F443316

General Info

Members Datasets Scaffolds Average Seq Length
435 236 435 246

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10065153|Ga0105247_100651531
Length 299
Sequence LVFFATFAAVLRVLCGKAFDFLKRMKSLNRKDRKENNAKYAKKDSENFSEYQMKNLLLGMFLLTCTVVGSAATAKEVSYKSGNETVQAVLYMPQGKGPFPALVVIHEWWGLNDWVKEQASKLADEGYVTLAVDLYRGKVATTADEAQKIMRDVPDERADQDLHVAVAFLKSQPEVKKDRVGAIGWCMGGGYALDVAMQEPTLAADVINYGELQADPADLKKIKSPILGIFGGVDRSIPQSDVNKFAQQLKSMGKSVDVHIYPEAGHAFENPNNTQGYRKDDAADAWTRTVAFLAEHLKK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
232 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
233 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.37
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2140330 2162886012 Unclassified 979
2 MBSR1b_contig_3695524 2162886012 Bacteria 2492
3 MBSR1b_contig_8300978 2162886012 Bacteria 2492
4 MBSR1b_contig_9737039 2162886012 Bacteria 2588
5 JGI24743J22301_10002672 3300001991 Bacteria 2724
6 JGI24034J26672_10007382 3300002239 Bacteria 1595
7 JGI24751J29686_10001844 3300002459 Bacteria 4341
8 rootH2_10066329 3300003320 Unclassified 1280
9 Ga0065712_10096056 3300005290 Bacteria 2197
10 Ga0065712_10200072 3300005290 Bacteria 1112
11 Ga0065715_10006845 3300005293 Bacteria 4484
12 Ga0065715_10344969 3300005293 Unclassified 961
13 Ga0070658_10230514 3300005327 Bacteria 1568
14 Ga0070658_10501063 3300005327 Bacteria 1049
15 Ga0070676_10005477 3300005328 Bacteria 6760
16 Ga0070683_100003718 3300005329 Bacteria 12442
17 Ga0070690_100063665 3300005330 Bacteria 2381
18 Ga0070670_100015294 3300005331 Bacteria 6588
19 Ga0070677_10005797 3300005333 Bacteria 4087
20 Ga0068869_100000460 3300005334 Bacteria 22453
21 Ga0068869_100446635 3300005334 Bacteria 1071
22 Ga0070666_10055100 3300005335 Bacteria 2683
23 Ga0070680_100110814 3300005336 Bacteria 2285
24 Ga0070682_100022693 3300005337 Bacteria 3719
25 Ga0070682_100181312 3300005337 Bacteria 1471
26 Ga0068868_100001918 3300005338 Bacteria 14284
27 Ga0068868_100025537 3300005338 Bacteria 4496
28 Ga0068868_100032594 3300005338 Bacteria 4010
29 Ga0070660_100166159 3300005339 Unclassified 1780
30 Ga0070689_100029587 3300005340 Bacteria 4148
31 Ga0070689_100032859 3300005340 Bacteria 3950
32 Ga0070687_100015743 3300005343 Bacteria 3427
33 Ga0070661_100041944 3300005344 Bacteria 3339
34 Ga0070668_100121656 3300005347 Bacteria 2087
35 Ga0070669_100005666 3300005353 Bacteria 9012
36 Ga0070675_100024338 3300005354 Bacteria 4849
37 Ga0070675_100766699 3300005354 Bacteria 881
38 Ga0070674_100075570 3300005356 Bacteria 2393
39 Ga0070673_100054251 3300005364 Bacteria 3152
40 Ga0070688_100032378 3300005365 Bacteria 3151
41 Ga0070688_100036057 3300005365 Bacteria 3007
42 Ga0070659_100000422 3300005366 Bacteria 32130
43 Ga0070659_100048571 3300005366 Bacteria 3334
44 Ga0070659_100159648 3300005366 Bacteria 1843
45 Ga0070667_100084452 3300005367 Bacteria 2721
46 Ga0070667_100573390 3300005367 Unclassified 1038
47 Ga0070709_10119375 3300005434 Bacteria 1785
48 Ga0070714_100031351 3300005435 Bacteria 4434
49 Ga0070713_100031307 3300005436 Bacteria 4236
50 Ga0070713_100044297 3300005436 Bacteria 3642
51 Ga0070713_100101664 3300005436 Unclassified 2491
52 Ga0070713_100488169 3300005436 Bacteria 1161
53 Ga0070710_10022676 3300005437 Bacteria 3288
54 Ga0070710_10393382 3300005437 Unclassified 927
55 Ga0070711_100036903 3300005439 Unclassified 3277
56 Ga0070705_100182606 3300005440 Bacteria 1422
57 Ga0070700_100184544 3300005441 Bacteria 1454
58 Ga0070694_100136780 3300005444 Bacteria 1776
59 Ga0070708_100023064 3300005445 Bacteria 5287
60 Ga0070708_100033978 3300005445 Bacteria 4433
61 Ga0070662_100003945 3300005457 Bacteria 9304
62 Ga0070662_100065413 3300005457 Bacteria 2665
63 Ga0070681_10186703 3300005458 Bacteria 1993
64 Ga0068867_100014810 3300005459 Bacteria 5529
65 Ga0068867_100029942 3300005459 Bacteria 3925
66 Ga0068867_100192850 3300005459 Unclassified 1627
67 Ga0070685_10002203 3300005466 Bacteria 10054
68 Ga0070706_100000882 3300005467 Bacteria 32908
69 Ga0070707_100006930 3300005468 Bacteria 10503
70 Ga0070707_100089584 3300005468 Bacteria 2977
71 Ga0070698_100000377 3300005471 Bacteria 46568
72 Ga0070699_100054850 3300005518 Bacteria 3451
73 Ga0070679_100343224 3300005530 Bacteria 1441
74 Ga0070684_100000565 3300005535 Bacteria 25529
75 Ga0070684_100001101 3300005535 Bacteria 19371
76 Ga0070684_100859522 3300005535 Unclassified 849
77 Ga0070697_100001844 3300005536 Bacteria 16190
78 Ga0070697_100003123 3300005536 Bacteria 12729
79 Ga0070697_100077176 3300005536 Bacteria 2740
80 Ga0070697_100292019 3300005536 Bacteria 1400
81 Ga0070697_100471324 3300005536 Bacteria 1096
82 Ga0068853_100006017 3300005539 Bacteria 9595
83 Ga0068853_100062676 3300005539 Bacteria 3218
84 Ga0068853_100364947 3300005539 Unclassified 1346
85 Ga0070672_100072385 3300005543 Bacteria 2744
86 Ga0070672_100291674 3300005543 Unclassified 1381
87 Ga0070672_100598097 3300005543 Bacteria 960
88 Ga0070686_100001862 3300005544 Bacteria 11757
89 Ga0070686_100078272 3300005544 Bacteria 2183
90 Ga0070695_100177504 3300005545 Unclassified 1507
91 Ga0070696_100030274 3300005546 Bacteria 3705
92 Ga0070693_100041255 3300005547 Bacteria 2595
93 Ga0070693_100054742 3300005547 Unclassified 2296
94 Ga0070693_100084892 3300005547 Unclassified 1896
95 Ga0070693_100388164 3300005547 Bacteria 965
96 Ga0070665_100169467 3300005548 Bacteria 2185
97 Ga0070665_100219331 3300005548 Bacteria 1902
98 Ga0068855_100161524 3300005563 Unclassified 2542
99 Ga0068855_100281297 3300005563 Bacteria 1847
100 Ga0070664_100051468 3300005564 Bacteria 3487
101 Ga0070664_100076050 3300005564 Bacteria 2884
102 Ga0068857_100006877 3300005577 Bacteria 9792
103 Ga0068854_100004973 3300005578 Bacteria 8382
104 Ga0068854_100041827 3300005578 Bacteria 3240
105 Ga0068854_100243759 3300005578 Bacteria 1432
106 Ga0068856_100041408 3300005614 Bacteria 4527
107 Ga0068856_100066225 3300005614 Bacteria 3570
108 Ga0070702_100040260 3300005615 Bacteria 2613
109 Ga0068852_100141528 3300005616 Bacteria 2227
110 Ga0068859_100103475 3300005617 Bacteria 2905
111 Ga0068864_100254762 3300005618 Unclassified 1631
112 Ga0068866_10000408 3300005718 Bacteria 20005
