F443560

General Info

Members Datasets Scaffolds Average Seq Length
436 156 436 424

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10075807|Ga0157379_100758072
Length 487
Sequence MRRDVGGDCIKILCGLCSPPLRNGLDRAARHLDCCRYKAQLRVAMTPMPMIDRRPVATRFAFYVGAVAMVALSTLVGLVIAPRWGNSAVDLLYLPAVLVAAILGGLRPALLAALGSALAYNYFFTVPHRSFRVDSPSDLVTIIVLFLVAMVVSQLAASVREQARIAAGHAARNLTIAGLARRLLSCTSELEIAEVTTTELAVVFDCNAVLVSGTPEPAIVACAPDPQSLTPSDVAAAALTLQTGEAAGRGLKRVDPASWQFHPVSSEDRVIAAVGLARDDGAPPIASEQLSLLQSLLDQIALALERARLENDARQFATLRERDRVRSSLLASIGQDVTPALKSIGAAVRQLRRNGSSDKTQLSAIQSETTKLERYVSNLVEVGPDEEHKPITAGGVTIDLFQRIVSRDGRDVHLTPKEYAVLAELAKHPGRVLTHEHLLRTAWGPAQEQQTEYLRVAIRALRQKLEVQPSRPQLIVNEPAVGYRLLA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 1.83
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000395 3300001979 Bacteria 18718
2 JGI24740J21852_10007079 3300001979 Bacteria 4596
3 JGI24739J22299_10005790 3300001989 Bacteria 4682
4 JGI24737J22298_10000051 3300001990 Bacteria 34099
5 JGI24737J22298_10001720 3300001990 Bacteria 7801
6 JGI24735J21928_10001952 3300002067 Bacteria 7248
7 JGI24735J21928_10004007 3300002067 Bacteria 4984
8 Ga0070658_10000179 3300005327 Bacteria 55511
9 Ga0070658_10000496 3300005327 Bacteria 34219
10 Ga0070658_10001209 3300005327 Bacteria 22133
11 Ga0070676_10068033 3300005328 Bacteria 2131
12 Ga0070683_100002632 3300005329 Bacteria 14348
13 Ga0070683_100018145 3300005329 Bacteria 6227
14 Ga0070683_100039375 3300005329 Bacteria 4339
15 Ga0070683_100039994 3300005329 Bacteria 4308
16 Ga0070683_100219055 3300005329 Bacteria 1809
17 Ga0070670_100007621 3300005331 Bacteria 9195
18 Ga0070670_100048538 3300005331 Bacteria 3653
19 Ga0070670_100050460 3300005331 Bacteria 3575
20 Ga0070670_100140470 3300005331 Bacteria 2088
21 Ga0070666_10000638 3300005335 Bacteria 21126
22 Ga0070666_10020282 3300005335 Bacteria 4296
23 Ga0070680_100007272 3300005336 Bacteria 8438
24 Ga0070680_100149716 3300005336 Bacteria 1959
25 Ga0070682_100026385 3300005337 Bacteria 3476
26 Ga0070682_100055467 3300005337 Bacteria 2489
27 Ga0070660_100000041 3300005339 Bacteria 74469
28 Ga0070660_100000094 3300005339 Bacteria 53860
29 Ga0070660_100000688 3300005339 Bacteria 22377
30 Ga0070660_100000767 3300005339 Bacteria 21303
31 Ga0070660_100022463 3300005339 Bacteria 4665
32 Ga0070660_100043426 3300005339 Bacteria 3435
33 Ga0070689_100010488 3300005340 Bacteria 6605
34 Ga0070661_100000168 3300005344 Bacteria 53906
35 Ga0070661_100016908 3300005344 Bacteria 5164
36 Ga0070661_100017499 3300005344 Bacteria 5087
37 Ga0070661_100058934 3300005344 Bacteria 2814
38 Ga0070661_100063862 3300005344 Bacteria 2705
39 Ga0070661_100071244 3300005344 Bacteria 2558
40 Ga0070661_100095835 3300005344 Bacteria 2201
41 Ga0070661_100100812 3300005344 Bacteria 2147
42 Ga0070692_10032578 3300005345 Bacteria 2621
43 Ga0070692_10069869 3300005345 Bacteria 1869
44 Ga0070668_100016706 3300005347 Bacteria 5485
45 Ga0070668_100048602 3300005347 Bacteria 3263
46 Ga0070669_100000699 3300005353 Bacteria 24602
47 Ga0070675_100012015 3300005354 Bacteria 6788
48 Ga0070675_100026739 3300005354 Bacteria 4630
49 Ga0070675_100100506 3300005354 Bacteria 2436
50 Ga0070671_100010935 3300005355 Bacteria 7290
51 Ga0070671_100035702 3300005355 Bacteria 4118
52 Ga0070671_100035885 3300005355 Bacteria 4109
53 Ga0070674_100014760 3300005356 Bacteria 4862
54 Ga0070673_100003743 3300005364 Bacteria 9537
55 Ga0070673_100027925 3300005364 Bacteria 4190
56 Ga0070673_100241697 3300005364 Bacteria 1570
57 Ga0070659_100000544 3300005366 Bacteria 27513
58 Ga0070659_100000753 3300005366 Bacteria 23494
59 Ga0070659_100034490 3300005366 Bacteria 3936
60 Ga0070659_100067636 3300005366 Bacteria 2833
61 Ga0070659_100070251 3300005366 Bacteria 2781
62 Ga0070659_100224781 3300005366 Bacteria 1550
63 Ga0070667_100001558 3300005367 Bacteria 20556
64 Ga0070667_100014258 3300005367 Bacteria 6563
65 Ga0070667_100020506 3300005367 Bacteria 5487
66 Ga0070667_100050677 3300005367 Bacteria 3499
67 Ga0070667_100054943 3300005367 Bacteria 3363
68 Ga0070667_100076463 3300005367 Bacteria 2858
69 Ga0070714_100014383 3300005435 Bacteria 6357
70 Ga0070714_100055062 3300005435 Bacteria 3399
71 Ga0070663_100004036 3300005455 Bacteria 8564
72 Ga0070663_100004382 3300005455 Bacteria 8287
73 Ga0070663_100007806 3300005455 Bacteria 6540
74 Ga0070663_100009430 3300005455 Bacteria 6043
75 Ga0070663_100013855 3300005455 Bacteria 5158
76 Ga0070663_100051992 3300005455 Bacteria 2921
77 Ga0070663_100127347 3300005455 Bacteria 1930
78 Ga0070678_100230022 3300005456 Bacteria 1545
79 Ga0070662_100000034 3300005457 Bacteria 78070
80 Ga0070662_100002248 3300005457 Bacteria 11841
81 Ga0070662_100016029 3300005457 Bacteria 5029
82 Ga0070662_100024299 3300005457 Bacteria 4174
83 Ga0070662_100057101 3300005457 Bacteria 2835
84 Ga0070662_100071681 3300005457 Bacteria 2556
85 Ga0070662_100082626 3300005457 Bacteria 2396
86 Ga0070681_10084474 3300005458 Bacteria 3127
87 Ga0068867_100001924 3300005459 Bacteria 14465
88 Ga0068867_100010515 3300005459 Bacteria 6530
89 Ga0070679_100004417 3300005530 Bacteria 13001
90 Ga0070679_100040305 3300005530 Bacteria 4647
91 Ga0070679_100095403 3300005530 Bacteria 2962
92 Ga0070679_100199456 3300005530 Bacteria 1968
93 Ga0068853_100000291 3300005539 Bacteria 35346
94 Ga0068853_100006221 3300005539 Bacteria 9456
95 Ga0068853_100006908 3300005539 Bacteria 9060
96 Ga0068853_100022901 3300005539 Bacteria 5223
97 Ga0070672_100000234 3300005543 Bacteria 31015
98 Ga0070672_100253227 3300005543 Bacteria 1483
99 Ga0070686_100000138 3300005544 Bacteria 50075
100 Ga0070693_100000220 3300005547 Bacteria 26504
101 Ga0070693_100030688 3300005547 Bacteria 2940
102 Ga0070665_100000195 3300005548 Bacteria 106493
103 Ga0070665_100003386 3300005548 Bacteria 17051
104 Ga0070665_100003766 3300005548 Bacteria 16049
105 Ga0070665_100016958 3300005548 Bacteria 7303
106 Ga0070665_100139428 3300005548 Bacteria 2428
107 Ga0068855_100000163 3300005563 Bacteria 85587
108 Ga0068855_100000247 3300005563 Bacteria 68071
109 Ga0068855_100041903 3300005563 Bacteria 5426
110 Ga0068855_100045801 3300005563 Bacteria 5172
111 Ga0068855_100213822 3300005563 Bacteria 2165
112 Ga0068855_100254002 3300005563 Unclassified 1960
113 Ga0068855_100392355 3300005563 Unclassified 1522
