metagRoot

F443305

General Info

Members	Datasets	Scaffolds	Average Seq Length
435	205	435	361

Family's Representative Sequence

Representative Sequence	3300007076\|Ga0075435_100000142\|Ga0075435_10000014230
Length	396
Sequence	MHDLIVIGGGPAGTAAAITAARAGGRVLLLERGRFPRHKVCGEFVSAESLGILRELLSSSPANAPHCAPCHPDAGRSRAEGSMYFGGSHASSRVGNSDSLLANSLRIPRARVFLDDQVLETPVDPPAASIARIDLDAALWNAAESASVDARQQIAAQNISGSGPFLVSTSPGEFESRAVINASGRWSNLNSGAPGEKSKTKWLGLKAHFAEPSPELSVDLYFFQNGYCGVQPVGPGRVNACAMVRSDVASSLSEVFALHPALYQRSAAWKPLIDPVSTSPLIFRDPQPAQDGVLLVGDAAGFVDPFIGDGISLALRSGTLAAQCLEPFLLRNATFSETVSRYREAYVSSLLPIFRASSTIRRALRFPRTIRRPLLRLLRRTPAMTRYLVNRTRQAN

Samples

	Sample ID	Description	Type	Environment
1	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
2	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
3	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
24	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
28	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
29	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
35	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
36	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
37	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
38	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
39	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
40	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
41	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
42	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
43	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
44	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
45	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
46	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
47	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
51	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
67	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
68	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
71	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
72	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
73	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
74	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
75	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
77	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
84	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
85	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
86	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
87	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
88	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
91	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
92	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
93	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
94	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
95	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
102	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
105	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
106	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
107	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
155	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
156	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
157	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
158	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
159	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
160	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
161	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
162	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
163	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
164	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
165	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
166	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
167	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
170	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
171	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
172	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
177	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
178	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
179	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
180	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
181	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
182	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
183	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
184	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
185	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
186	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
187	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
188	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