113 Ga0068866_10020869 3300005718 Bacteria 3009
114 Ga0068861_100087009 3300005719 Bacteria 2458
115 Ga0068861_100217825 3300005719 Bacteria 1612
116 Ga0068861_100368723 3300005719 Unclassified 1265
117 Ga0068851_10002143 3300005834 Bacteria 8672
118 Ga0068851_10006816 3300005834 Bacteria 5228
119 Ga0068851_10325198 3300005834 Unclassified 889
120 Ga0068870_10009293 3300005840 Bacteria 4465
121 Ga0068863_100026013 3300005841 Bacteria 5584
122 Ga0068863_100047816 3300005841 Unclassified 4057
123 Ga0068863_100181033 3300005841 Unclassified 2023
124 Ga0068863_100323221 3300005841 Bacteria 1499
125 Ga0068858_100003081 3300005842 Bacteria 16683
126 Ga0068858_100032962 3300005842 Bacteria 4811
127 Ga0068858_100106951 3300005842 Bacteria 2611
128 Ga0068858_100118989 3300005842 Bacteria 2469
129 Ga0068858_100236750 3300005842 Bacteria 1731
130 Ga0068860_100019385 3300005843 Bacteria 6597
131 Ga0068860_100033093 3300005843 Bacteria 4963
132 Ga0068860_100095185 3300005843 Bacteria 2838
133 Ga0068862_100019526 3300005844 Bacteria 5658
134 Ga0068862_100069361 3300005844 Bacteria 3043
135 Ga0068862_100146293 3300005844 Bacteria 2100
136 Ga0070717_10001546 3300006028 Bacteria 15955
137 Ga0070717_10013350 3300006028 Bacteria 6291
138 Ga0070717_10116712 3300006028 Bacteria 2282
139 Ga0070715_10007282 3300006163 Bacteria 3805
140 Ga0070716_100001781 3300006173 Bacteria 9749
141 Ga0070716_100049917 3300006173 Unclassified 2373
142 Ga0070712_100004398 3300006175 Bacteria 8697
143 Ga0070712_100017967 3300006175 Bacteria 4585
144 Ga0097621_100007984 3300006237 Bacteria 7595
145 Ga0097621_100057871 3300006237 Bacteria 3171
146 Ga0068871_100002727 3300006358 Bacteria 12048
147 Ga0068871_100024207 3300006358 Bacteria 4705
148 Ga0068871_100103514 3300006358 Bacteria 2387
149 Ga0068871_100152051 3300006358 Bacteria 1974
150 Ga0075433_10023703 3300006852 Bacteria 5169
151 Ga0075434_100166786 3300006871 Bacteria 2222
152 Ga0068865_100009702 3300006881 Bacteria 5973
153 Ga0068865_100017233 3300006881 Bacteria 4642
154 Ga0068865_100069764 3300006881 Bacteria 2488
155 Ga0097620_100103485 3300006931 Bacteria 2905
156 Ga0075435_100046976 3300007076 Bacteria 3465
157 Ga0105250_10003576 3300009092 Bacteria 7321
158 Ga0105240_10021905 3300009093 Bacteria 8488
159 Ga0105240_10500512 3300009093 Bacteria 1351
160 Ga0105245_10002364 3300009098 Bacteria 17052
161 Ga0105245_10095679 3300009098 Bacteria 2740
162 Ga0105245_10101500 3300009098 Bacteria 2663
163 Ga0105245_10121369 3300009098 Unclassified 2442
164 Ga0105247_10002050 3300009101 Bacteria 13953
165 Ga0105247_10065153 3300009101 Unclassified 2266
166 Ga0105243_10015628 3300009148 Bacteria 5738
167 Ga0105243_10026224 3300009148 Bacteria 4460
168 Ga0105241_10008548 3300009174 Bacteria 7529
169 Ga0105241_10035492 3300009174 Bacteria 3750
170 Ga0105241_10105142 3300009174 Bacteria 2251
171 Ga0105242_10093287 3300009176 Bacteria 2538
172 Ga0105248_10054261 3300009177 Bacteria 4494
173 Ga0105248_10111829 3300009177 Unclassified 3080
174 Ga0105248_10155046 3300009177 Bacteria 2584
175 Ga0105248_10297718 3300009177 Unclassified 1817
176 Ga0105237_10021276 3300009545 Bacteria 6670
177 Ga0105237_10127193 3300009545 Bacteria 2542
178 Ga0105237_10137876 3300009545 Bacteria 2434
179 Ga0105237_10306812 3300009545 Unclassified 1590
180 Ga0105238_10001026 3300009551 Bacteria 28422
181 Ga0105238_10090752 3300009551 Bacteria 3043
182 Ga0105238_10137112 3300009551 Bacteria 2425
183 Ga0105249_10255224 3300009553 Bacteria 1740
184 Ga0105239_10020921 3300010375 Bacteria 7218
185 Ga0105239_10025453 3300010375 Bacteria 6516
186 Ga0105239_10101085 3300010375 Bacteria 3190
187 Ga0105239_10104989 3300010375 Bacteria 3128
188 Ga0105239_10244954 3300010375 Bacteria 2012
189 Ga0105246_10001057 3300011119 Bacteria 15887
190 Ga0105246_10014891 3300011119 Bacteria 4901
191 Ga0105246_10311818 3300011119 Bacteria 1275
192 Ga0157373_10029881 3300013100 Bacteria 3924
193 Ga0157373_10032373 3300013100 Bacteria 3764
194 Ga0157371_10036131 3300013102 Bacteria 3538
195 Ga0157371_10154921 3300013102 Bacteria 1635
196 Ga0157370_10015789 3300013104 Bacteria 7663
197 Ga0157369_10000353 3300013105 Bacteria 61209
198 Ga0157369_10031012 3300013105 Bacteria 5891
199 Ga0157369_10046620 3300013105 Bacteria 4710
200 Ga0157369_10134551 3300013105 Bacteria 2618
201 Ga0157374_10001924 3300013296 Bacteria 17416
202 Ga0157374_10004591 3300013296 Bacteria 11579
203 Ga0157374_10014703 3300013296 Bacteria 6852
204 Ga0157374_10065470 3300013296 Bacteria 3413
205 Ga0157374_10107586 3300013296 Bacteria 2680
206 Ga0157374_10294512 3300013296 Bacteria 1605
207 Ga0157374_10380106 3300013296 Unclassified 1407
208 Ga0157378_10001143 3300013297 Bacteria 24134
209 Ga0157378_10140426 3300013297 Bacteria 2243
210 Ga0157378_10376644 3300013297 Bacteria 1393
211 Ga0163162_10173208 3300013306 Bacteria 2283
212 Ga0163162_10268625 3300013306 Unclassified 1837
213 Ga0163162_10331297 3300013306 Unclassified 1655
214 Ga0157372_10052150 3300013307 Bacteria 4554
215 Ga0157372_10061479 3300013307 Bacteria 4206
216 Ga0157372_10062951 3300013307 Bacteria 4158
217 Ga0157372_10550408 3300013307 Unclassified 1345
218 Ga0157375_10075277 3300013308 Bacteria 3400
219 Ga0157375_10083620 3300013308 Bacteria 3237
220 Ga0163163_10002994 3300014325 Bacteria 14293
221 Ga0163163_10005018 3300014325 Bacteria 11407
222 Ga0163163_10105515 3300014325 Bacteria 2844
223 Ga0163163_10178013 3300014325 Bacteria 2174
224 Ga0163163_10348580 3300014325 Bacteria 1536
225 Ga0157380_10450813 3300014326 Unclassified 1235
226 Ga0182008_10030057 3300014497 Bacteria 2741
227 Ga0157377_10043511 3300014745 Bacteria 2499
228 Ga0157377_10500697 3300014745 Unclassified 849
229 Ga0157379_10021417 3300014968 Bacteria 5722
230 Ga0157379_10033648 3300014968 Unclassified 4571
231 Ga0157379_10059747 3300014968 Bacteria 3409
232 Ga0157379_10171381 3300014968 Bacteria 1959
233 Ga0157376_10002059 3300014969 Bacteria 13496
234 Ga0157376_10018937 3300014969 Bacteria 5293
235 Ga0157376_10060378 3300014969 Bacteria 3183
236 Ga0157376_10149821 3300014969 Bacteria 2103
237 Ga0182006_1029512 3300015261 Bacteria 2221
