Ga0265316_10027267 3300031344 Bacteria 4733
273 Ga0265314_10063310 3300031711 Bacteria 2509
274 Ga0265342_10319344 3300031712 Bacteria 814
275 Ga0307409_101976630 3300031995 Bacteria 613
276 Ga0307416_100307840 3300032002 Bacteria 1579
277 Ga0373930_0004501 3300034816 Bacteria 2273
278 Ga0373950_0010517 3300034818 Bacteria 1496
279 Ga0373958_0000860 3300034819 Bacteria 3903
280 Ga0373959_0005434 3300034820 Bacteria 2088
281 Ga0373938_0002836 3300034957 Bacteria 2799
282 Ga0373928_0032593 3300035084 Bacteria 1162
283 Ga0373929_0007682 3300035085 Bacteria 1973
284 Ga0373949_0002898 3300035090 Bacteria 4228
285 Ga0373951_0001764 3300035091 Bacteria 5628
286 Ga0373951_0008509 3300035091 Bacteria 2314
287 Ga0373952_0033245 3300035092 Bacteria 1156
288 Ga0373932_0002131 3300035112 Bacteria 5139
289 Ga0373939_0001104 3300035114 Bacteria 6635
290 Ga0373941_0004400 3300035115 Bacteria 3254
291 Ga0373960_0000379 3300035121 Bacteria 8622
292 Ga0373960_0100132 3300035121 Bacteria 938
293 Ga0373942_0004604 3300035207 Bacteria 3199
294 Ga0373942_0151348 3300035207 Bacteria 745
295 Ga0373961_0011273 3300035241 Bacteria 2216
296 Ga0373961_0014674 3300035241 Bacteria 1992
297 Ga0373962_0000833 3300035242 Bacteria 7030
298 Ga0373962_0011998 3300035242 Bacteria 2179
299 Ga0373931_0004517 3300035691 Bacteria 6364
300 Ga0373931_0204831 3300035691 Bacteria 1180
301 Ga0395899_0477197 3300037312 Unclassified 812
302 Ga0395899_0650673 3300037312 Bacteria 666
303 Ga0395900_0173807 3300037418 Bacteria 2192
304 Ga0395900_0186099 3300037418 Bacteria 2108
305 Ga0395900_0205726 3300037418 Bacteria 1989
306 Ga0395900_0460724 3300037418 Bacteria 1226
307 Ga0395900_0588067 3300037418 Bacteria 1054
308 Ga0395900_1091610 3300037418 Bacteria 715
309 Ga0395898_0013091 3300037466 Bacteria 8553
310 Ga0395898_0032963 3300037466 Bacteria 5171
311 Ga0395898_0119129 3300037466 Bacteria 2529
312 Ga0395898_0496964 3300037466 Unclassified 1160
313 Ga0395898_0902902 3300037466 Unclassified 821
314 Ga0395905_0501244 3300037471 Unclassified 1114
315 Ga0395905_0783693 3300037471 Bacteria 856
316 Ga0395905_0873207 3300037471 Bacteria 802
317 Ga0395901_0040321 3300038443 Bacteria 4836
318 Ga0395901_0042544 3300038443 Bacteria 4710
319 Ga0395901_0081942 3300038443 Bacteria 3370
320 Ga0395901_0297226 3300038443 Unclassified 1674
321 Ga0395901_1171610 3300038443 Bacteria 736
322 Ga0436365_0366420 3300039437 Bacteria 3280
323 Ga0436363_1094325 3300039450 Bacteria 13140
324 Ga0439438_060182 3300041405 Bacteria 952
325 Ga0439461_0020008 3300041410 Bacteria 1322
326 Ga0451789_0472513 3300041443 Bacteria 1779
327 Ga0451800_0473391 3300041459 Bacteria 3150
328 Ga0451800_1080634 3300041459 Bacteria 669
329 Ga0451802_2085695 3300041460 Bacteria 2217
330 Ga0451804_0857326 3300041463 Bacteria 2009
331 Ga0451807_1550634 3300041486 Bacteria 752
332 Ga0451807_1882910 3300041486 Bacteria 1991
333 Ga0451833_1214299 3300041491 Unclassified 617
334 Ga0451837_1427208 3300041494 Bacteria 529
335 Ga0451839_0997909 3300041496 Bacteria 800
336 Ga0451841_1422534 3300041498 Bacteria 1384
337 Ga0451847_0284722 3300041503 Bacteria 1770
338 Ga0451849_0897043 3300041505 Bacteria 1978
339 Ga0451851_0888473 3300041507 Unclassified 874
340 Ga0451843_0583775 3300041509 Unclassified 514