114 Ga0070664_100000043 3300005564 Bacteria 76803
115 Ga0070664_100002457 3300005564 Bacteria 14923
116 Ga0070664_100006897 3300005564 Bacteria 9156
117 Ga0070664_100049625 3300005564 Bacteria 3550
118 Ga0068857_100007919 3300005577 Bacteria 9169
119 Ga0068857_100049163 3300005577 Bacteria 3742
120 Ga0068857_100101527 3300005577 Bacteria 2581
121 Ga0068854_100000061 3300005578 Bacteria 78663
122 Ga0068854_100001151 3300005578 Bacteria 15907
123 Ga0068854_100006885 3300005578 Bacteria 7249
124 Ga0068854_100016221 3300005578 Bacteria 4960
125 Ga0068854_100071608 3300005578 Bacteria 2536
126 Ga0068854_100131525 3300005578 Bacteria 1911
127 Ga0068856_100000149 3300005614 Bacteria 71048
128 Ga0068856_100023464 3300005614 Bacteria 5998
129 Ga0068856_100050651 3300005614 Bacteria 4094
130 Ga0068856_100122952 3300005614 Bacteria 2598
131 Ga0068856_100171080 3300005614 Bacteria 2184
132 Ga0068856_100180652 3300005614 Bacteria 2123
133 Ga0068852_100000540 3300005616 Bacteria 24862
134 Ga0068852_100000847 3300005616 Bacteria 20320
135 Ga0068852_100002361 3300005616 Bacteria 13005
136 Ga0068852_100003663 3300005616 Bacteria 10767
137 Ga0068852_100008826 3300005616 Bacteria 7461
138 Ga0068852_100041269 3300005616 Bacteria 3899
139 Ga0068859_100003001 3300005617 Bacteria 17114
140 Ga0068859_100257318 3300005617 Bacteria 1836
141 Ga0068864_100000378 3300005618 Bacteria 38838
142 Ga0068864_100069418 3300005618 Bacteria 3064
143 Ga0068851_10014237 3300005834 Bacteria 3775
144 Ga0068851_10014321 3300005834 Bacteria 3765
145 Ga0068851_10082255 3300005834 Bacteria 1683
146 Ga0068863_100000523 3300005841 Bacteria 39154
147 Ga0068863_100015853 3300005841 Bacteria 7229
148 Ga0068863_100036953 3300005841 Bacteria 4650
149 Ga0068863_100123953 3300005841 Bacteria 2465
150 Ga0068863_100163389 3300005841 Unclassified 2134
151 Ga0068858_100012709 3300005842 Bacteria 7933
152 Ga0068858_100026804 3300005842 Bacteria 5354
153 Ga0068858_100031805 3300005842 Bacteria 4904
154 Ga0068860_100007966 3300005843 Bacteria 10567
155 Ga0068860_100058164 3300005843 Bacteria 3675
156 Ga0068862_100011826 3300005844 Bacteria 7207
157 Ga0068862_100054057 3300005844 Bacteria 3438
158 Ga0075363_100000119 3300006048 Bacteria 18451
159 Ga0075362_10000012 3300006177 Bacteria 106760
160 Ga0075369_10000157 3300006186 Bacteria 19210
161 Ga0075366_10002064 3300006195 Bacteria 10203
162 Ga0097621_100157275 3300006237 Unclassified 1951
163 Ga0075370_10000131 3300006353 Bacteria 25052
164 Ga0068865_100000434 3300006881 Bacteria 23266
165 Ga0068865_100089235 3300006881 Bacteria 2232
166 Ga0097620_100003001 3300006931 Bacteria 17114
167 Ga0097620_100257321 3300006931 Bacteria 1836
168 Ga0105240_10032076 3300009093 Bacteria 6804
169 Ga0105245_10000424 3300009098 Bacteria 39397
170 Ga0105241_10007436 3300009174 Bacteria 8065
171 Ga0105248_10000159 3300009177 Bacteria 78504
172 Ga0105248_10004178 3300009177 Bacteria 15951
173 Ga0105248_10073740 3300009177 Bacteria 3836
174 Ga0105248_10379482 3300009177 Bacteria 1591
175 Ga0105237_10025856 3300009545 Bacteria 6002
176 Ga0105237_10203413 3300009545 Unclassified 1981
177 Ga0105238_10017594 3300009551 Bacteria 7266
178 Ga0157373_10001876 3300013100 Bacteria 15943
179 Ga0157373_10004774 3300013100 Bacteria 10200
180 Ga0157373_10007128 3300013100 Bacteria 8337
181 Ga0157373_10030891 3300013100 Bacteria 3854
182 Ga0157373_10040500 3300013100 Bacteria 3334
183 Ga0157373_10089844 3300013100 Bacteria 2163
184 Ga0157371_10002948 3300013102 Bacteria 15849
185 Ga0157371_10003598 3300013102 Bacteria 13964
186 Ga0157371_10004322 3300013102 Bacteria 12459
187 Ga0157371_10010006 3300013102 Bacteria 7421
188 Ga0157371_10022145 3300013102 Bacteria 4661
189 Ga0157371_10063142 3300013102 Bacteria 2625
190 Ga0157370_10016408 3300013104 Bacteria 7497
191 Ga0157370_10064890 3300013104 Bacteria 3455
192 Ga0157370_10117692 3300013104 Bacteria 2482
193 Ga0157370_10118298 3300013104 Bacteria 2475
194 Ga0157369_10002297 3300013105 Bacteria 22999
195 Ga0157369_10097455 3300013105 Bacteria 3137
196 Ga0157374_10062928 3300013296 Bacteria 3479
197 Ga0157378_10006264 3300013297 Bacteria 10415
198 Ga0163162_10069474 3300013306 Bacteria 3574
199 Ga0157372_10112759 3300013307 Bacteria 3116
200 Ga0157372_10131475 3300013307 Bacteria 2880
201 Ga0157372_10170845 3300013307 Bacteria 2515
202 Ga0157372_10255833 3300013307 Bacteria 2033
203 Ga0157372_10303097 3300013307 Bacteria 1859
204 Ga0157375_10055864 3300013308 Bacteria 3895
205 Ga0163163_10083608 3300014325 Bacteria 3197
206 Ga0157379_10075807 3300014968 Bacteria 3012
207 Ga0213876_10025982 3300021384 Bacteria 3088
208 Ga0207697_10002979 3300025315 Bacteria 8549
209 Ga0207656_10003292 3300025321 Bacteria 5538
210 Ga0207656_10009413 3300025321 Bacteria 3628
211 Ga0207656_10023896 3300025321 Bacteria 2466
212 Ga0207688_10000018 3300025901 Bacteria 51641
213 Ga0207680_10001318 3300025903 Bacteria 11705
214 Ga0207680_10013782 3300025903 Bacteria 4162
215 Ga0207680_10082026 3300025903 Bacteria 2028
216 Ga0207647_10000333 3300025904 Bacteria 38836
217 Ga0207647_10001648 3300025904 Bacteria 17173
218 Ga0207647_10002012 3300025904 Bacteria 15553
219 Ga0207647_10005211 3300025904 Bacteria 9567
220 Ga0207647_10008050 3300025904 Bacteria 7578
221 Ga0207647_10018999 3300025904 Bacteria 4630
222 Ga0207647_10057027 3300025904 Bacteria 2395
223 Ga0207645_10004865 3300025907 Bacteria 9852
224 Ga0207645_10075817 3300025907 Bacteria 2153
225 Ga0207705_10000082 3300025909 Bacteria 118194
226 Ga0207705_10000191 3300025909 Bacteria 62363
227 Ga0207705_10001215 3300025909 Bacteria 20857
228 Ga0207705_10002012 3300025909 Bacteria 15815
229 Ga0207705_10010246 3300025909 Bacteria 6819
230 Ga0207705_10027791 3300025909 Bacteria 4034
231 Ga0207705_10032613 3300025909 Bacteria 3723
232 Ga0207705_10038291 3300025909 Bacteria 3432
233 Ga0207707_10059972 3300025912 Bacteria 3310
234 Ga0207695_10125616 3300025913 Unclassified 2528
235 Ga0207660_10003565 3300025917 Bacteria 10137
236 Ga0207657_10000031 3300025919 Bacteria 132167
237 Ga0207657_10000058 3300025919 Bacteria 103811
238 Ga0207657_10001215 3300025919 Bacteria 27430
239 Ga0207657_10008817 3300025919 Bacteria 10202
240 Ga0207657_10010774 3300025919 Bacteria 9101