238 Ga0182007_10011638 3300015262 Bacteria 3419
239 Ga0163161_10001529 3300017792 Bacteria 17106
240 Ga0213873_10074025 3300021358 Unclassified 943
241 Ga0228598_1000200 3300024227 Bacteria 11021
242 Ga0207697_10010002 3300025315 Bacteria 4074
243 Ga0207656_10052176 3300025321 Unclassified 1770
244 Ga0207656_10233578 3300025321 Unclassified 897
245 Ga0207682_10189008 3300025893 Bacteria 943
246 Ga0207692_10023415 3300025898 Unclassified 2855
247 Ga0207692_10172179 3300025898 Unclassified 1255
248 Ga0207692_10336158 3300025898 Unclassified 928
249 Ga0207642_10026729 3300025899 Bacteria 2353
250 Ga0207642_10045337 3300025899 Bacteria 1951
251 Ga0207688_10174629 3300025901 Unclassified 1279
252 Ga0207680_10012833 3300025903 Bacteria 4280
253 Ga0207680_10042628 3300025903 Bacteria 2656
254 Ga0207647_10006271 3300025904 Bacteria 8658
255 Ga0207647_10010301 3300025904 Bacteria 6603
256 Ga0207685_10047380 3300025905 Bacteria 1640
257 Ga0207699_10075625 3300025906 Bacteria 2072
258 Ga0207645_10000881 3300025907 Bacteria 24915
259 Ga0207643_10002334 3300025908 Bacteria 10320
260 Ga0207705_10230017 3300025909 Bacteria 1410
261 Ga0207684_10056523 3300025910 Bacteria 3329
262 Ga0207684_10123448 3300025910 Unclassified 2221
263 Ga0207654_10009466 3300025911 Bacteria 4948
264 Ga0207654_10019168 3300025911 Bacteria 3605
265 Ga0207707_10136085 3300025912 Bacteria 2148
266 Ga0207695_10007875 3300025913 Bacteria 13451
267 Ga0207671_10035419 3300025914 Bacteria 3705
268 Ga0207671_10098883 3300025914 Unclassified 2207
269 Ga0207693_10009044 3300025915 Bacteria 8127
270 Ga0207693_10031618 3300025915 Bacteria 4182
271 Ga0207663_10031107 3300025916 Unclassified 3155
272 Ga0207663_10043515 3300025916 Bacteria 2750
273 Ga0207660_10044588 3300025917 Bacteria 3120
274 Ga0207662_10000950 3300025918 Bacteria 13459
275 Ga0207657_10001625 3300025919 Bacteria 24210
276 Ga0207657_10008171 3300025919 Bacteria 10661
277 Ga0207649_10001051 3300025920 Bacteria 16908
278 Ga0207649_10018209 3300025920 Bacteria 3990
279 Ga0207652_10107280 3300025921 Bacteria 2473
280 Ga0207652_10291668 3300025921 Unclassified 1472
281 Ga0207646_10000334 3300025922 Bacteria 63767
282 Ga0207681_10213297 3300025923 Bacteria 1489
283 Ga0207681_10341915 3300025923 Bacteria 1195
284 Ga0207694_10061970 3300025924 Bacteria 2911
285 Ga0207650_10000455 3300025925 Bacteria 34752
286 Ga0207659_10007080 3300025926 Bacteria 6886
287 Ga0207687_10023853 3300025927 Bacteria 4082
288 Ga0207687_10043902 3300025927 Bacteria 3082
289 Ga0207687_10318167 3300025927 Bacteria 1259
290 Ga0207687_10330693 3300025927 Unclassified 1236
291 Ga0207700_10059875 3300025928 Bacteria 2882
292 Ga0207700_10246395 3300025928 Bacteria 1525
293 Ga0207664_10008632 3300025929 Bacteria 7122
294 Ga0207644_10032799 3300025931 Bacteria 3626
295 Ga0207690_10047196 3300025932 Bacteria 2856
296 Ga0207706_10000331 3300025933 Bacteria 51309
297 Ga0207706_10006848 3300025933 Bacteria 10535
298 Ga0207686_10261073 3300025934 Unclassified 1270
299 Ga0207709_10453353 3300025935 Bacteria 992
300 Ga0207670_10028510 3300025936 Bacteria 3545
301 Ga0207669_10026640 3300025937 Bacteria 3149
302 Ga0207704_10057445 3300025938 Bacteria 2390
303 Ga0207665_10002022 3300025939 Bacteria 13646
304 Ga0207665_10354283 3300025939 Unclassified 1108
305 Ga0207691_10001595 3300025940 Bacteria 22532
306 Ga0207691_10339580 3300025940 Unclassified 1286
307 Ga0207711_10000693 3300025941 Bacteria 33226
308 Ga0207711_10201331 3300025941 Unclassified 1817
309 Ga0207711_10395778 3300025941 Bacteria 1283
310 Ga0207689_10001015 3300025942 Bacteria 26978
311 Ga0207689_10001672 3300025942 Bacteria 21060
312 Ga0207689_10035556 3300025942 Bacteria 4138
313 Ga0207689_10048097 3300025942 Bacteria 3519
314 Ga0207661_10000386 3300025944 Bacteria 28519
315 Ga0207679_10000148 3300025945 Bacteria 57781
316 Ga0207679_10170695 3300025945 Bacteria 1790
317 Ga0207667_10015609 3300025949 Bacteria 8615
318 Ga0207667_10129275 3300025949 Unclassified 2601
319 Ga0207667_10439510 3300025949 Unclassified 1326
320 Ga0207667_10623940 3300025949 Bacteria 1085
321 Ga0207667_10725144 3300025949 Unclassified 995
322 Ga0207640_10030931 3300025981 Bacteria 3302
323 Ga0207640_10456830 3300025981 Unclassified 1054
324 Ga0207658_10040688 3300025986 Bacteria 3361
325 Ga0207658_10156185 3300025986 Unclassified 1864
326 Ga0207677_10034825 3300026023 Bacteria 3264
327 Ga0207677_10046535 3300026023 Bacteria 2906
328 Ga0207677_10131179 3300026023 Bacteria 1903
329 Ga0207677_10164967 3300026023 Bacteria 1725
330 Ga0207677_10703771 3300026023 Unclassified 897
331 Ga0207703_10014240 3300026035 Bacteria 6204
332 Ga0207703_10024760 3300026035 Bacteria 4723
333 Ga0207703_10076759 3300026035 Bacteria 2772
334 Ga0207639_10109166 3300026041 Bacteria 2251
335 Ga0207639_10442513 3300026041 Unclassified 1178
336 Ga0207678_10003640 3300026067 Bacteria 13854
337 Ga0207678_10008772 3300026067 Bacteria 8894
338 Ga0207708_10139666 3300026075 Bacteria 1899
339 Ga0207702_10215422 3300026078 Unclassified 1787
340 Ga0207641_10000335 3300026088 Bacteria 57488
341 Ga0207641_10176444 3300026088 Bacteria 1954
342 Ga0207641_10231834 3300026088 Unclassified 1716
343 Ga0207648_10000351 3300026089 Bacteria 50640
344 Ga0207648_10028552 3300026089 Bacteria 4945
345 Ga0207648_10043396 3300026089 Bacteria 3947
346 Ga0207676_10000452 3300026095 Bacteria 34530
347 Ga0207674_10000617 3300026116 Bacteria 46697
348 Ga0207675_100008858 3300026118 Bacteria 9441
349 Ga0207675_100070676 3300026118 Bacteria 3263
350 Ga0207675_100135445 3300026118 Unclassified 2337
351 Ga0207683_10000735 3300026121 Bacteria 29814
352 Ga0207698_10198542 3300026142 Bacteria 1794
353 Ga0268266_10007550 3300028379 Bacteria 9793
354 Ga0268266_10079604 3300028379 Bacteria 2853
355 Ga0268265_10036983 3300028380 Bacteria 3579
356 Ga0268265_10079394 3300028380 Unclassified 2584
357 Ga0268265_10227938 3300028380 Bacteria 1635
358 Ga0268264_10032829 3300028381 Bacteria 4260
359 Ga0268264_10055939 3300028381 Unclassified 3297
360 Ga0268264_10060242 3300028381 Bacteria 3181
361 Ga0265338_10017868 3300028800 Bacteria 7620
362 Ga0265760_10000522 3300031090 Bacteria 10778
363 Ga0265325_10002425 3300031241 Bacteria 12578