189	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
190	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
191	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
192	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
193	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
194	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
195	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
196	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
197	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
198	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
199	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
200	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
201	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
202	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
203	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
204	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
205	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	7.36
Rhizosphere	91.72
Stem	0
Stem Tuber	0
Unclassified	0.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24751J29686_10000795	3300002459	Bacteria	7390
2	Ga0065712_10003616	3300005290	Bacteria	4288
3	Ga0065715_10000935	3300005293	Bacteria	9888
4	Ga0065707_10124643	3300005295	Unclassified	2040
5	Ga0070658_10015209	3300005327	Bacteria	6156
6	Ga0070676_10002082	3300005328	Bacteria	10181
7	Ga0070683_100002442	3300005329	Bacteria	14785
8	Ga0070683_100005653	3300005329	Bacteria	10443
9	Ga0070683_100082811	3300005329	Unclassified	3005
10	Ga0070683_100387515	3300005329	Bacteria	1332
11	Ga0070690_100004402	3300005330	Bacteria	7814
12	Ga0070690_100043237	3300005330	Bacteria	2856
13	Ga0070670_100015218	3300005331	Bacteria	6602
14	Ga0068869_100008080	3300005334	Bacteria	6764
15	Ga0070666_10074013	3300005335	Bacteria	2321
16	Ga0070666_10105799	3300005335	Unclassified	1943
17	Ga0070680_100006626	3300005336	Bacteria	8808
18	Ga0070680_100079227	3300005336	Unclassified	2707
19	Ga0068868_100004143	3300005338	Bacteria	10132
20	Ga0068868_100016922	3300005338	Bacteria	5424
21	Ga0068868_100020658	3300005338	Unclassified	4953
22	Ga0068868_100054988	3300005338	Bacteria	3139
23	Ga0068868_100104634	3300005338	Bacteria	2294
24	Ga0070660_100001360	3300005339	Bacteria	16615
25	Ga0070689_100003898	3300005340	Bacteria	9999
26	Ga0070689_100040080	3300005340	Unclassified	3589
27	Ga0070687_100013787	3300005343	Bacteria	3613
28	Ga0070661_100007120	3300005344	Bacteria	7716
29	Ga0070661_100113330	3300005344	Unclassified	2026
30	Ga0070669_100013597	3300005353	Bacteria	5785
31	Ga0070675_100004266	3300005354	Bacteria	10888
32	Ga0070671_100042661	3300005355	Bacteria	3770
33	Ga0070673_100021297	3300005364	Unclassified	4697
34	Ga0070688_100000903	3300005365	Bacteria	14812
35	Ga0070659_100007344	3300005366	Bacteria	8007
36	Ga0070709_10072592	3300005434	Bacteria	2225
37	Ga0070714_100074262	3300005435	Unclassified	2947
38	Ga0070714_100095429	3300005435	Bacteria	2612
39	Ga0070714_100412522	3300005435	Bacteria	1278
40	Ga0070713_100017082	3300005436	Bacteria	5476
41	Ga0070713_100042784	3300005436	Bacteria	3699
42	Ga0070713_100078251	3300005436	Bacteria	2814
43	Ga0070713_100132057	3300005436	Bacteria	2203
44	Ga0070710_10043083	3300005437	Unclassified	2498
45	Ga0070711_100005193	3300005439	Bacteria	7764
46	Ga0070711_100015088	3300005439	Bacteria	4883
47	Ga0070711_100016426	3300005439	Bacteria	4702
48	Ga0070711_100024599	3300005439	Bacteria	3930
49	Ga0070711_100075940	3300005439	Unclassified	2381
50	Ga0070705_100052063	3300005440	Unclassified	2390
51	Ga0070708_100003088	3300005445	Bacteria	12952
52	Ga0070708_100004252	3300005445	Bacteria	11249
53	Ga0070708_100005132	3300005445	Bacteria	10368
54	Ga0070708_100008883	3300005445	Bacteria	8089
55	Ga0070708_100013639	3300005445	Bacteria	6661
56	Ga0070708_100033647	3300005445	Unclassified	4454
57	Ga0070663_100001055	3300005455	Bacteria	15087
58	Ga0070663_100006374	3300005455	Bacteria	7091
59	Ga0070681_10003328	3300005458	Bacteria	15026
60	Ga0070681_10038346	3300005458	Bacteria	4804
61	Ga0070681_10120934	3300005458	Bacteria	2553
62	Ga0070681_10168770	3300005458	Unclassified	2111
63	Ga0068867_100005145	3300005459	Bacteria	9243
64	Ga0068867_100024180	3300005459	Unclassified	4353
65	Ga0070685_10002197	3300005466	Bacteria	10074
66	Ga0070706_100000706	3300005467	Bacteria	37581
67	Ga0070706_100002421	3300005467	Bacteria	18800
68	Ga0070706_100042582	3300005467	Unclassified	4196
69	Ga0070707_100039635	3300005468	Unclassified	4503
70	Ga0070707_100105892	3300005468	Unclassified	2727
71	Ga0070707_100407758	3300005468	Unclassified	1319
72	Ga0070698_100000638	3300005471	Bacteria	37638
73	Ga0070699_100031042	3300005518	Unclassified	4614