241 Ga0207657_10020433 3300025919 Bacteria 6257
242 Ga0207657_10027535 3300025919 Bacteria 5205
243 Ga0207657_10033912 3300025919 Bacteria 4597
244 Ga0207657_10059269 3300025919 Bacteria 3291
245 Ga0207657_10065040 3300025919 Bacteria 3110
246 Ga0207657_10115887 3300025919 Unclassified 2208
247 Ga0207649_10000148 3300025920 Bacteria 57865
248 Ga0207649_10004550 3300025920 Bacteria 7531
249 Ga0207649_10035788 3300025920 Bacteria 2986
250 Ga0207649_10097859 3300025920 Bacteria 1935
251 Ga0207652_10000133 3300025921 Bacteria 80146
252 Ga0207652_10006598 3300025921 Bacteria 9353
253 Ga0207652_10031295 3300025921 Bacteria 4468
254 Ga0207652_10044920 3300025921 Bacteria 3766
255 Ga0207652_10260811 3300025921 Unclassified 1563
256 Ga0207681_10001180 3300025923 Bacteria 16821
257 Ga0207681_10161575 3300025923 Bacteria 1689
258 Ga0207694_10021310 3300025924 Bacteria 4911
259 Ga0207650_10005251 3300025925 Bacteria 8833
260 Ga0207659_10008440 3300025926 Bacteria 6393
261 Ga0207659_10073681 3300025926 Bacteria 2501
262 Ga0207664_10041407 3300025929 Bacteria 3588
263 Ga0207664_10041520 3300025929 Bacteria 3584
264 Ga0207644_10006606 3300025931 Bacteria 7558
265 Ga0207690_10000185 3300025932 Bacteria 47899
266 Ga0207690_10006226 3300025932 Bacteria 7065
267 Ga0207690_10049867 3300025932 Bacteria 2792
268 Ga0207690_10114911 3300025932 Bacteria 1944
269 Ga0207706_10000028 3300025933 Bacteria 149092
270 Ga0207706_10000171 3300025933 Bacteria 72122
271 Ga0207706_10006168 3300025933 Bacteria 11130
272 Ga0207706_10010098 3300025933 Bacteria 8646
273 Ga0207706_10026236 3300025933 Bacteria 5215
274 Ga0207706_10029452 3300025933 Bacteria 4900
275 Ga0207706_10046456 3300025933 Bacteria 3844
276 Ga0207706_10062650 3300025933 Bacteria 3275
277 Ga0207706_10094024 3300025933 Bacteria 2637
278 Ga0207704_10006236 3300025938 Bacteria 5545
279 Ga0207691_10000070 3300025940 Bacteria 84000
280 Ga0207691_10058803 3300025940 Bacteria 3496
281 Ga0207711_10002610 3300025941 Bacteria 16002
282 Ga0207711_10004177 3300025941 Bacteria 12363
283 Ga0207689_10000123 3300025942 Bacteria 64762
284 Ga0207661_10000261 3300025944 Bacteria 33999
285 Ga0207661_10018366 3300025944 Bacteria 5194
286 Ga0207661_10022573 3300025944 Bacteria 4742
287 Ga0207661_10094351 3300025944 Bacteria 2499
288 Ga0207661_10104891 3300025944 Bacteria 2381
289 Ga0207679_10000129 3300025945 Bacteria 61477
290 Ga0207679_10022650 3300025945 Bacteria 4281
291 Ga0207679_10032176 3300025945 Unclassified 3679
292 Ga0207679_10067613 3300025945 Bacteria 2681
293 Ga0207667_10000114 3300025949 Bacteria 128923
294 Ga0207667_10000357 3300025949 Bacteria 62034
295 Ga0207667_10042732 3300025949 Bacteria 4816
296 Ga0207651_10000332 3300025960 Bacteria 20079
297 Ga0207640_10005515 3300025981 Bacteria 6895
298 Ga0207640_10014576 3300025981 Bacteria 4530
299 Ga0207640_10015732 3300025981 Bacteria 4385
300 Ga0207640_10023161 3300025981 Bacteria 3729
301 Ga0207658_10005135 3300025986 Bacteria 9018
302 Ga0207658_10011578 3300025986 Bacteria 6005
303 Ga0207658_10082350 3300025986 Bacteria 2471
304 Ga0207677_10000970 3300026023 Bacteria 15880
305 Ga0207703_10019736 3300026035 Bacteria 5269
306 Ga0207703_10054175 3300026035 Bacteria 3261
307 Ga0207703_10123081 3300026035 Bacteria 2229
308 Ga0207639_10000675 3300026041 Bacteria 23574
309 Ga0207639_10006053 3300026041 Bacteria 8209
310 Ga0207639_10023476 3300026041 Bacteria 4454
311 Ga0207678_10005348 3300026067 Bacteria 11496
312 Ga0207678_10005441 3300026067 Bacteria 11393
313 Ga0207678_10009975 3300026067 Bacteria 8334
314 Ga0207678_10017824 3300026067 Bacteria 6235
315 Ga0207678_10025675 3300026067 Bacteria 5142
316 Ga0207678_10060424 3300026067 Bacteria 3260
317 Ga0207678_10060717 3300026067 Bacteria 3252
318 Ga0207678_10069755 3300026067 Bacteria 3014
319 Ga0207702_10001695 3300026078 Bacteria 21764
320 Ga0207702_10033238 3300026078 Bacteria 4307
321 Ga0207702_10049133 3300026078 Bacteria 3559
322 Ga0207641_10002327 3300026088 Bacteria 17629
323 Ga0207641_10009748 3300026088 Bacteria 7911
324 Ga0207641_10011371 3300026088 Bacteria 7303
325 Ga0207648_10000317 3300026089 Bacteria 52853
326 Ga0207648_10004979 3300026089 Bacteria 13505
327 Ga0207648_10111524 3300026089 Bacteria 2401
328 Ga0207676_10001136 3300026095 Bacteria 20113
329 Ga0207676_10003796 3300026095 Bacteria 10683
330 Ga0207676_10035995 3300026095 Bacteria 3762
331 Ga0207674_10000937 3300026116 Bacteria 38029
332 Ga0207674_10002465 3300026116 Bacteria 23361
333 Ga0207674_10006989 3300026116 Bacteria 13205
334 Ga0207674_10011582 3300026116 Bacteria 9904
335 Ga0207674_10012673 3300026116 Bacteria 9420
336 Ga0207674_10014935 3300026116 Bacteria 8557
337 Ga0207674_10015537 3300026116 Bacteria 8360
338 Ga0207674_10028906 3300026116 Bacteria 5843
339 Ga0207674_10182692 3300026116 Bacteria 2048
340 Ga0207675_100097706 3300026118 Bacteria 2765
341 Ga0207683_10011043 3300026121 Bacteria 7696
342 Ga0207698_10000723 3300026142 Bacteria 19154
343 Ga0207698_10009884 3300026142 Bacteria 6101
344 Ga0207698_10021455 3300026142 Bacteria 4467
345 Ga0207698_10059837 3300026142 Bacteria 2959
346 Ga0207698_10060671 3300026142 Bacteria 2942
347 Ga0268266_10001710 3300028379 Bacteria 25123
348 Ga0268266_10005171 3300028379 Bacteria 12291
349 Ga0268266_10006817 3300028379 Bacteria 10405
350 Ga0268266_10093387 3300028379 Bacteria 2640
351 Ga0268265_10007449 3300028380 Bacteria 7392
352 Ga0268265_10016782 3300028380 Bacteria 5040
353 Ga0268265_10058214 3300028380 Bacteria 2949
354 Ga0268265_10294810 3300028380 Bacteria 1457
355 Ga0268264_10002173 3300028381 Bacteria 17473
356 Ga0307408_100058166 3300031548 Bacteria 2809
357 Ga0307405_10083778 3300031731 Bacteria 2091
358 Ga0307413_10050383 3300031824 Bacteria 2501
359 Ga0307410_10014701 3300031852 Bacteria 4617
360 Ga0307407_10003387 3300031903 Bacteria 6528
361 Ga0307412_10104300 3300031911 Bacteria 2011
362 Ga0307412_10125721 3300031911 Bacteria 1854
363 Ga0307416_100037860 3300032002 Bacteria 3716
364 Ga0307411_10007255 3300032005 Bacteria 5626
365 Ga0307411_10021239 3300032005 Bacteria 3794
366 Ga0307415_100016280 3300032126 Bacteria 4429
367 Ga0373931_0075119 3300035691 Bacteria 1853
368 Ga0395899_0000112 3300037312 Bacteria 138389
369 Ga0395899_0040772 3300037312 Bacteria 3472