364 Ga0265325_10011506 3300031241 Bacteria 5082
365 Ga0265340_10005877 3300031247 Bacteria 6787
366 Ga0265340_10056056 3300031247 Unclassified 1896
367 Ga0265339_10005653 3300031249 Bacteria 8300
368 Ga0265339_10029826 3300031249 Unclassified 3092
369 Ga0265331_10007068 3300031250 Bacteria 6546
370 Ga0265327_10022611 3300031251 Bacteria 3751
371 Ga0265313_10181402 3300031595 Bacteria 884
372 Ga0265314_10056000 3300031711 Bacteria 2717
373 Ga0265314_10095341 3300031711 Unclassified 1926
374 Ga0307405_10103556 3300031731 Bacteria 1914
375 Ga0307410_10005165 3300031852 Bacteria 6873
376 Ga0307410_10310846 3300031852 Bacteria 1247
377 Ga0307409_100003357 3300031995 Bacteria 8675
378 Ga0307416_100187296 3300032002 Unclassified 1947
379 Ga0307416_100234747 3300032002 Bacteria 1771
380 Ga0307414_10439041 3300032004 Unclassified 1142
381 Ga0307415_100035058 3300032126 Unclassified 3274
382 Ga0307415_100230962 3300032126 Bacteria 1490
383 Ga0373932_0024247 3300035112 Unclassified 1631
384 Ga0373956_0056147 3300035119 Unclassified 1777
385 Ga0373943_0076436 3300035170 Unclassified 1708
386 Ga0373955_0098277 3300035172 Unclassified 1677
387 Ga0373933_0013314 3300035724 Bacteria 4558
388 Ga0373933_0168030 3300035724 Bacteria 1395
389 Ga0373947_0537628 3300035725 Unclassified 795
390 Ga0373937_0056430 3300036401 Bacteria 3607
391 Ga0373925_0427937 3300037068 Bacteria 1082
392 Ga0436364_0695650 3300037853 Bacteria 2066
393 Ga0436360_0547326 3300039438 Unclassified 1104
394 Ga0436360_0551727 3300039438 Unclassified 967
395 Ga0436363_1462658 3300039450 Bacteria 3054
396 Ga0436362_0362963 3300039453 Bacteria 7783
397 Ga0466963_0075864 3300044694 Unclassified 2270
398 Ga0495629_0213371 3300046459 Unclassified 1333
399 Ga0495580_0001227 3300046472 Bacteria 22632
400 Ga0495580_0001728 3300046472 Bacteria 19205
401 Ga0495580_0156855 3300046472 Unclassified 1576
402 Ga0495580_0169242 3300046472 Bacteria 1511
403 Ga0495580_0410551 3300046472 Unclassified 912
404 Ga0495584_0100089 3300046491 Bacteria 1465
405 Ga0495645_0019808 3300046543 Bacteria 4847
406 Ga0495645_0125543 3300046543 Unclassified 1803
407 Ga0495659_0022901 3300046664 Unclassified 2118
408 Ga0495669_0009634 3300046684 Unclassified 4075
409 Ga0495669_0153491 3300046684 Unclassified 1091
410 Ga0495675_0242515 3300047444 Unclassified 1084
411 Ga0496100_0081137 3300048903 Bacteria 2191
412 Ga0496101_0227302 3300048904 Bacteria 1450
413 Ga0496102_0033278 3300048905 Bacteria 4631
414 Ga0496102_0058482 3300048905 Bacteria 3523
415 Ga0496102_0155250 3300048905 Bacteria 2151
416 Ga0496104_0095641 3300048907 Bacteria 2842
417 Ga0496106_0081848 3300048909 Bacteria 2481
418 Ga0496106_0557251 3300048909 Bacteria 919
419 Ga0496108_0000092 3300048911 Bacteria 95002
420 Ga0496109_0000473 3300048912 Bacteria 34192
421 Ga0496109_0171357 3300048912 Bacteria 2036
422 Ga0496110_0077098 3300048913 Bacteria 2965
423 Ga0496111_0004371 3300048914 Bacteria 8922
424 Ga0496112_0000072 3300048915 Bacteria 66241
425 Ga0496112_0002771 3300048915 Bacteria 14211
426 Ga0496112_0067334 3300048915 Bacteria 3534
427 Ga0496112_0088725 3300048915 Unclassified 3060
428 Ga0496113_0000056 3300048916 Bacteria 48500
429 Ga0496113_0113659 3300048916 Bacteria 2110
430 Ga0501296_013945 3300049519 Bacteria 982
431 Ga0501243_043120 3300049675 Bacteria 797
432 Ga0501266_023714 3300049763 Bacteria 848
433 nmdc:mga05p37_145836_c1 3300050507 Bacteria 2899
434 nmdc:mga0n895_8152_c1 3300050512 Bacteria 9052
435 nmdc:mga0rr50_4496_c1 3300050513 Bacteria 8214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100057871 Ga0097621_1000578712 194
2 3300006358 Ga0068871_100103514 Ga0068871_1001035143 194
3 3300005434 Ga0070709_10119375 Ga0070709_101193752 203
4 3300005436 Ga0070713_100044297 Ga0070713_1000442972 203
5 3300005439 Ga0070711_100036903 Ga0070711_1000369034 203
6 3300006028 Ga0070717_10013350 Ga0070717_100133504 203
7 3300006173 Ga0070716_100049917 Ga0070716_1000499174 203
8 3300025898 Ga0207692_10172179 Ga0207692_101721792 203
9 3300025906 Ga0207699_10075625 Ga0207699_100756253 203
10 3300025916 Ga0207663_10031107 Ga0207663_100311073 203
11 3300025928 Ga0207700_10059875 Ga0207700_100598754 203
12 3300025939 Ga0207665_10354283 Ga0207665_103542832 203
13 3300035170 Ga0373943_0076436 Ga0373943_0076436_952_1692 204
14 3300035725 Ga0373947_0537628 Ga0373947_0537628_19_759 204
15 3300009551 Ga0105238_10001026 Ga0105238_1000102619 223
16 3300013102 Ga0157371_10036131 Ga0157371_100361313 223
17 3300013105 Ga0157369_10000353 Ga0157369_1000035337 223
18 3300013296 Ga0157374_10001924 Ga0157374_1000192411 223
19 3300005842 Ga0068858_100106951 Ga0068858_1001069513 227
20 3300026035 Ga0207703_10076759 Ga0207703_100767593 227
21 3300005535 Ga0070684_100859522 Ga0070684_1008595221 237
22 3300005563 Ga0068855_100161524 Ga0068855_1001615243 237
23 3300013105 Ga0157369_10031012 Ga0157369_100310123 237
24 3300025949 Ga0207667_10129275 Ga0207667_101292753 237
25 3300005437 Ga0070710_10393382 Ga0070710_103933821 239
26 3300025898 Ga0207692_10336158 Ga0207692_103361581 239
27 3300003320 rootH2_10066329 rootH2_100663292 240
28 3300005293 Ga0065715_10344969 Ga0065715_103449691 240
29 3300006852 Ga0075433_10023703 Ga0075433_100237034 240
30 3300050507 nmdc:mga05p37_145836_c1 nmdc:mga05p37_145836_c1_1560_2348 240
31 3300005548 Ga0070665_100169467 Ga0070665_1001694674 241
32 3300035724 Ga0373933_0168030 Ga0373933_0168030_108_851 241
33 3300005290 Ga0065712_10096056 Ga0065712_100960562 242
34 3300005327 Ga0070658_10501063 Ga0070658_105010632 242
35 3300005330 Ga0070690_100063665 Ga0070690_1000636651 242
36 3300005335 Ga0070666_10055100 Ga0070666_100551002 242
37 3300005336 Ga0070680_100110814 Ga0070680_1001108143 242
38 3300005337 Ga0070682_100022693 Ga0070682_1000226931 242
39 3300005338 Ga0068868_100001918 Ga0068868_10000191811 242
40 3300005340 Ga0070689_100029587 Ga0070689_1000295874 242
41 3300005344 Ga0070661_100041944 Ga0070661_1000419444 242
42 3300005347 Ga0070668_100121656 Ga0070668_1001216562 242
43 3300005353 Ga0070669_100005666 Ga0070669_1000056668 242
44 3300005354 Ga0070675_100766699 Ga0070675_1007666991 242