341 Ga0451853_0323621 3300041512 Archaea 570
342 Ga0451853_0898650 3300041512 Bacteria 2713
343 Ga0451853_3233425 3300041512 Unclassified 1283
344 Ga0439445_0035332 3300042004 Bacteria 1312
345 Ga0450920_020643 3300042122 Bacteria 1270
346 Ga0450898_043328 3300042134 Bacteria 856
347 Ga0439446_0049756 3300042156 Bacteria 1250
348 Ga0439434_0139251 3300042435 Bacteria 799
349 Ga0466972_0164238 3300044658 Bacteria 1043
350 Ga0451576_0311644 3300045051 Bacteria 1646
351 Ga0466967_1877626 3300045976 Bacteria 596
352 Ga0495592_0392278 3300046454 Bacteria 881
353 Ga0495628_0067168 3300046516 Bacteria 2801
354 Ga0495656_0054070 3300046615 Bacteria 1727
355 Ga0495602_0292568 3300048088 Bacteria 1195
356 Ga0496100_0014676 3300048903 Bacteria 4555
357 Ga0496100_0131554 3300048903 Bacteria 1763
358 Ga0496101_0059768 3300048904 Bacteria 2763
359 Ga0496101_0190588 3300048904 Bacteria 1582
360 Ga0496101_0241855 3300048904 Unclassified 1405
361 Ga0496101_0513561 3300048904 Bacteria 947
362 Ga0496102_0096932 3300048905 Bacteria 2735
363 Ga0496102_0132140 3300048905 Bacteria 2337
364 Ga0496102_0615943 3300048905 Bacteria 1009
365 Ga0496103_0005385 3300048906 Bacteria 7668
366 Ga0496103_0246834 3300048906 Bacteria 1149
367 Ga0496103_0453027 3300048906 Bacteria 823
368 Ga0496104_0120486 3300048907 Bacteria 2519
369 Ga0496104_0186946 3300048907 Bacteria 1982
370 Ga0496105_0014154 3300048908 Bacteria 6347
371 Ga0496105_0756472 3300048908 Bacteria 742
372 Ga0496106_0144727 3300048909 Bacteria 1871
373 Ga0496106_0310153 3300048909 Bacteria 1266
374 Ga0496106_0911039 3300048909 Bacteria 694
375 Ga0496107_0042800 3300048910 Bacteria 3253
376 Ga0496107_0070922 3300048910 Bacteria 2531
377 Ga0496107_0137150 3300048910 Unclassified 1808
378 Ga0496108_0150560 3300048911 Bacteria 2007
379 Ga0496108_0175587 3300048911 Bacteria 1854
380 Ga0496109_0027121 3300048912 Bacteria 5112
381 Ga0496109_0030617 3300048912 Bacteria 4823
382 Ga0496109_0607385 3300048912 Bacteria 1030
383 Ga0496109_1190514 3300048912 Bacteria 699
384 Ga0496110_0018736 3300048913 Bacteria 5807
385 Ga0496110_0046616 3300048913 Bacteria 3792
386 Ga0496110_0438050 3300048913 Bacteria 1191
387 Ga0496110_0985573 3300048913 Bacteria 750
388 Ga0496110_1168031 3300048913 Bacteria 678
389 Ga0496111_0039577 3300048914 Bacteria 3381
390 Ga0496111_0071265 3300048914 Bacteria 2529
391 Ga0496111_0107665 3300048914 Bacteria 2052
392 Ga0496111_0596672 3300048914 Bacteria 809
393 Ga0496111_0769469 3300048914 Unclassified 698
394 Ga0496112_0100738 3300048915 Bacteria 2858
395 Ga0496112_0547653 3300048915 Bacteria 1091
396 Ga0496113_0251564 3300048916 Bacteria 1411
397 Ga0496114_0013425 3300048917 Bacteria 6567
398 Ga0496114_0126182 3300048917 Bacteria 2206
399 Ga0496115_0096488 3300048918 Bacteria 2421
400 Ga0496115_0559101 3300048918 Bacteria 913
401 Ga0501039_0100950 3300049575 Bacteria 2252
402 Ga0501040_0609944 3300049576 Bacteria 788
403 Ga0501042_0226420 3300049578 Bacteria 1349
404 Ga0501048_0081944 3300049582 Bacteria 2276
405 Ga0501072_0099518 3300049588 Bacteria 2311
406 Ga0501072_0979088 3300049588 Unclassified 660
407 Ga0501075_0055388 3300049591 Bacteria 2984
408 Ga0501076_0068803 3300049592 Bacteria 2828
409 Ga0501077_0105850 3300049593 Bacteria 1782