370 Ga0395899_0055109 3300037312 Bacteria 2941
371 Ga0395900_0000614 3300037418 Bacteria 48329
372 Ga0395900_0018937 3300037418 Bacteria 7021
373 Ga0395900_0035085 3300037418 Bacteria 5167
374 Ga0395900_0038203 3300037418 Bacteria 4949
375 Ga0395900_0058067 3300037418 Bacteria 3983
376 Ga0395900_0096198 3300037418 Bacteria 3042
377 Ga0395900_0125663 3300037418 Bacteria 2630
378 Ga0395898_0011853 3300037466 Bacteria 9030
379 Ga0395898_0013439 3300037466 Bacteria 8431
380 Ga0395898_0024186 3300037466 Bacteria 6128
381 Ga0395898_0035388 3300037466 Bacteria 4966
382 Ga0395898_0068467 3300037466 Bacteria 3435
383 Ga0395898_0092756 3300037466 Bacteria 2903
384 Ga0395898_0204276 3300037466 Bacteria 1885
385 Ga0395905_0000523 3300037471 Bacteria 52635
386 Ga0395905_0016321 3300037471 Bacteria 7056
387 Ga0395905_0026341 3300037471 Bacteria 5483
388 Ga0395905_0036192 3300037471 Bacteria 4635
389 Ga0395905_0042547 3300037471 Bacteria 4263
390 Ga0395905_0054803 3300037471 Bacteria 3731
391 Ga0395905_0057235 3300037471 Bacteria 3647
392 Ga0395905_0068666 3300037471 Bacteria 3319
393 Ga0395905_0080453 3300037471 Bacteria 3053
394 Ga0395905_0086578 3300037471 Bacteria 2937
395 Ga0395905_0089587 3300037471 Bacteria 2883
396 Ga0395905_0101781 3300037471 Bacteria 2697
397 Ga0395905_0226345 3300037471 Bacteria 1749
398 Ga0395901_0000047 3300038443 Bacteria 175221
399 Ga0395901_0002453 3300038443 Bacteria 18800
400 Ga0395901_0007608 3300038443 Bacteria 10937
401 Ga0395901_0013672 3300038443 Bacteria 8249
402 Ga0395901_0066208 3300038443 Bacteria 3763
403 Ga0395901_0094208 3300038443 Bacteria 3136
404 Ga0395901_0333353 3300038443 Bacteria 1568
405 Ga0466966_0000111 3300044684 Bacteria 50890
406 Ga0466966_0029396 3300044684 Bacteria 3575
407 Ga0466966_0065412 3300044684 Bacteria 2287
408 Ga0466963_0004999 3300044694 Bacteria 7741
409 Ga0466963_0125867 3300044694 Bacteria 1767
410 Ga0466971_0001429 3300044719 Bacteria 10039
411 Ga0466957_0005001 3300044842 Bacteria 7419
412 Ga0466958_0004352 3300045836 Bacteria 7468
413 Ga0466958_0061605 3300045836 Unclassified 2286
414 Ga0466967_0078982 3300045976 Bacteria 2965
415 Ga0466967_0101446 3300045976 Unclassified 2630
416 Ga0495668_0037088 3300046616 Bacteria 2729
417 Ga0495669_0001387 3300046684 Bacteria 9998
418 Ga0495669_0008320 3300046684 Bacteria 4359
419 Ga0495669_0014681 3300046684 Bacteria 3349
420 Ga0495669_0031043 3300046684 Bacteria 2345
421 Ga0496102_0044004 3300048905 Bacteria 4050
422 Ga0496105_0075575 3300048908 Bacteria 2782
423 Ga0496107_0090895 3300048910 Unclassified 2230
424 Ga0496108_0050326 3300048911 Bacteria 3487
425 Ga0496108_0058687 3300048911 Bacteria 3235
426 Ga0496110_0042476 3300048913 Bacteria 3968
427 Ga0496110_0044758 3300048913 Bacteria 3866
428 Ga0496113_0007019 3300048916 Bacteria 7204
429 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
430 nmdc:mga03n38_6056_c1 3300050490 Bacteria 4174
431 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
432 nmdc:mga0k408_39889_c1 3300050493 Bacteria 2700
433 nmdc:mga06z11_119917_c1 3300050494 Bacteria 1466
434 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
435 nmdc:mga0n895_362981_c1 3300050512 Unclassified 1466
436 nmdc:mga0sz30_269_c3 3300050516 Bacteria 17632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_119917_c1 nmdc:mga06z11_119917_c1_206_1399 375
2 3300037471 Ga0395905_0101781 Ga0395905_0101781_649_1998 385
3 3300001990 JGI24737J22298_10001720 JGI24737J22298_100017202 389
4 3300002067 JGI24735J21928_10001952 JGI24735J21928_100019525 389
5 3300005327 Ga0070658_10000179 Ga0070658_1000017944 389
6 3300005329 Ga0070683_100002632 Ga0070683_10000263212 389
7 3300005335 Ga0070666_10000638 Ga0070666_1000063829 389
8 3300005339 Ga0070660_100000041 Ga0070660_10000004175 389
9 3300005344 Ga0070661_100000168 Ga0070661_10000016861 389
10 3300005366 Ga0070659_100000544 Ga0070659_10000054418 389
11 3300005367 Ga0070667_100054943 Ga0070667_1000549432 389
12 3300005455 Ga0070663_100004382 Ga0070663_1000043829 389
13 3300005457 Ga0070662_100000034 Ga0070662_10000003439 389
14 3300005530 Ga0070679_100095403 Ga0070679_1000954033 389
15 3300005539 Ga0068853_100000291 Ga0068853_10000029130 389
16 3300005547 Ga0070693_100000220 Ga0070693_10000022015 389
17 3300005548 Ga0070665_100003386 Ga0070665_10000338615 389
18 3300005563 Ga0068855_100000163 Ga0068855_10000016370 389
19 3300005564 Ga0070664_100000043 Ga0070664_10000004319 389
20 3300005614 Ga0068856_100000149 Ga0068856_10000014978 389
21 3300005616 Ga0068852_100002361 Ga0068852_1000023617 389
22 3300005618 Ga0068864_100069418 Ga0068864_1000694182 389
23 3300005842 Ga0068858_100026804 Ga0068858_1000268044 389
24 3300009177 Ga0105248_10004178 Ga0105248_1000417811 389
25 3300013100 Ga0157373_10004774 Ga0157373_100047744 389
26 3300013102 Ga0157371_10004322 Ga0157371_1000432211 389
27 3300025321 Ga0207656_10003292 Ga0207656_100032922 389
28 3300025903 Ga0207680_10001318 Ga0207680_100013181 389
29 3300025904 Ga0207647_10005211 Ga0207647_100052118 389
30 3300025909 Ga0207705_10000191 Ga0207705_1000019168 389
31 3300025919 Ga0207657_10000031 Ga0207657_1000003176 389
32 3300025920 Ga0207649_10000148 Ga0207649_1000014839 389
33 3300025932 Ga0207690_10000185 Ga0207690_1000018523 389
34 3300025933 Ga0207706_10000028 Ga0207706_1000002894 389
35 3300025941 Ga0207711_10004177 Ga0207711_100041772 389
36 3300025945 Ga0207679_10000129 Ga0207679_1000012950 389
37 3300025949 Ga0207667_10000357 Ga0207667_1000035723 389
38 3300025981 Ga0207640_10014576 Ga0207640_100145761 389
39 3300026035 Ga0207703_10019736 Ga0207703_100197362 389
40 3300026041 Ga0207639_10000675 Ga0207639_1000067511 389
41 3300026067 Ga0207678_10009975 Ga0207678_100099759 389
42 3300026078 Ga0207702_10001695 Ga0207702_1000169510 389
43 3300026095 Ga0207676_10035995 Ga0207676_100359952 389
44 3300026142 Ga0207698_10000723 Ga0207698_100007233 389
45 3300028379 Ga0268266_10006817 Ga0268266_1000681710 389
46 3300045836 Ga0466958_0061605 Ga0466958_0061605_414_1751 390
47 3300045976 Ga0466967_0101446 Ga0466967_0101446_348_1685 390
48 3300005336 Ga0070680_100149716 Ga0070680_1001497162 391
49 3300044684 Ga0466966_0029396 Ga0466966_0029396_684_1970 391
50 3300025932 Ga0207690_10049867 Ga0207690_100498672 392
51 3300032126 Ga0307415_100016280 Ga0307415_1000162803 393