45 3300005365 Ga0070688_100036057 Ga0070688_1000360571 242
46 3300005366 Ga0070659_100048571 Ga0070659_1000485713 242
47 3300005367 Ga0070667_100084452 Ga0070667_1000844523 242
48 3300005437 Ga0070710_10022676 Ga0070710_100226762 242
49 3300005444 Ga0070694_100136780 Ga0070694_1001367802 242
50 3300005445 Ga0070708_100023064 Ga0070708_1000230645 242
51 3300005445 Ga0070708_100033978 Ga0070708_1000339781 242
52 3300005457 Ga0070662_100003945 Ga0070662_1000039459 242
53 3300005458 Ga0070681_10186703 Ga0070681_101867033 242
54 3300005459 Ga0068867_100029942 Ga0068867_1000299424 242
55 3300005467 Ga0070706_100000882 Ga0070706_10000088230 242
56 3300005468 Ga0070707_100006930 Ga0070707_1000069306 242
57 3300005471 Ga0070698_100000377 Ga0070698_10000037744 242
58 3300005518 Ga0070699_100054850 Ga0070699_1000548503 242
59 3300005530 Ga0070679_100343224 Ga0070679_1003432242 242
60 3300005535 Ga0070684_100000565 Ga0070684_1000005659 242
61 3300005536 Ga0070697_100001844 Ga0070697_1000018448 242
62 3300005536 Ga0070697_100003123 Ga0070697_1000031236 242
63 3300005536 Ga0070697_100292019 Ga0070697_1002920192 242
64 3300005536 Ga0070697_100471324 Ga0070697_1004713241 242
65 3300005539 Ga0068853_100062676 Ga0068853_1000626763 242
66 3300005543 Ga0070672_100291674 Ga0070672_1002916741 242
67 3300005544 Ga0070686_100078272 Ga0070686_1000782721 242
68 3300005545 Ga0070695_100177504 Ga0070695_1001775042 242
69 3300005546 Ga0070696_100030274 Ga0070696_1000302742 242
70 3300005547 Ga0070693_100041255 Ga0070693_1000412551 242
71 3300005547 Ga0070693_100084892 Ga0070693_1000848923 242
72 3300005548 Ga0070665_100219331 Ga0070665_1002193312 242
73 3300005563 Ga0068855_100281297 Ga0068855_1002812972 242
74 3300005564 Ga0070664_100051468 Ga0070664_1000514684 242
75 3300005578 Ga0068854_100004973 Ga0068854_1000049739 242
76 3300005578 Ga0068854_100243759 Ga0068854_1002437592 242
77 3300005614 Ga0068856_100041408 Ga0068856_1000414081 242
78 3300005616 Ga0068852_100141528 Ga0068852_1001415282 242
79 3300005617 Ga0068859_100103475 Ga0068859_1001034752 242
80 3300005718 Ga0068866_10020869 Ga0068866_100208691 242
81 3300005719 Ga0068861_100087009 Ga0068861_1000870091 242
82 3300005834 Ga0068851_10002143 Ga0068851_100021437 242
83 3300005842 Ga0068858_100032962 Ga0068858_1000329622 242
84 3300005842 Ga0068858_100118989 Ga0068858_1001189894 242
85 3300005843 Ga0068860_100095185 Ga0068860_1000951852 242
86 3300005844 Ga0068862_100019526 Ga0068862_1000195263 242
87 3300006028 Ga0070717_10116712 Ga0070717_101167122 242
88 3300006237 Ga0097621_100007984 Ga0097621_1000079847 242
89 3300006358 Ga0068871_100002727 Ga0068871_1000027275 242
90 3300006358 Ga0068871_100024207 Ga0068871_1000242073 242
91 3300006871 Ga0075434_100166786 Ga0075434_1001667864 242
92 3300006881 Ga0068865_100069764 Ga0068865_1000697644 242
93 3300006931 Ga0097620_100103485 Ga0097620_1001034852 242
94 3300007076 Ga0075435_100046976 Ga0075435_1000469764 242
95 3300009093 Ga0105240_10021905 Ga0105240_100219054 242
96 3300009098 Ga0105245_10002364 Ga0105245_100023644 242
97 3300009098 Ga0105245_10095679 Ga0105245_100956793 242
98 3300009148 Ga0105243_10015628 Ga0105243_100156283 242
99 3300009174 Ga0105241_10105142 Ga0105241_101051423 242
100 3300009176 Ga0105242_10093287 Ga0105242_100932871 242
101 3300009177 Ga0105248_10054261 Ga0105248_100542613 242
102 3300009177 Ga0105248_10297718 Ga0105248_102977182 242
103 3300009545 Ga0105237_10127193 Ga0105237_101271933 242
104 3300009545 Ga0105237_10306812 Ga0105237_103068121 242
105 3300009551 Ga0105238_10137112 Ga0105238_101371121 242
106 3300010375 Ga0105239_10104989 Ga0105239_101049893 242
107 3300010375 Ga0105239_10244954 Ga0105239_102449543 242
108 3300011119 Ga0105246_10014891 Ga0105246_100148916 242
109 3300013100 Ga0157373_10029881 Ga0157373_100298814 242
110 3300013104 Ga0157370_10015789 Ga0157370_100157895 242
111 3300013105 Ga0157369_10134551 Ga0157369_101345513 242
112 3300013296 Ga0157374_10004591 Ga0157374_100045913 242
113 3300013296 Ga0157374_10380106 Ga0157374_103801062 242
114 3300013297 Ga0157378_10001143 Ga0157378_1000114313 242
115 3300013297 Ga0157378_10140426 Ga0157378_101404263 242
116 3300013306 Ga0163162_10268625 Ga0163162_102686252 242
117 3300013306 Ga0163162_10331297 Ga0163162_103312973 242
118 3300013307 Ga0157372_10061479 Ga0157372_100614792 242
119 3300013307 Ga0157372_10062951 Ga0157372_100629513 242
120 3300013308 Ga0157375_10083620 Ga0157375_100836201 242
121 3300014325 Ga0163163_10105515 Ga0163163_101055153 242
122 3300014745 Ga0157377_10500697 Ga0157377_105006971 242
123 3300014968 Ga0157379_10171381 Ga0157379_101713812 242
124 3300014969 Ga0157376_10018937 Ga0157376_100189375 242
125 3300014969 Ga0157376_10060378 Ga0157376_100603783 242
126 3300025321 Ga0207656_10052176 Ga0207656_100521762 242
127 3300025899 Ga0207642_10045337 Ga0207642_100453372 242
128 3300025903 Ga0207680_10042628 Ga0207680_100426282 242
129 3300025910 Ga0207684_10123448 Ga0207684_101234482 242
130 3300025911 Ga0207654_10009466 Ga0207654_100094664 242
131 3300025912 Ga0207707_10136085 Ga0207707_101360851 242
132 3300025913 Ga0207695_10007875 Ga0207695_1000787511 242
133 3300025914 Ga0207671_10035419 Ga0207671_100354193 242
134 3300025917 Ga0207660_10044588 Ga0207660_100445884 242
135 3300025919 Ga0207657_10008171 Ga0207657_1000817111 242
136 3300025920 Ga0207649_10018209 Ga0207649_100182094 242
137 3300025921 Ga0207652_10107280 Ga0207652_101072803 242
138 3300025921 Ga0207652_10291668 Ga0207652_102916682 242
139 3300025922 Ga0207646_10000334 Ga0207646_1000033453 242
140 3300025923 Ga0207681_10213297 Ga0207681_102132971 242
141 3300025924 Ga0207694_10061970 Ga0207694_100619702 242
142 3300025927 Ga0207687_10023853 Ga0207687_100238535 242
143 3300025927 Ga0207687_10043902 Ga0207687_100439022 242
144 3300025928 Ga0207700_10246395 Ga0207700_102463952 242
145 3300025932 Ga0207690_10047196 Ga0207690_100471962 242
146 3300025933 Ga0207706_10000331 Ga0207706_1000033117 242
147 3300025934 Ga0207686_10261073 Ga0207686_102610732 242
148 3300025935 Ga0207709_10453353 Ga0207709_104533531 242
149 3300025940 Ga0207691_10339580 Ga0207691_103395802 242
150 3300025941 Ga0207711_10000693 Ga0207711_1000069312 242