410 Ga0501077_0569654 3300049593 Bacteria 727
411 Ga0501080_0389913 3300049742 Bacteria 1254
412 Ga0501081_0090594 3300049743 Bacteria 2150
413 Ga0501083_0612049 3300049744 Unclassified 709
414 Ga0501045_0993553 3300049824 Unclassified 615
415 Ga0501045_1130536 3300049824 Bacteria 572
416 nmdc:mga04h51_362256_c1 3300050495 Bacteria 601
417 nmdc:mga05p37_49820_c1 3300050507 Bacteria 5151
418 nmdc:mga05p37_692341_c1 3300050507 Bacteria 1134
419 nmdc:mga08y16_106428_c1 3300050511 Bacteria 2919
420 nmdc:mga08y16_60861_c1 3300050511 Bacteria 3943
421 nmdc:mga0n895_1001007_c1 3300050512 Bacteria 817
422 nmdc:mga0n895_29005_c1 3300050512 Bacteria 5272
423 nmdc:mga0rr50_459586_c1 3300050513 Bacteria 1080
424 nmdc:mga0rr50_483611_c1 3300050513 Bacteria 1052
425 nmdc:mga08x19_36342_c1 3300050514 Bacteria 3120
426 nmdc:mga0a205_369793_c1 3300050515 Bacteria 1300
427 nmdc:mga0a205_401038_c1 3300050515 Bacteria 1235
428 Ga0495619_0809447 3300053085 Bacteria 633
429 Ga0501084_0205683 3300054114 Bacteria 1661
430 Ga0501082_0133628 3300060353 Bacteria 2153
431 Ga0501082_0437753 3300060353 Bacteria 1142
432 Ga0501082_0573727 3300060353 Bacteria 987
433 Ga0501082_0868263 3300060353 Unclassified 789
434 Ga0530510_0046836 3300061734 Bacteria 3124
435 Ga0530510_0178344 3300061734 Bacteria 1575
436 Ga0530510_1451786 3300061734 Bacteria 526
437 Ga0530510_1488281 3300061734 Bacteria 520
438 Ga0451855_0967867
439 JGI24738J21930_10002351
440 Ga0070676_10133809
441 Ga0070683_100071588
442 Ga0070670_101091398
443 Ga0068869_100079390
444 Ga0068869_100225036
445 Ga0070680_100145325
446 Ga0070680_100217623
447 Ga0070682_100013825
448 Ga0070682_100028511
449 Ga0068868_100049579
450 Ga0068868_100746588
451 Ga0070660_100031422
452 Ga0070660_100173085
453 Ga0070689_100483155
454 Ga0070691_10009032
455 Ga0070661_100949148
456 Ga0070692_10246173
457 Ga0070675_100045423
458 Ga0070675_100877745
459 Ga0070671_100115614
460 Ga0070674_100025799
461 Ga0070674_100898841
462 Ga0070673_100543987
463 Ga0070688_100050749
464 Ga0070659_100014917
465 Ga0070659_100118982
466 Ga0070703_10003797
467 Ga0070709_10275169
468 Ga0070714_100048152
469 Ga0070714_100670902
470 Ga0070713_100164008
471 Ga0070710_10022815
472 Ga0070701_10014614
473 Ga0070711_100464908
474 Ga0070705_100014117
475 Ga0070705_100035389
476 Ga0070705_100079715
477 Ga0070705_100204081
478 Ga0070705_101365084
479 Ga0070700_100149370
480 Ga0070700_100552755
481 Ga0070700_101891028
482 Ga0070694_100006955
483 Ga0070694_100059646
484 Ga0070694_100310159
485 Ga0070708_100531049
486 Ga0070663_100225312
487 Ga0070678_100009863
488 Ga0070678_100035166
489 Ga0070678_100161363
490 Ga0070678_100674543
491 Ga0070662_100169678
492 Ga0070681_10690931
493 Ga0070681_11597082
494 Ga0068867_100025363
495 Ga0070685_10010049
496 Ga0070706_100027782
497 Ga0070706_100447643
498 Ga0070706_101365098
499 Ga0070707_100029981
500 Ga0070707_100406913
501 Ga0070707_100891403
502 Ga0070698_101228767
503 Ga0070699_100336523
504 Ga0070679_101562513
505 Ga0070684_100791052
506 Ga0070684_101613023
507 Ga0070697_100026565
508 Ga0070697_100149430
509 Ga0070697_100560008
510 Ga0070697_101610787
511 Ga0068853_100040173
512 Ga0068853_101055151
513 Ga0070672_100018453
514 Ga0070672_101100743