52 3300031911 Ga0307412_10125721 Ga0307412_101257211 394
53 3300032002 Ga0307416_100037860 Ga0307416_1000378603 394
54 3300031548 Ga0307408_100058166 Ga0307408_1000581662 395
55 3300031824 Ga0307413_10050383 Ga0307413_100503832 395
56 3300031852 Ga0307410_10014701 Ga0307410_100147012 395
57 3300031903 Ga0307407_10003387 Ga0307407_100033873 395
58 3300031911 Ga0307412_10104300 Ga0307412_101043002 395
59 3300037312 Ga0395899_0055109 Ga0395899_0055109_1295_2629 395
60 3300037418 Ga0395900_0038203 Ga0395900_0038203_1990_3324 395
61 3300037466 Ga0395898_0013439 Ga0395898_0013439_681_2015 395
62 3300038443 Ga0395901_0002453 Ga0395901_0002453_16223_17557 395
63 3300044694 Ga0466963_0004999 Ga0466963_0004999_2556_3944 395
64 3300044719 Ga0466971_0001429 Ga0466971_0001429_2902_4290 395
65 3300044842 Ga0466957_0005001 Ga0466957_0005001_3795_5183 395
66 3300045836 Ga0466958_0004352 Ga0466958_0004352_4824_6212 395
67 3300048916 Ga0496113_0007019 Ga0496113_0007019_4136_5470 395
68 3300025944 Ga0207661_10094351 Ga0207661_100943512 397
69 3300037466 Ga0395898_0035388 Ga0395898_0035388_1946_3205 397
70 3300005548 Ga0070665_100000195 Ga0070665_10000019580 398
71 3300005578 Ga0068854_100071608 Ga0068854_1000716082 398
72 3300005614 Ga0068856_100180652 Ga0068856_1001806522 398
73 3300005616 Ga0068852_100000540 Ga0068852_10000054010 398
74 3300025909 Ga0207705_10027791 Ga0207705_100277912 398
75 3300026089 Ga0207648_10111524 Ga0207648_101115242 398
76 3300028379 Ga0268266_10001710 Ga0268266_100017102 398
77 3300031731 Ga0307405_10083778 Ga0307405_100837782 398
78 3300005335 Ga0070666_10020282 Ga0070666_100202822 399
79 3300005367 Ga0070667_100014258 Ga0070667_1000142582 399
80 3300037471 Ga0395905_0080453 Ga0395905_0080453_279_1679 399
81 3300005366 Ga0070659_100070251 Ga0070659_1000702512 400
82 3300025932 Ga0207690_10114911 Ga0207690_101149112 400
83 3300026067 Ga0207678_10060424 Ga0207678_100604242 400
84 3300026118 Ga0207675_100097706 Ga0207675_1000977062 400
85 3300037471 Ga0395905_0016321 Ga0395905_0016321_4733_6085 400
86 3300037471 Ga0395905_0042547 Ga0395905_0042547_2181_3512 400
87 3300005344 Ga0070661_100100812 Ga0070661_1001008122 401
88 3300005563 Ga0068855_100392355 Ga0068855_1003923551 401
89 3300005834 Ga0068851_10082255 Ga0068851_100822552 401
90 3300025904 Ga0207647_10018999 Ga0207647_100189993 401
91 3300025909 Ga0207705_10038291 Ga0207705_100382912 401
92 3300025944 Ga0207661_10018366 Ga0207661_100183664 401
93 3300026067 Ga0207678_10025675 Ga0207678_100256752 401
94 3300026078 Ga0207702_10049133 Ga0207702_100491331 401
95 3300026116 Ga0207674_10028906 Ga0207674_100289066 401
96 3300032005 Ga0307411_10007255 Ga0307411_100072552 402
97 3300001979 JGI24740J21852_10007079 JGI24740J21852_100070792 403
98 3300001989 JGI24739J22299_10005790 JGI24739J22299_100057904 403
99 3300002067 JGI24735J21928_10004007 JGI24735J21928_100040074 403
100 3300005329 Ga0070683_100018145 Ga0070683_1000181453 403
101 3300005337 Ga0070682_100026385 Ga0070682_1000263852 403
102 3300005344 Ga0070661_100058934 Ga0070661_1000589342 403
103 3300005455 Ga0070663_100007806 Ga0070663_1000078061 403
104 3300005563 Ga0068855_100041903 Ga0068855_1000419032 403
105 3300005577 Ga0068857_100049163 Ga0068857_1000491632 403
106 3300025917 Ga0207660_10003565 Ga0207660_100035658 403
107 3300025919 Ga0207657_10033912 Ga0207657_100339122 403
108 3300025921 Ga0207652_10006598 Ga0207652_100065982 403
109 3300026041 Ga0207639_10006053 Ga0207639_100060532 403
110 3300026067 Ga0207678_10017824 Ga0207678_100178245 403
111 3300026116 Ga0207674_10014935 Ga0207674_100149358 403
112 3300044684 Ga0466966_0065412 Ga0466966_0065412_839_2185 403
113 3300044694 Ga0466963_0125867 Ga0466963_0125867_63_1412 403
114 3300001990 JGI24737J22298_10000051 JGI24737J22298_1000005131 404
115 3300005329 Ga0070683_100039994 Ga0070683_1000399942 404
116 3300005331 Ga0070670_100007621 Ga0070670_10000762110 404
117 3300005339 Ga0070660_100000767 Ga0070660_10000076710 404
118 3300005339 Ga0070660_100022463 Ga0070660_1000224632 404
119 3300005340 Ga0070689_100010488 Ga0070689_1000104886 404
120 3300005344 Ga0070661_100095835 Ga0070661_1000958351 404
121 3300005347 Ga0070668_100016706 Ga0070668_1000167062 404
122 3300005353 Ga0070669_100000699 Ga0070669_1000006999 404
123 3300005354 Ga0070675_100012015 Ga0070675_1000120157 404
124 3300005355 Ga0070671_100010935 Ga0070671_1000109355 404
125 3300005355 Ga0070671_100035702 Ga0070671_1000357022 404
126 3300005356 Ga0070674_100014760 Ga0070674_1000147604 404
127 3300005364 Ga0070673_100003743 Ga0070673_1000037434 404
128 3300005366 Ga0070659_100000753 Ga0070659_10000075312 404
129 3300005367 Ga0070667_100001558 Ga0070667_10000155812 404
130 3300005367 Ga0070667_100020506 Ga0070667_1000205062 404
131 3300005455 Ga0070663_100127347 Ga0070663_1001273472 404
132 3300005457 Ga0070662_100002248 Ga0070662_1000022488 404
133 3300005457 Ga0070662_100057101 Ga0070662_1000571011 404
134 3300005459 Ga0068867_100001924 Ga0068867_1000019248 404
135 3300005459 Ga0068867_100010515 Ga0068867_1000105156 404
136 3300005539 Ga0068853_100006221 Ga0068853_1000062212 404
137 3300005543 Ga0070672_100000234 Ga0070672_1000002344 404
138 3300005548 Ga0070665_100016958 Ga0070665_1000169585 404
139 3300005563 Ga0068855_100254002 Ga0068855_1002540021 404
140 3300005578 Ga0068854_100000061 Ga0068854_10000006132 404
141 3300005578 Ga0068854_100131525 Ga0068854_1001315252 404
142 3300005614 Ga0068856_100122952 Ga0068856_1001229522 404
143 3300005614 Ga0068856_100171080 Ga0068856_1001710802 404
144 3300005616 Ga0068852_100000847 Ga0068852_1000008479 404
145 3300005616 Ga0068852_100008826 Ga0068852_1000088266 404
146 3300005616 Ga0068852_100041269 Ga0068852_1000412692 404
147 3300005618 Ga0068864_100000378 Ga0068864_1000003785 404
148 3300005834 Ga0068851_10014237 Ga0068851_100142372 404
149 3300005841 Ga0068863_100000523 Ga0068863_1000005237 404
150 3300005842 Ga0068858_100012709 Ga0068858_1000127094 404
151 3300005843 Ga0068860_100007966 Ga0068860_1000079668 404
152 3300005844 Ga0068862_100054057 Ga0068862_1000540571 404
153 3300006237 Ga0097621_100157275 Ga0097621_1001572752 404
154 3300006881 Ga0068865_100000434 Ga0068865_1000004342 404
155 3300009098 Ga0105245_10000424 Ga0105245_1000042416 404