151 3300025941 Ga0207711_10201331 Ga0207711_102013312 242
152 3300025942 Ga0207689_10035556 Ga0207689_100355563 242
153 3300025945 Ga0207679_10170695 Ga0207679_101706952 242
154 3300025949 Ga0207667_10015609 Ga0207667_100156097 242
155 3300025949 Ga0207667_10439510 Ga0207667_104395102 242
156 3300025981 Ga0207640_10456830 Ga0207640_104568301 242
157 3300025986 Ga0207658_10156185 Ga0207658_101561853 242
158 3300026023 Ga0207677_10034825 Ga0207677_100348253 242
159 3300026023 Ga0207677_10703771 Ga0207677_107037711 242
160 3300026041 Ga0207639_10109166 Ga0207639_101091662 242
161 3300026067 Ga0207678_10003640 Ga0207678_100036409 242
162 3300026078 Ga0207702_10215422 Ga0207702_102154221 242
163 3300026089 Ga0207648_10028552 Ga0207648_100285525 242
164 3300026118 Ga0207675_100070676 Ga0207675_1000706763 242
165 3300026142 Ga0207698_10198542 Ga0207698_101985423 242
166 3300028379 Ga0268266_10079604 Ga0268266_100796042 242
167 3300028380 Ga0268265_10036983 Ga0268265_100369831 242
168 3300028800 Ga0265338_10017868 Ga0265338_100178685 242
169 3300031090 Ga0265760_10000522 Ga0265760_100005229 242
170 3300031241 Ga0265325_10011506 Ga0265325_100115066 242
171 3300031247 Ga0265340_10005877 Ga0265340_100058774 242
172 3300031249 Ga0265339_10005653 Ga0265339_100056537 242
173 3300031249 Ga0265339_10029826 Ga0265339_100298263 242
174 3300031711 Ga0265314_10095341 Ga0265314_100953412 242
175 3300031731 Ga0307405_10103556 Ga0307405_101035562 242
176 3300031852 Ga0307410_10005165 Ga0307410_100051652 242
177 3300031852 Ga0307410_10310846 Ga0307410_103108462 242
178 3300031995 Ga0307409_100003357 Ga0307409_1000033577 242
179 3300032002 Ga0307416_100187296 Ga0307416_1001872962 242
180 3300032002 Ga0307416_100234747 Ga0307416_1002347472 242
181 3300032004 Ga0307414_10439041 Ga0307414_104390412 242
182 3300032126 Ga0307415_100035058 Ga0307415_1000350582 242
183 3300032126 Ga0307415_100230962 Ga0307415_1002309622 242
184 3300035112 Ga0373932_0024247 Ga0373932_0024247_543_1283 242
185 3300035119 Ga0373956_0056147 Ga0373956_0056147_301_1131 242
186 3300035172 Ga0373955_0098277 Ga0373955_0098277_903_1658 242
187 3300035724 Ga0373933_0013314 Ga0373933_0013314_3474_4304 242
188 3300036401 Ga0373937_0056430 Ga0373937_0056430_2151_2981 242
189 3300037853 Ga0436364_0695650 Ga0436364_0695650_379_1119 242
190 3300039438 Ga0436360_0547326 Ga0436360_0547326_219_959 242
191 3300039438 Ga0436360_0551727 Ga0436360_0551727_13_753 242
192 3300039450 Ga0436363_1462658 Ga0436363_1462658_166_906 242
193 3300044694 Ga0466963_0075864 Ga0466963_0075864_1202_1942 242
194 3300046459 Ga0495629_0213371 Ga0495629_0213371_102_842 242
195 3300046684 Ga0495669_0153491 Ga0495669_0153491_153_893 242
196 3300048904 Ga0496101_0227302 Ga0496101_0227302_177_917 242
197 3300048905 Ga0496102_0033278 Ga0496102_0033278_1644_2390 242
198 3300048905 Ga0496102_0155250 Ga0496102_0155250_227_967 242
199 3300048909 Ga0496106_0557251 Ga0496106_0557251_27_767 242
200 3300048915 Ga0496112_0067334 Ga0496112_0067334_1676_2416 242
201 3300048916 Ga0496113_0113659 Ga0496113_0113659_811_1551 242
202 3300049519 Ga0501296_013945 Ga0501296_013945_39_779 242
203 3300049675 Ga0501243_043120 Ga0501243_043120_13_753 242
204 3300049763 Ga0501266_023714 Ga0501266_023714_17_757 242
205 3300050512 nmdc:mga0n895_8152_c1 nmdc:mga0n895_8152_c1_1171_1911 242
206 3300050513 nmdc:mga0rr50_4496_c1 nmdc:mga0rr50_4496_c1_5592_6332 242
207 2162886012 MBSR1b_contig_2140330 MBSR1b_0687.00007070 243
208 2162886012 MBSR1b_contig_3695524 MBSR1b_0572.00006180 243
209 2162886012 MBSR1b_contig_8300978 MBSR1b_0183.00008400 243
210 2162886012 MBSR1b_contig_9737039 MBSR1b_0170.00004630 243
211 3300001991 JGI24743J22301_10002672 JGI24743J22301_100026724 243
212 3300002239 JGI24034J26672_10007382 JGI24034J26672_100073822 243
213 3300002459 JGI24751J29686_10001844 JGI24751J29686_100018445 243
214 3300005290 Ga0065712_10200072 Ga0065712_102000722 243
215 3300005293 Ga0065715_10006845 Ga0065715_100068451 243
216 3300005327 Ga0070658_10230514 Ga0070658_102305142 243
217 3300005328 Ga0070676_10005477 Ga0070676_100054775 243
218 3300005329 Ga0070683_100003718 Ga0070683_1000037186 243
219 3300005331 Ga0070670_100015294 Ga0070670_1000152945 243
220 3300005333 Ga0070677_10005797 Ga0070677_100057972 243
221 3300005334 Ga0068869_100000460 Ga0068869_1000004607 243
222 3300005334 Ga0068869_100446635 Ga0068869_1004466352 243
223 3300005337 Ga0070682_100181312 Ga0070682_1001813122 243
224 3300005338 Ga0068868_100025537 Ga0068868_1000255373 243
225 3300005338 Ga0068868_100032594 Ga0068868_1000325942 243
226 3300005339 Ga0070660_100166159 Ga0070660_1001661591 243
227 3300005340 Ga0070689_100032859 Ga0070689_1000328595 243
228 3300005343 Ga0070687_100015743 Ga0070687_1000157435 243
229 3300005354 Ga0070675_100024338 Ga0070675_1000243385 243
230 3300005356 Ga0070674_100075570 Ga0070674_1000755703 243
231 3300005364 Ga0070673_100054251 Ga0070673_1000542512 243
232 3300005365 Ga0070688_100032378 Ga0070688_1000323782 243
233 3300005366 Ga0070659_100000422 Ga0070659_10000042216 243
234 3300005366 Ga0070659_100159648 Ga0070659_1001596482 243
235 3300005367 Ga0070667_100573390 Ga0070667_1005733902 243
236 3300005435 Ga0070714_100031351 Ga0070714_1000313515 243
237 3300005436 Ga0070713_100031307 Ga0070713_1000313074 243
238 3300005436 Ga0070713_100101664 Ga0070713_1001016641 243
239 3300005436 Ga0070713_100488169 Ga0070713_1004881691 243
240 3300005440 Ga0070705_100182606 Ga0070705_1001826062 243
241 3300005441 Ga0070700_100184544 Ga0070700_1001845442 243
242 3300005457 Ga0070662_100065413 Ga0070662_1000654132 243
243 3300005459 Ga0068867_100014810 Ga0068867_1000148102 243
244 3300005459 Ga0068867_100192850 Ga0068867_1001928502 243
245 3300005466 Ga0070685_10002203 Ga0070685_100022039 243
246 3300005468 Ga0070707_100089584 Ga0070707_1000895842 243
247 3300005535 Ga0070684_100001101 Ga0070684_1000011019 243
248 3300005536 Ga0070697_100077176 Ga0070697_1000771761 243
249 3300005539 Ga0068853_100006017 Ga0068853_1000060174 243
250 3300005539 Ga0068853_100364947 Ga0068853_1003649472 243
251 3300005543 Ga0070672_100072385 Ga0070672_1000723854 243