515 Ga0070695_100004638
516 Ga0070695_100037465
517 Ga0070695_100202316
518 Ga0070696_100014346
519 Ga0070696_100045460
520 Ga0070696_100318902
521 Ga0070696_101009357
522 Ga0070693_100044933
523 Ga0070665_100030651
524 Ga0070704_100007670
525 Ga0068855_100464366
526 Ga0070664_100095218
527 Ga0070664_101277816
528 Ga0070664_101726662
529 Ga0070702_100089134
530 Ga0070702_101190779
531 Ga0068852_100057766
532 Ga0068859_100035134
533 Ga0068866_10014754
534 Ga0068866_10552469
535 Ga0068861_100401933
536 Ga0068851_10051135
537 Ga0068851_10963126
538 Ga0068870_10019479
539 Ga0068870_10023058
540 Ga0068863_100039417
541 Ga0068860_101266965
542 Ga0068862_100081876
543 Ga0081538_10023392
544 Ga0081538_10171680
545 Ga0075365_10785002
546 Ga0070715_10004124
547 Ga0070716_100302870
548 Ga0070716_101746411
549 Ga0070712_100089164
550 Ga0070712_100893745
551 Ga0097621_100142721
552 Ga0097621_100332907
553 Ga0068871_100215027
554 Ga0068871_100236491
555 Ga0068871_101795700
556 Ga0075428_100885698
557 Ga0075431_101888141
558 Ga0075433_10010135
559 Ga0075433_10431418
560 Ga0075434_100022573
561 Ga0075434_100193818
562 Ga0075434_100343953
563 Ga0075429_101390986
564 Ga0068865_100028727
565 Ga0075436_100032912
566 Ga0097620_100035134
567 Ga0075435_100580564
568 Ga0111539_10017892
569 Ga0111539_10103326
570 Ga0111539_10922796
571 Ga0105245_10014329
572 Ga0105245_10086732
573 Ga0105245_10138025
574 Ga0105245_10320465
575 Ga0105247_10094690
576 Ga0114129_10081109
577 Ga0114129_10109426
578 Ga0105243_10005317
579 Ga0105243_10045328
580 Ga0105243_11845228
581 Ga0105241_10108447
582 Ga0105242_10010026
583 Ga0105248_10075193
584 Ga0105248_11087340
585 Ga0105249_10137539
586 Ga0105239_10035143
587 Ga0105239_10933642
588 Ga0105246_10063839
589 Ga0105246_12426416
590 Ga0157373_10157572
591 Ga0157371_10021612
592 Ga0157371_10106474
593 Ga0157374_11630311
594 Ga0157378_10214020
595 Ga0157378_10304856
596 Ga0157372_10903365
597 Ga0163163_10201496
598 Ga0163163_11630344
599 Ga0157380_10065818
600 Ga0182008_10963606
601 Ga0157377_10252969
602 Ga0157379_10121081
603 Ga0163161_10186867
604 Ga0213874_10003987
605 Ga0213876_10027834
606 Ga0207656_10112301
607 Ga0207656_10407200
608 Ga0207653_10001866
609 Ga0207692_10030196
610 Ga0207710_10090480
611 Ga0207685_10005207
612 Ga0207699_10117073
613 Ga0207699_10268435
614 Ga0207643_10020419
615 Ga0207643_10207122
616 Ga0207684_10210973
617 Ga0207684_10787852
618 Ga0207654_10211494
619 Ga0207654_10468382
620 Ga0207707_10156288
621 Ga0207707_10249659
622 Ga0207693_10001702
623 Ga0207693_10071453
624 Ga0207663_10165614
625 Ga0207663_10279507
626 Ga0207660_10389575
627 Ga0207660_10520730
628 Ga0207657_10025378
629 Ga0207657_10038188
630 Ga0207649_10528445
631 Ga0207652_10118537
632 Ga0207646_10045170
633 Ga0207646_10276492
634 Ga0207681_10123716
635 Ga0207650_10267446
636 Ga0207687_10056998
637 Ga0207687_10140930
638 Ga0207687_10209762
639 Ga0207687_10901353
640 Ga0207664_10885280
641 Ga0207644_10628925
642 Ga0207690_10111630
643 Ga0207690_10899661
644 Ga0207706_10010156
645 Ga0207706_10069862
646 Ga0207706_10222367
647 Ga0207686_10048053
648 Ga0207709_10013976
649 Ga0207709_10074818
650 Ga0207709_10164011
651 Ga0207669_10026592
652 Ga0207669_11761849
653 Ga0207704_10054340
654 Ga0207704_10831023