156 3300009174 Ga0105241_10007436 Ga0105241_100074368 404
157 3300009177 Ga0105248_10000159 Ga0105248_1000015911 404
158 3300013100 Ga0157373_10001876 Ga0157373_1000187612 404
159 3300013100 Ga0157373_10030891 Ga0157373_100308913 404
160 3300013100 Ga0157373_10040500 Ga0157373_100405002 404
161 3300013102 Ga0157371_10003598 Ga0157371_100035982 404
162 3300013102 Ga0157371_10022145 Ga0157371_100221452 404
163 3300013104 Ga0157370_10016408 Ga0157370_100164085 404
164 3300013104 Ga0157370_10118298 Ga0157370_101182982 404
165 3300013105 Ga0157369_10097455 Ga0157369_100974552 404
166 3300013297 Ga0157378_10006264 Ga0157378_1000626411 404
167 3300013307 Ga0157372_10112759 Ga0157372_101127592 404
168 3300013307 Ga0157372_10170845 Ga0157372_101708452 404
169 3300013307 Ga0157372_10255833 Ga0157372_102558333 404
170 3300025315 Ga0207697_10002979 Ga0207697_100029796 404
171 3300025321 Ga0207656_10009413 Ga0207656_100094132 404
172 3300025901 Ga0207688_10000018 Ga0207688_1000001825 404
173 3300025903 Ga0207680_10082026 Ga0207680_100820262 404
174 3300025904 Ga0207647_10000333 Ga0207647_1000033313 404
175 3300025904 Ga0207647_10008050 Ga0207647_100080502 404
176 3300025907 Ga0207645_10004865 Ga0207645_100048656 404
177 3300025913 Ga0207695_10125616 Ga0207695_101256162 404
178 3300025919 Ga0207657_10010774 Ga0207657_100107742 404
179 3300025919 Ga0207657_10020433 Ga0207657_100204335 404
180 3300025919 Ga0207657_10027535 Ga0207657_100275354 404
181 3300025921 Ga0207652_10260811 Ga0207652_102608112 404
182 3300025923 Ga0207681_10001180 Ga0207681_1000118013 404
183 3300025925 Ga0207650_10005251 Ga0207650_100052515 404
184 3300025926 Ga0207659_10008440 Ga0207659_100084402 404
185 3300025929 Ga0207664_10041520 Ga0207664_100415202 404
186 3300025933 Ga0207706_10000171 Ga0207706_1000017115 404
187 3300025933 Ga0207706_10006168 Ga0207706_100061685 404
188 3300025933 Ga0207706_10026236 Ga0207706_100262364 404
189 3300025940 Ga0207691_10000070 Ga0207691_1000007027 404
190 3300025941 Ga0207711_10002610 Ga0207711_100026104 404
191 3300025942 Ga0207689_10000123 Ga0207689_100001239 404
192 3300025944 Ga0207661_10000261 Ga0207661_100002614 404
193 3300025944 Ga0207661_10104891 Ga0207661_101048912 404
194 3300025949 Ga0207667_10042732 Ga0207667_100427322 404
195 3300025960 Ga0207651_10000332 Ga0207651_100003324 404
196 3300025981 Ga0207640_10015732 Ga0207640_100157323 404
197 3300025981 Ga0207640_10023161 Ga0207640_100231612 404
198 3300025986 Ga0207658_10011578 Ga0207658_100115783 404
199 3300026023 Ga0207677_10000970 Ga0207677_100009707 404
200 3300026067 Ga0207678_10005348 Ga0207678_100053482 404
201 3300026067 Ga0207678_10069755 Ga0207678_100697552 404
202 3300026088 Ga0207641_10002327 Ga0207641_1000232713 404
203 3300026089 Ga0207648_10000317 Ga0207648_1000031742 404
204 3300026089 Ga0207648_10004979 Ga0207648_100049796 404
205 3300026095 Ga0207676_10001136 Ga0207676_100011368 404
206 3300026116 Ga0207674_10000937 Ga0207674_1000093725 404
207 3300026116 Ga0207674_10011582 Ga0207674_100115827 404
208 3300026116 Ga0207674_10015537 Ga0207674_100155376 404
209 3300026142 Ga0207698_10009884 Ga0207698_100098844 404
210 3300026142 Ga0207698_10059837 Ga0207698_100598372 404
211 3300026142 Ga0207698_10060671 Ga0207698_100606712 404
212 3300028379 Ga0268266_10093387 Ga0268266_100933872 404
213 3300028380 Ga0268265_10016782 Ga0268265_100167825 404
214 3300028381 Ga0268264_10002173 Ga0268264_1000217313 404
215 3300037418 Ga0395900_0035085 Ga0395900_0035085_1362_2729 404
216 3300037471 Ga0395905_0057235 Ga0395905_0057235_1940_3352 404
217 3300037471 Ga0395905_0086578 Ga0395905_0086578_1019_2359 404
218 3300038443 Ga0395901_0013672 Ga0395901_0013672_6458_7798 404
219 3300038443 Ga0395901_0066208 Ga0395901_0066208_1292_2620 404
220 3300038443 Ga0395901_0333353 Ga0395901_0333353_59_1426 404
221 3300005331 Ga0070670_100048538 Ga0070670_1000485386 405
222 3300005578 Ga0068854_100006885 Ga0068854_1000068856 405
223 3300005435 Ga0070714_100055062 Ga0070714_1000550621 406
224 3300021384 Ga0213876_10025982 Ga0213876_100259822 406
225 3300025912 Ga0207707_10059972 Ga0207707_100599722 406
226 3300025933 Ga0207706_10010098 Ga0207706_100100984 406
227 3300037471 Ga0395905_0026341 Ga0395905_0026341_1330_2682 406
228 3300046684 Ga0495669_0001387 Ga0495669_0001387_4199_5524 406
229 3300005366 Ga0070659_100067636 Ga0070659_1000676362 407
230 3300025933 Ga0207706_10062650 Ga0207706_100626501 408
231 3300050512 nmdc:mga0n895_362981_c1 nmdc:mga0n895_362981_c1_68_1426 408
232 3300005458 Ga0070681_10084474 Ga0070681_100844743 409
233 3300005530 Ga0070679_100040305 Ga0070679_1000403052 409
234 3300025921 Ga0207652_10031295 Ga0207652_100312952 409
235 3300005331 Ga0070670_100050460 Ga0070670_1000504601 410
236 3300005354 Ga0070675_100026739 Ga0070675_1000267392 410
237 3300005355 Ga0070671_100035885 Ga0070671_1000358853 410
238 3300005456 Ga0070678_100230022 Ga0070678_1002300221 410
239 3300013296 Ga0157374_10062928 Ga0157374_100629282 410
240 3300014325 Ga0163163_10083608 Ga0163163_100836082 410
241 3300005841 Ga0068863_100123953 Ga0068863_1001239532 411
242 3300026088 Ga0207641_10011371 Ga0207641_100113715 411
243 3300028380 Ga0268265_10058214 Ga0268265_100582142 411
244 3300037312 Ga0395899_0040772 Ga0395899_0040772_940_2289 411
245 3300005530 Ga0070679_100199456 Ga0070679_1001994562 412
246 3300005539 Ga0068853_100022901 Ga0068853_1000229012 412
247 3300025909 Ga0207705_10032613 Ga0207705_100326133 412
248 3300025919 Ga0207657_10059269 Ga0207657_100592694 412
249 3300025921 Ga0207652_10044920 Ga0207652_100449202 412
250 3300005327 Ga0070658_10001209 Ga0070658_100012093 415
251 3300005339 Ga0070660_100000094 Ga0070660_10000009428 415
252 3300005344 Ga0070661_100063862 Ga0070661_1000638621 415
253 3300005563 Ga0068855_100000247 Ga0068855_10000024757 415
254 3300005614 Ga0068856_100023464 Ga0068856_1000234647 415
255 3300005617 Ga0068859_100257318 Ga0068859_1002573182 415
256 3300005841 Ga0068863_100163389 Ga0068863_1001633892 415
257 3300006931 Ga0097620_100257321 Ga0097620_1002573212 415
258 3300009545 Ga0105237_10203413 Ga0105237_102034132 415
259 3300013102 Ga0157371_10002948 Ga0157371_1000294810 415
260 3300014968 Ga0157379_10075807 Ga0157379_100758072 415