252 3300005543 Ga0070672_100598097 Ga0070672_1005980971 243
253 3300005544 Ga0070686_100001862 Ga0070686_1000018628 243
254 3300005547 Ga0070693_100054742 Ga0070693_1000547423 243
255 3300005547 Ga0070693_100388164 Ga0070693_1003881641 243
256 3300005564 Ga0070664_100076050 Ga0070664_1000760504 243
257 3300005577 Ga0068857_100006877 Ga0068857_1000068772 243
258 3300005578 Ga0068854_100041827 Ga0068854_1000418274 243
259 3300005614 Ga0068856_100066225 Ga0068856_1000662253 243
260 3300005615 Ga0070702_100040260 Ga0070702_1000402604 243
261 3300005618 Ga0068864_100254762 Ga0068864_1002547621 243
262 3300005718 Ga0068866_10000408 Ga0068866_100004088 243
263 3300005719 Ga0068861_100217825 Ga0068861_1002178252 243
264 3300005719 Ga0068861_100368723 Ga0068861_1003687232 243
265 3300005834 Ga0068851_10006816 Ga0068851_100068164 243
266 3300005834 Ga0068851_10325198 Ga0068851_103251982 243
267 3300005840 Ga0068870_10009293 Ga0068870_100092935 243
268 3300005841 Ga0068863_100026013 Ga0068863_1000260136 243
269 3300005841 Ga0068863_100047816 Ga0068863_1000478163 243
270 3300005841 Ga0068863_100181033 Ga0068863_1001810333 243
271 3300005841 Ga0068863_100323221 Ga0068863_1003232211 243
272 3300005842 Ga0068858_100003081 Ga0068858_1000030815 243
273 3300005842 Ga0068858_100236750 Ga0068858_1002367502 243
274 3300005843 Ga0068860_100019385 Ga0068860_1000193858 243
275 3300005843 Ga0068860_100033093 Ga0068860_1000330935 243
276 3300005844 Ga0068862_100069361 Ga0068862_1000693613 243
277 3300005844 Ga0068862_100146293 Ga0068862_1001462933 243
278 3300006028 Ga0070717_10001546 Ga0070717_100015468 243
279 3300006163 Ga0070715_10007282 Ga0070715_100072826 243
280 3300006173 Ga0070716_100001781 Ga0070716_1000017815 243
281 3300006175 Ga0070712_100004398 Ga0070712_10000439812 243
282 3300006175 Ga0070712_100017967 Ga0070712_1000179677 243
283 3300006358 Ga0068871_100152051 Ga0068871_1001520512 243
284 3300006881 Ga0068865_100009702 Ga0068865_1000097025 243
285 3300006881 Ga0068865_100017233 Ga0068865_1000172333 243
286 3300009092 Ga0105250_10003576 Ga0105250_100035766 243
287 3300009093 Ga0105240_10500512 Ga0105240_105005122 243
288 3300009098 Ga0105245_10101500 Ga0105245_101015004 243
289 3300009098 Ga0105245_10121369 Ga0105245_101213692 243
290 3300009101 Ga0105247_10002050 Ga0105247_100020507 243
291 3300009101 Ga0105247_10065153 Ga0105247_100651531 243
292 3300009148 Ga0105243_10026224 Ga0105243_100262245 243
293 3300009174 Ga0105241_10008548 Ga0105241_100085487 243
294 3300009174 Ga0105241_10035492 Ga0105241_100354923 243
295 3300009177 Ga0105248_10111829 Ga0105248_101118293 243
296 3300009177 Ga0105248_10155046 Ga0105248_101550463 243
297 3300009545 Ga0105237_10021276 Ga0105237_100212761 243
298 3300009545 Ga0105237_10137876 Ga0105237_101378762 243
299 3300009551 Ga0105238_10090752 Ga0105238_100907524 243
300 3300009553 Ga0105249_10255224 Ga0105249_102552242 243
301 3300010375 Ga0105239_10020921 Ga0105239_100209216 243
302 3300010375 Ga0105239_10025453 Ga0105239_100254538 243
303 3300010375 Ga0105239_10101085 Ga0105239_101010854 243
304 3300011119 Ga0105246_10001057 Ga0105246_100010579 243
305 3300011119 Ga0105246_10311818 Ga0105246_103118182 243
306 3300013100 Ga0157373_10032373 Ga0157373_100323732 243
307 3300013102 Ga0157371_10154921 Ga0157371_101549211 243
308 3300013105 Ga0157369_10046620 Ga0157369_100466204 243
309 3300013296 Ga0157374_10014703 Ga0157374_100147035 243
310 3300013296 Ga0157374_10065470 Ga0157374_100654702 243
311 3300013296 Ga0157374_10107586 Ga0157374_101075863 243
312 3300013296 Ga0157374_10294512 Ga0157374_102945122 243
313 3300013297 Ga0157378_10376644 Ga0157378_103766442 243
314 3300013306 Ga0163162_10173208 Ga0163162_101732083 243
315 3300013307 Ga0157372_10052150 Ga0157372_100521505 243
316 3300013307 Ga0157372_10550408 Ga0157372_105504082 243
317 3300013308 Ga0157375_10075277 Ga0157375_100752772 243
318 3300014325 Ga0163163_10002994 Ga0163163_100029942 243
319 3300014325 Ga0163163_10005018 Ga0163163_100050188 243
320 3300014325 Ga0163163_10178013 Ga0163163_101780134 243
321 3300014325 Ga0163163_10348580 Ga0163163_103485802 243
322 3300014326 Ga0157380_10450813 Ga0157380_104508131 243
323 3300014497 Ga0182008_10030057 Ga0182008_100300574 243
324 3300014745 Ga0157377_10043511 Ga0157377_100435113 243
325 3300014968 Ga0157379_10021417 Ga0157379_100214173 243
326 3300014968 Ga0157379_10033648 Ga0157379_100336482 243
327 3300014968 Ga0157379_10059747 Ga0157379_100597473 243
328 3300014969 Ga0157376_10002059 Ga0157376_100020594 243
329 3300014969 Ga0157376_10149821 Ga0157376_101498213 243
330 3300015261 Ga0182006_1029512 Ga0182006_10295121 243
331 3300015262 Ga0182007_10011638 Ga0182007_100116382 243
332 3300017792 Ga0163161_10001529 Ga0163161_1000152917 243
333 3300021358 Ga0213873_10074025 Ga0213873_100740251 243
334 3300024227 Ga0228598_1000200 Ga0228598_100020012 243
335 3300025315 Ga0207697_10010002 Ga0207697_100100025 243
336 3300025321 Ga0207656_10233578 Ga0207656_102335782 243
337 3300025893 Ga0207682_10189008 Ga0207682_101890081 243
338 3300025898 Ga0207692_10023415 Ga0207692_100234154 243
339 3300025899 Ga0207642_10026729 Ga0207642_100267293 243
340 3300025901 Ga0207688_10174629 Ga0207688_101746292 243
341 3300025903 Ga0207680_10012833 Ga0207680_100128335 243
342 3300025904 Ga0207647_10006271 Ga0207647_100062714 243
343 3300025904 Ga0207647_10010301 Ga0207647_100103015 243
344 3300025905 Ga0207685_10047380 Ga0207685_100473802 243
345 3300025907 Ga0207645_10000881 Ga0207645_1000088112 243
346 3300025908 Ga0207643_10002334 Ga0207643_100023347 243
347 3300025909 Ga0207705_10230017 Ga0207705_102300172 243
348 3300025910 Ga0207684_10056523 Ga0207684_100565235 243
349 3300025911 Ga0207654_10019168 Ga0207654_100191685 243
350 3300025914 Ga0207671_10098883 Ga0207671_100988834 243
351 3300025915 Ga0207693_10009044 Ga0207693_1000904411 243
352 3300025915 Ga0207693_10031618 Ga0207693_100316183 243
353 3300025916 Ga0207663_10043515 Ga0207663_100435154 243
354 3300025918 Ga0207662_10000950 Ga0207662_100009503 243
355 3300025919 Ga0207657_10001625 Ga0207657_100016257 243
356 3300025920 Ga0207649_10001051 Ga0207649_100010513 243