655 Ga0207665_10006909
656 Ga0207665_10712545
657 Ga0207711_10164716
658 Ga0207711_12092078
659 Ga0207689_10057962
660 Ga0207689_10514299
661 Ga0207661_10015409
662 Ga0207661_11255343
663 Ga0207661_11618112
664 Ga0207679_11201255
665 Ga0207679_11297375
666 Ga0207667_10331547
667 Ga0207651_10582536
668 Ga0207712_10317587
669 Ga0207668_10418625
670 Ga0207640_10187282
671 Ga0207640_10833899
672 Ga0207658_10624878
673 Ga0207677_10753233
674 Ga0207677_11479254
675 Ga0207639_10224310
676 Ga0207639_10395786
677 Ga0207639_10551307
678 Ga0207639_11179460
679 Ga0207678_10017697
680 Ga0207708_10015442
681 Ga0207708_10302895
682 Ga0207641_10422052
683 Ga0207648_10031706
684 Ga0207676_10047199
685 Ga0207674_10072443
686 Ga0207675_100027462
687 Ga0207675_100377958
688 Ga0207683_10008677
689 Ga0207683_10060704
690 Ga0207683_10076337
691 Ga0207683_10213037
692 Ga0207428_10043514
693 Ga0265319_1020744
694 Ga0265334_10045428
695 Ga0265318_10009874
696 Ga0265322_10063502
697 Ga0265338_10029019
698 Ga0265338_10066434
699 Ga0265338_10258236
700 Ga0265338_10361444
701 Ga0265330_10094956
702 Ga0265320_10365278
703 Ga0265320_10367476
704 Ga0265320_10533054
705 Ga0265325_10207988
706 Ga0265329_10045967
707 Ga0265339_10103251
708 Ga0265327_10057140
709 Ga0265316_10027267
710 Ga0265314_10063310
711 Ga0265342_10319344
712 Ga0307409_101976630
713 Ga0307416_100307840
714 Ga0373930_0004501
715 Ga0373950_0010517
716 Ga0373958_0000860
717 Ga0373959_0005434
718 Ga0373938_0002836
719 Ga0373928_0032593
720 Ga0373929_0007682
721 Ga0373949_0002898
722 Ga0373951_0001764
723 Ga0373951_0008509
724 Ga0373952_0033245
725 Ga0373932_0002131
726 Ga0373939_0001104
727 Ga0373941_0004400
728 Ga0373960_0000379
729 Ga0373960_0100132
730 Ga0373942_0004604
731 Ga0373942_0151348
732 Ga0373961_0011273
733 Ga0373961_0014674
734 Ga0373962_0000833
735 Ga0373962_0011998
736 Ga0373931_0004517
737 Ga0373931_0204831
738 Ga0395899_0477197
739 Ga0395899_0650673
740 Ga0395900_0173807
741 Ga0395900_0186099
742 Ga0395900_0205726
743 Ga0395900_0460724
744 Ga0395900_0588067
745 Ga0395900_1091610
746 Ga0395898_0013091
747 Ga0395898_0032963
748 Ga0395898_0119129
749 Ga0395898_0496964
750 Ga0395898_0902902
751 Ga0395905_0501244
752 Ga0395905_0783693
753 Ga0395905_0873207
754 Ga0395901_0040321
755 Ga0395901_0042544
756 Ga0395901_0081942
757 Ga0395901_0297226
758 Ga0395901_1171610
759 Ga0436365_0366420
760 Ga0436363_1094325
761 Ga0439438_060182
762 Ga0439461_0020008
763 Ga0451789_0472513
764 Ga0451800_0473391
765 Ga0451800_1080634
766 Ga0451802_2085695
767 Ga0451804_0857326
768 Ga0451807_1550634
769 Ga0451807_1882910
770 Ga0451833_1214299
771 Ga0451837_1427208
772 Ga0451839_0997909
773 Ga0451841_1422534
774 Ga0451847_0284722
775 Ga0451849_0897043
776 Ga0451851_0888473
777 Ga0451843_0583775
778 Ga0451853_0323621
779 Ga0451853_0898650
780 Ga0451853_3233425
781 Ga0439445_0035332
782 Ga0450920_020643
783 Ga0450898_043328
784 Ga0439446_0049756
785 Ga0439434_0139251
786 Ga0466972_0164238
787 Ga0451576_0311644
788 Ga0466967_1877626
789 Ga0495592_0392278
790 Ga0495628_0067168
791 Ga0495656_0054070
792 Ga0495602_0292568
793 Ga0496100_0014676
794 Ga0496100_0131554
795 Ga0496101_0059768
796 Ga0496101_0190588
797 Ga0496101_0241855
798 Ga0496101_0513561
799 Ga0496102_0096932