261 3300025904 Ga0207647_10002012 Ga0207647_100020123 415
262 3300025909 Ga0207705_10000082 Ga0207705_1000008264 415
263 3300025919 Ga0207657_10000058 Ga0207657_1000005896 415
264 3300025949 Ga0207667_10000114 Ga0207667_1000011492 415
265 3300026035 Ga0207703_10054175 Ga0207703_100541752 415
266 3300026116 Ga0207674_10002465 Ga0207674_1000246510 415
267 3300032005 Ga0307411_10021239 Ga0307411_100212391 415
268 3300037471 Ga0395905_0054803 Ga0395905_0054803_2068_3384 415
269 3300048905 Ga0496102_0044004 Ga0496102_0044004_2334_3650 415
270 3300048908 Ga0496105_0075575 Ga0496105_0075575_542_1858 415
271 3300048910 Ga0496107_0090895 Ga0496107_0090895_12_1328 415
272 3300048911 Ga0496108_0050326 Ga0496108_0050326_1273_2589 415
273 3300048913 Ga0496110_0044758 Ga0496110_0044758_1535_2851 415
274 3300005328 Ga0070676_10068033 Ga0070676_100680333 416
275 3300005331 Ga0070670_100140470 Ga0070670_1001404701 416
276 3300005337 Ga0070682_100055467 Ga0070682_1000554672 416
277 3300005354 Ga0070675_100100506 Ga0070675_1001005062 416
278 3300005367 Ga0070667_100076463 Ga0070667_1000764632 416
279 3300005455 Ga0070663_100004036 Ga0070663_1000040364 416
280 3300005457 Ga0070662_100071681 Ga0070662_1000716812 416
281 3300005457 Ga0070662_100082626 Ga0070662_1000826263 416
282 3300005543 Ga0070672_100253227 Ga0070672_1002532271 416
283 3300005547 Ga0070693_100030688 Ga0070693_1000306882 416
284 3300005578 Ga0068854_100016221 Ga0068854_1000162213 416
285 3300005617 Ga0068859_100003001 Ga0068859_1000030012 416
286 3300005841 Ga0068863_100015853 Ga0068863_1000158533 416
287 3300005843 Ga0068860_100058164 Ga0068860_1000581641 416
288 3300006881 Ga0068865_100089235 Ga0068865_1000892351 416
289 3300006931 Ga0097620_100003001 Ga0097620_10000300113 416
290 3300009177 Ga0105248_10073740 Ga0105248_100737402 416
291 3300013100 Ga0157373_10089844 Ga0157373_100898442 416
292 3300013104 Ga0157370_10064890 Ga0157370_100648904 416
293 3300013105 Ga0157369_10002297 Ga0157369_1000229717 416
294 3300025907 Ga0207645_10075817 Ga0207645_100758173 416
295 3300025919 Ga0207657_10115887 Ga0207657_101158872 416
296 3300025920 Ga0207649_10035788 Ga0207649_100357882 416
297 3300025923 Ga0207681_10161575 Ga0207681_101615752 416
298 3300025926 Ga0207659_10073681 Ga0207659_100736812 416
299 3300025933 Ga0207706_10029452 Ga0207706_100294522 416
300 3300025933 Ga0207706_10094024 Ga0207706_100940242 416
301 3300025938 Ga0207704_10006236 Ga0207704_100062361 416
302 3300025940 Ga0207691_10058803 Ga0207691_100588032 416
303 3300025986 Ga0207658_10005135 Ga0207658_100051354 416
304 3300025986 Ga0207658_10082350 Ga0207658_100823502 416
305 3300026035 Ga0207703_10123081 Ga0207703_101230812 416
306 3300026067 Ga0207678_10060717 Ga0207678_100607172 416
307 3300026088 Ga0207641_10009748 Ga0207641_100097487 416
308 3300026095 Ga0207676_10003796 Ga0207676_100037966 416
309 3300026116 Ga0207674_10012673 Ga0207674_100126733 416
310 3300028380 Ga0268265_10294810 Ga0268265_102948101 416
311 3300046684 Ga0495669_0008320 Ga0495669_0008320_2030_3358 416
312 3300005327 Ga0070658_10000496 Ga0070658_1000049617 417
313 3300005339 Ga0070660_100000688 Ga0070660_10000068819 417
314 3300005366 Ga0070659_100224781 Ga0070659_1002247811 417
315 3300005455 Ga0070663_100051992 Ga0070663_1000519922 417
316 3300005544 Ga0070686_100000138 Ga0070686_10000013839 417
317 3300005548 Ga0070665_100003766 Ga0070665_1000037664 417
318 3300005563 Ga0068855_100045801 Ga0068855_1000458013 417
319 3300013102 Ga0157371_10010006 Ga0157371_100100066 417
320 3300013104 Ga0157370_10117692 Ga0157370_101176923 417
321 3300025904 Ga0207647_10057027 Ga0207647_100570272 417
322 3300025909 Ga0207705_10001215 Ga0207705_1000121517 417
323 3300025919 Ga0207657_10001215 Ga0207657_100012157 417
324 3300028379 Ga0268266_10005171 Ga0268266_100051712 417
325 3300037312 Ga0395899_0000112 Ga0395899_0000112_40038_41411 417
326 3300037418 Ga0395900_0000614 Ga0395900_0000614_40116_41489 417
327 3300037466 Ga0395898_0011853 Ga0395898_0011853_501_1874 417
328 3300037466 Ga0395898_0068467 Ga0395898_0068467_935_2335 417
329 3300037471 Ga0395905_0089587 Ga0395905_0089587_1376_2776 417
330 3300038443 Ga0395901_0000047 Ga0395901_0000047_42729_44102 417
331 3300044684 Ga0466966_0000111 Ga0466966_0000111_33603_34961 417
332 3300005329 Ga0070683_100039375 Ga0070683_1000393753 418
333 3300005344 Ga0070661_100016908 Ga0070661_1000169081 418
334 3300005345 Ga0070692_10032578 Ga0070692_100325781 418
335 3300005347 Ga0070668_100048602 Ga0070668_1000486024 418
336 3300005364 Ga0070673_100027925 Ga0070673_1000279252 418
337 3300005367 Ga0070667_100050677 Ga0070667_1000506771 418
338 3300005455 Ga0070663_100009430 Ga0070663_1000094302 418
339 3300005457 Ga0070662_100024299 Ga0070662_1000242992 418
340 3300005548 Ga0070665_100139428 Ga0070665_1001394282 418
341 3300005564 Ga0070664_100006897 Ga0070664_1000068975 418
342 3300005564 Ga0070664_100049625 Ga0070664_1000496252 418
343 3300005577 Ga0068857_100101527 Ga0068857_1001015274 418
344 3300005841 Ga0068863_100036953 Ga0068863_1000369532 418
345 3300005842 Ga0068858_100031805 Ga0068858_1000318051 418
346 3300005844 Ga0068862_100011826 Ga0068862_1000118266 418
347 3300006048 Ga0075363_100000119 Ga0075363_1000001199 418
348 3300006177 Ga0075362_10000012 Ga0075362_1000001213 418
349 3300006186 Ga0075369_10000157 Ga0075369_1000015713 418
350 3300006195 Ga0075366_10002064 Ga0075366_100020642 418
351 3300006353 Ga0075370_10000131 Ga0075370_1000013112 418
352 3300009177 Ga0105248_10379482 Ga0105248_103794821 418
353 3300013306 Ga0163162_10069474 Ga0163162_100694742 418
354 3300013307 Ga0157372_10303097 Ga0157372_103030972 418
355 3300013308 Ga0157375_10055864 Ga0157375_100558643 418
356 3300025903 Ga0207680_10013782 Ga0207680_100137822 418
357 3300025919 Ga0207657_10065040 Ga0207657_100650402 418
358 3300025920 Ga0207649_10097859 Ga0207649_100978592 418
359 3300025931 Ga0207644_10006606 Ga0207644_100066066 418
360 3300025933 Ga0207706_10046456 Ga0207706_100464563 418
361 3300025945 Ga0207679_10022650 Ga0207679_100226502 418
362 3300025945 Ga0207679_10067613 Ga0207679_100676132 418
363 3300026067 Ga0207678_10005441 Ga0207678_100054414 418
364 3300026116 Ga0207674_10182692 Ga0207674_101826923 418