357 3300025923 Ga0207681_10341915 Ga0207681_103419151 243
358 3300025925 Ga0207650_10000455 Ga0207650_1000045514 243
359 3300025926 Ga0207659_10007080 Ga0207659_100070805 243
360 3300025927 Ga0207687_10318167 Ga0207687_103181672 243
361 3300025927 Ga0207687_10330693 Ga0207687_103306931 243
362 3300025929 Ga0207664_10008632 Ga0207664_100086325 243
363 3300025931 Ga0207644_10032799 Ga0207644_100327994 243
364 3300025933 Ga0207706_10006848 Ga0207706_100068484 243
365 3300025936 Ga0207670_10028510 Ga0207670_100285103 243
366 3300025937 Ga0207669_10026640 Ga0207669_100266403 243
367 3300025938 Ga0207704_10057445 Ga0207704_100574453 243
368 3300025939 Ga0207665_10002022 Ga0207665_1000202210 243
369 3300025940 Ga0207691_10001595 Ga0207691_100015958 243
370 3300025941 Ga0207711_10395778 Ga0207711_103957782 243
371 3300025942 Ga0207689_10001015 Ga0207689_100010153 243
372 3300025942 Ga0207689_10001672 Ga0207689_100016729 243
373 3300025942 Ga0207689_10048097 Ga0207689_100480975 243
374 3300025944 Ga0207661_10000386 Ga0207661_1000038617 243
375 3300025945 Ga0207679_10000148 Ga0207679_1000014823 243
376 3300025949 Ga0207667_10623940 Ga0207667_106239401 243
377 3300025949 Ga0207667_10725144 Ga0207667_107251442 243
378 3300025981 Ga0207640_10030931 Ga0207640_100309314 243
379 3300025986 Ga0207658_10040688 Ga0207658_100406885 243
380 3300026023 Ga0207677_10046535 Ga0207677_100465354 243
381 3300026023 Ga0207677_10131179 Ga0207677_101311792 243
382 3300026023 Ga0207677_10164967 Ga0207677_101649671 243
383 3300026035 Ga0207703_10014240 Ga0207703_100142406 243
384 3300026035 Ga0207703_10024760 Ga0207703_100247602 243
385 3300026041 Ga0207639_10442513 Ga0207639_104425132 243
386 3300026067 Ga0207678_10008772 Ga0207678_100087729 243
387 3300026075 Ga0207708_10139666 Ga0207708_101396662 243
388 3300026088 Ga0207641_10000335 Ga0207641_1000033534 243
389 3300026088 Ga0207641_10176444 Ga0207641_101764442 243
390 3300026088 Ga0207641_10231834 Ga0207641_102318342 243
391 3300026089 Ga0207648_10000351 Ga0207648_1000035131 243
392 3300026089 Ga0207648_10043396 Ga0207648_100433962 243
393 3300026095 Ga0207676_10000452 Ga0207676_1000045226 243
394 3300026116 Ga0207674_10000617 Ga0207674_1000061727 243
395 3300026118 Ga0207675_100008858 Ga0207675_10000885811 243
396 3300026118 Ga0207675_100135445 Ga0207675_1001354454 243
397 3300026121 Ga0207683_10000735 Ga0207683_1000073518 243
398 3300028379 Ga0268266_10007550 Ga0268266_1000755010 243
399 3300028380 Ga0268265_10079394 Ga0268265_100793943 243
400 3300028380 Ga0268265_10227938 Ga0268265_102279382 243
401 3300028381 Ga0268264_10032829 Ga0268264_100328294 243
402 3300028381 Ga0268264_10055939 Ga0268264_100559392 243
403 3300028381 Ga0268264_10060242 Ga0268264_100602422 243
404 3300031241 Ga0265325_10002425 Ga0265325_1000242512 243
405 3300031247 Ga0265340_10056056 Ga0265340_100560561 243
406 3300031250 Ga0265331_10007068 Ga0265331_100070685 243
407 3300031251 Ga0265327_10022611 Ga0265327_100226113 243
408 3300031595 Ga0265313_10181402 Ga0265313_101814021 243
409 3300031711 Ga0265314_10056000 Ga0265314_100560003 243
410 3300037068 Ga0373925_0427937 Ga0373925_0427937_49_807 243
411 3300039453 Ga0436362_0362963 Ga0436362_0362963_6975_7718 243
412 3300046472 Ga0495580_0001227 Ga0495580_0001227_16042_16800 243
413 3300046472 Ga0495580_0001728 Ga0495580_0001728_13662_14420 243
414 3300046472 Ga0495580_0156855 Ga0495580_0156855_516_1262 243
415 3300046472 Ga0495580_0169242 Ga0495580_0169242_133_876 243
416 3300046472 Ga0495580_0410551 Ga0495580_0410551_101_859 243
417 3300046491 Ga0495584_0100089 Ga0495584_0100089_176_934 243
418 3300046543 Ga0495645_0019808 Ga0495645_0019808_3976_4761 243
419 3300046543 Ga0495645_0125543 Ga0495645_0125543_441_1196 243
420 3300046664 Ga0495659_0022901 Ga0495659_0022901_1204_1962 243
421 3300046684 Ga0495669_0009634 Ga0495669_0009634_493_1236 243
422 3300047444 Ga0495675_0242515 Ga0495675_0242515_153_908 243
423 3300048903 Ga0496100_0081137 Ga0496100_0081137_852_1595 243
424 3300048905 Ga0496102_0058482 Ga0496102_0058482_1131_1874 243
425 3300048907 Ga0496104_0095641 Ga0496104_0095641_1172_1915 243
426 3300048909 Ga0496106_0081848 Ga0496106_0081848_1701_2444 243
427 3300048911 Ga0496108_0000092 Ga0496108_0000092_21537_22280 243
428 3300048912 Ga0496109_0000473 Ga0496109_0000473_12602_13345 243
429 3300048912 Ga0496109_0171357 Ga0496109_0171357_84_827 243
430 3300048913 Ga0496110_0077098 Ga0496110_0077098_873_1616 243
431 3300048914 Ga0496111_0004371 Ga0496111_0004371_7675_8418 243
432 3300048915 Ga0496112_0000072 Ga0496112_0000072_64075_64818 243
433 3300048915 Ga0496112_0002771 Ga0496112_0002771_11870_12601 243
434 3300048915 Ga0496112_0088725 Ga0496112_0088725_739_1482 243
435 3300048916 Ga0496113_0000056 Ga0496113_0000056_38050_38793 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

86

297

0.97

PF00326

Peptidase_S9

Prolyl oligopeptidase family

201

299

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9276 15 241
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9273 15 240
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9218 15 241
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.919 15 241
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9078 17 238
ID Description Score Start End Superfamily
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9292 17 241 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9273 15 240 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9252 15 241 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9153 19 235 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9036 17 240 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9IXF9-F1-model_v4 Dienelactone hydrolase family protein 0.9927 48 241 GO:0016787
AF-A0A5E4HUK0-F1-model_v4 Dienelactone hydrolase family protein 0.9812 17 241 GO:0016020
GO:0016787
AF-A0A2H5WNG7-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9794 17 241 GO:0008806
AF-A0A1Q7RPM4-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9788 153 241 GO:0016787
AF-A0A2V9IXF9-F1-model_v4 Dienelactone hydrolase family protein 0.9777 48 241 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map