800 Ga0496102_0132140
801 Ga0496102_0615943
802 Ga0496103_0005385
803 Ga0496103_0246834
804 Ga0496103_0453027
805 Ga0496104_0120486
806 Ga0496104_0186946
807 Ga0496105_0014154
808 Ga0496105_0756472
809 Ga0496106_0144727
810 Ga0496106_0310153
811 Ga0496106_0911039
812 Ga0496107_0042800
813 Ga0496107_0070922
814 Ga0496107_0137150
815 Ga0496108_0150560
816 Ga0496108_0175587
817 Ga0496109_0027121
818 Ga0496109_0030617
819 Ga0496109_0607385
820 Ga0496109_1190514
821 Ga0496110_0018736
822 Ga0496110_0046616
823 Ga0496110_0438050
824 Ga0496110_0985573
825 Ga0496110_1168031
826 Ga0496111_0039577
827 Ga0496111_0071265
828 Ga0496111_0107665
829 Ga0496111_0596672
830 Ga0496111_0769469
831 Ga0496112_0100738
832 Ga0496112_0547653
833 Ga0496113_0251564
834 Ga0496114_0013425
835 Ga0496114_0126182
836 Ga0496115_0096488
837 Ga0496115_0559101
838 Ga0501039_0100950
839 Ga0501040_0609944
840 Ga0501042_0226420
841 Ga0501048_0081944
842 Ga0501072_0099518
843 Ga0501072_0979088
844 Ga0501075_0055388
845 Ga0501076_0068803
846 Ga0501077_0105850
847 Ga0501077_0569654
848 Ga0501080_0389913
849 Ga0501081_0090594
850 Ga0501083_0612049
851 Ga0501045_0993553
852 Ga0501045_1130536
853 nmdc:mga04h51_362256_c1
854 nmdc:mga05p37_49820_c1
855 nmdc:mga05p37_692341_c1
856 nmdc:mga08y16_106428_c1
857 nmdc:mga08y16_60861_c1
858 nmdc:mga0n895_1001007_c1
859 nmdc:mga0n895_29005_c1
860 nmdc:mga0rr50_459586_c1
861 nmdc:mga0rr50_483611_c1
862 nmdc:mga08x19_36342_c1
863 nmdc:mga0a205_369793_c1
864 nmdc:mga0a205_401038_c1
865 Ga0495619_0809447
866 Ga0501084_0205683
867 Ga0501082_0133628
868 Ga0501082_0437753
869 Ga0501082_0573727
870 Ga0501082_0868263
871 Ga0530510_0046836
872 Ga0530510_0178344
873 Ga0530510_1451786
874 Ga0530510_1488281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

26

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_A-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9201 1 116
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9184 1 116
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9152 2 116
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9145 1 116
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.9128 1 117
ID Description Score Start End Superfamily
2cg8A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9185 1 117 3.30.1130.10
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9106 1 116 3.30.1130.10
2cg8A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.903 1 117 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9003 1 117 3.30.1130.10
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8998 1 116 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A7M2YX50-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9716 1 117 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7M2YX50-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9636 1 117 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7V4MYU1-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9545 1 116 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A538UCD4-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9514 1 117 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A538U1P2-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9494 1 117 GO:0004150
GO:0005737
GO:0046654
GO:0046656

Map