365 3300026121 Ga0207683_10011043 Ga0207683_100110432 418
366 3300028380 Ga0268265_10007449 Ga0268265_100074496 418
367 3300035691 Ga0373931_0075119 Ga0373931_0075119_161_1501 418
368 3300037418 Ga0395900_0018937 Ga0395900_0018937_2780_4123 418
369 3300037418 Ga0395900_0058067 Ga0395900_0058067_2538_3884 418
370 3300037418 Ga0395900_0125663 Ga0395900_0125663_730_2076 418
371 3300037466 Ga0395898_0092756 Ga0395898_0092756_555_1901 418
372 3300037471 Ga0395905_0000523 Ga0395905_0000523_21048_22391 418
373 3300037471 Ga0395905_0068666 Ga0395905_0068666_1187_2533 418
374 3300038443 Ga0395901_0007608 Ga0395901_0007608_7502_8845 418
375 3300038443 Ga0395901_0094208 Ga0395901_0094208_788_2134 418
376 3300045976 Ga0466967_0078982 Ga0466967_0078982_333_1676 418
377 3300048911 Ga0496108_0058687 Ga0496108_0058687_34_1356 418
378 3300048913 Ga0496110_0042476 Ga0496110_0042476_1179_2501 418
379 3300050489 nmdc:mga03683_2_c1 nmdc:mga03683_2_c1_236752_238092 418
380 3300050490 nmdc:mga03n38_6056_c1 nmdc:mga03n38_6056_c1_434_1774 418
381 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_146439_147779 418
382 3300050493 nmdc:mga0k408_39889_c1 nmdc:mga0k408_39889_c1_1187_2527 418
383 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_37625_38965 418
384 3300050516 nmdc:mga0sz30_269_c3 nmdc:mga0sz30_269_c3_11555_12895 418
385 3300001979 JGI24740J21852_10000395 JGI24740J21852_1000039512 419
386 3300005329 Ga0070683_100219055 Ga0070683_1002190552 419
387 3300005336 Ga0070680_100007272 Ga0070680_1000072722 419
388 3300005339 Ga0070660_100043426 Ga0070660_1000434263 419
389 3300005344 Ga0070661_100017499 Ga0070661_1000174993 419
390 3300005344 Ga0070661_100071244 Ga0070661_1000712442 419
391 3300005345 Ga0070692_10069869 Ga0070692_100698692 419
392 3300005364 Ga0070673_100241697 Ga0070673_1002416971 419
393 3300005366 Ga0070659_100034490 Ga0070659_1000344903 419
394 3300005435 Ga0070714_100014383 Ga0070714_1000143831 419
395 3300005455 Ga0070663_100013855 Ga0070663_1000138553 419
396 3300005457 Ga0070662_100016029 Ga0070662_1000160294 419
397 3300005530 Ga0070679_100004417 Ga0070679_1000044179 419
398 3300005539 Ga0068853_100006908 Ga0068853_1000069085 419
399 3300005563 Ga0068855_100213822 Ga0068855_1002138222 419
400 3300005564 Ga0070664_100002457 Ga0070664_1000024578 419
401 3300005577 Ga0068857_100007919 Ga0068857_1000079197 419
402 3300005578 Ga0068854_100001151 Ga0068854_1000011516 419
403 3300005614 Ga0068856_100050651 Ga0068856_1000506512 419
404 3300005616 Ga0068852_100003663 Ga0068852_1000036633 419
405 3300005834 Ga0068851_10014321 Ga0068851_100143213 419
406 3300009093 Ga0105240_10032076 Ga0105240_100320764 419
407 3300009545 Ga0105237_10025856 Ga0105237_100258563 419
408 3300009551 Ga0105238_10017594 Ga0105238_100175944 419
409 3300013100 Ga0157373_10007128 Ga0157373_100071285 419
410 3300013102 Ga0157371_10063142 Ga0157371_100631422 419
411 3300013307 Ga0157372_10131475 Ga0157372_101314751 419
412 3300025321 Ga0207656_10023896 Ga0207656_100238962 419
413 3300025904 Ga0207647_10001648 Ga0207647_100016489 419
414 3300025909 Ga0207705_10002012 Ga0207705_100020128 419
415 3300025909 Ga0207705_10010246 Ga0207705_100102463 419
416 3300025919 Ga0207657_10008817 Ga0207657_100088173 419
417 3300025920 Ga0207649_10004550 Ga0207649_100045503 419
418 3300025921 Ga0207652_10000133 Ga0207652_100001336 419
419 3300025924 Ga0207694_10021310 Ga0207694_100213102 419
420 3300025929 Ga0207664_10041407 Ga0207664_100414072 419
421 3300025932 Ga0207690_10006226 Ga0207690_100062262 419
422 3300025944 Ga0207661_10022573 Ga0207661_100225732 419
423 3300025945 Ga0207679_10032176 Ga0207679_100321762 419
424 3300025981 Ga0207640_10005515 Ga0207640_100055154 419
425 3300026041 Ga0207639_10023476 Ga0207639_100234762 419
426 3300026078 Ga0207702_10033238 Ga0207702_100332383 419
427 3300026116 Ga0207674_10006989 Ga0207674_100069895 419
428 3300026142 Ga0207698_10021455 Ga0207698_100214553 419
429 3300037418 Ga0395900_0096198 Ga0395900_0096198_735_2093 419
430 3300037466 Ga0395898_0024186 Ga0395898_0024186_1955_3280 419
431 3300037466 Ga0395898_0204276 Ga0395898_0204276_234_1592 419
432 3300037471 Ga0395905_0036192 Ga0395905_0036192_2856_4181 419
433 3300037471 Ga0395905_0226345 Ga0395905_0226345_347_1705 419
434 3300046616 Ga0495668_0037088 Ga0495668_0037088_1188_2525 419
435 3300046684 Ga0495669_0014681 Ga0495669_0014681_450_1787 419
436 3300046684 Ga0495669_0031043 Ga0495669_0031043_671_2008 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13493

DUF4118

Domain of unknown function (DUF4118)

63

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqg-assembly1.cif.gz_A yycf effector domain structure without dna bound 0.9686 321 417
3zq7-assembly1.cif.gz_A the structure of dna-binding domain of response regulator from escherichia coli k-12 0.954 320 417
6cqg-assembly1.cif.gz_A yycf effector domain structure without dna bound 0.9495 321 417
2hwv-assembly1.cif.gz_A crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily. 0.9421 321 418
2d1v-assembly1.cif.gz_A crystal structure of dna-binding domain of bacillus subtilis yycf 0.9364 320 418
ID Description Score Start End Superfamily
af_P9WGN1_116_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9641 318 416 1.10.10.10
4kfcB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9594 320 417 1.10.10.10
4kfcB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9409 320 417 1.10.10.10
5za3A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9283 320 419 1.10.10.10
af_Q2FXN6_122_233_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9268 317 418 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1J5CQY8-F1-model_v4 OmpR/PhoB-type domain-containing protein 0.9935 343 417 GO:0000160
GO:0003677
GO:0006355
AF-A0A7W7IPS9-F1-model_v4 DNA-binding response OmpR family regulator 0.9912 343 418 GO:0000160
GO:0003677
GO:0006355
AF-X0V810-F1-model_v4 OmpR/PhoB-type domain-containing protein 0.9852 339 417 GO:0000160
GO:0003677
GO:0006355
AF-A0A317HAT0-F1-model_v4 DNA-binding response regulator 0.9798 329 417 GO:0000160
GO:0003677
GO:0006355
AF-A0A7W7IPS9-F1-model_v4 DNA-binding response OmpR family regulator 0.9784 343 418 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
85.17 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map