74	Ga0070679_100002191	3300005530	Bacteria	17642
75	Ga0070679_100370472	3300005530	Unclassified	1379
76	Ga0070684_100002238	3300005535	Bacteria	14235
77	Ga0070684_100203774	3300005535	Unclassified	1802
78	Ga0070697_100000122	3300005536	Bacteria	61581
79	Ga0070697_100000190	3300005536	Bacteria	50723
80	Ga0070697_100001593	3300005536	Bacteria	17302
81	Ga0070697_100037221	3300005536	Bacteria	3930
82	Ga0070697_100100852	3300005536	Unclassified	2398
83	Ga0068853_100015426	3300005539	Bacteria	6277
84	Ga0068853_100021411	3300005539	Bacteria	5391
85	Ga0068853_100071099	3300005539	Bacteria	3029
86	Ga0068853_100265583	3300005539	Bacteria	1579
87	Ga0070672_100001540	3300005543	Bacteria	14279
88	Ga0070686_100012111	3300005544	Bacteria	4908
89	Ga0070686_100017276	3300005544	Unclassified	4213
90	Ga0070695_100010995	3300005545	Bacteria	5410
91	Ga0070695_100061923	3300005545	Unclassified	2429
92	Ga0070696_100017473	3300005546	Bacteria	4841
93	Ga0070696_100033558	3300005546	Bacteria	3527
94	Ga0070693_100020664	3300005547	Unclassified	3477
95	Ga0070693_100024095	3300005547	Bacteria	3259
96	Ga0070665_100021665	3300005548	Bacteria	6463
97	Ga0068855_100012428	3300005563	Bacteria	10283
98	Ga0068855_100094037	3300005563	Unclassified	3456
99	Ga0068855_100120606	3300005563	Bacteria	3001
100	Ga0068855_100124402	3300005563	Unclassified	2950
101	Ga0068855_100167097	3300005563	Bacteria	2493
102	Ga0070664_100002532	3300005564	Bacteria	14743
103	Ga0070664_100006027	3300005564	Bacteria	9803
104	Ga0068857_100000471	3300005577	Bacteria	28734
105	Ga0068857_100001109	3300005577	Bacteria	20921
106	Ga0068857_100082117	3300005577	Bacteria	2879
107	Ga0068857_100145367	3300005577	Bacteria	2145
108	Ga0068854_100004795	3300005578	Bacteria	8532
109	Ga0068854_100009407	3300005578	Bacteria	6311
110	Ga0068854_100017053	3300005578	Bacteria	4854
111	Ga0068854_100062801	3300005578	Unclassified	2695
112	Ga0068856_100004473	3300005614	Bacteria	13908
113	Ga0068856_100021683	3300005614	Bacteria	6242
114	Ga0068856_100121444	3300005614	Bacteria	2614
115	Ga0068856_100198182	3300005614	Unclassified	2022
116	Ga0068852_100013744	3300005616	Bacteria	6205
117	Ga0068852_100086947	3300005616	Bacteria	2788
118	Ga0068859_100002581	3300005617	Bacteria	18427
119	Ga0068864_100004299	3300005618	Bacteria	11712
120	Ga0068861_100130135	3300005719	Unclassified	2042
121	Ga0068861_100179701	3300005719	Unclassified	1760
122	Ga0068851_10001878	3300005834	Bacteria	9234
123	Ga0068851_10033423	3300005834	Bacteria	2563
124	Ga0068870_10001080	3300005840	Bacteria	10824
125	Ga0068863_100039512	3300005841	Bacteria	4488
126	Ga0068858_100011937	3300005842	Bacteria	8186
127	Ga0068858_100015724	3300005842	Bacteria	7117
128	Ga0068858_100018877	3300005842	Bacteria	6452
129	Ga0068858_100078058	3300005842	Unclassified	3076
130	Ga0068858_100227401	3300005842	Bacteria	1768
131	Ga0068860_100019415	3300005843	Bacteria	6592
132	Ga0068862_100008606	3300005844	Bacteria	8444
133	Ga0081455_10021337	3300005937	Bacteria	6077
134	Ga0070717_10001335	3300006028	Bacteria	16946
135	Ga0070717_10051785	3300006028	Unclassified	3380
136	Ga0070717_10076375	3300006028	Bacteria	2804
137	Ga0070717_10136474	3300006028	Unclassified	2113
138	Ga0070717_10247237	3300006028	Unclassified	1574
139	Ga0070717_10270872	3300006028	Bacteria	1504
140	Ga0070715_10013081	3300006163	Bacteria	3039
141	Ga0070716_100000080	3300006173	Bacteria	37843
142	Ga0070716_100008007	3300006173	Bacteria	5233
143	Ga0070716_100158965	3300006173	Bacteria	1462
144	Ga0070712_100002243	3300006175	Bacteria	11889
145	Ga0070712_100009698	3300006175	Bacteria	6068
146	Ga0070712_100010904	3300006175	Bacteria	5747
147	Ga0097621_100009020	3300006237	Bacteria	7222
148	Ga0097621_100010364	3300006237	Bacteria	6815
149	Ga0068871_100002182	3300006358	Bacteria	13297
150	Ga0068871_100025356	3300006358	Unclassified	4612
151	Ga0075433_10082116	3300006852	Bacteria	2842
152	Ga0075434_100001995	3300006871	Bacteria	17710
153	Ga0075434_100126761	3300006871	Bacteria	2569
154	Ga0075434_100135266	3300006871	Bacteria	2484
155	Ga0068865_100014491	3300006881	Bacteria	5010
156	Ga0068865_100075808	3300006881	Unclassified	2399
157	Ga0075436_100000180	3300006914	Bacteria	39663
158	Ga0075436_100148602	3300006914	Bacteria	1648
159	Ga0097620_100002580	3300006931	Bacteria	18427
160	Ga0075435_100000142	3300007076	Bacteria	40637
161	Ga0075435_100014264	3300007076	Bacteria	5934
162	Ga0105240_10015526	3300009093	Bacteria	10351
163	Ga0105240_10068300	3300009093	Bacteria	4402
164	Ga0105240_10120242	3300009093	Bacteria	3163
165	Ga0105240_10419641	3300009093	Unclassified	1503
166	Ga0105240_10472702	3300009093	Bacteria	1399
167	Ga0105240_10698985	3300009093	Bacteria	1107
168	Ga0105245_10000539	3300009098	Bacteria	34684
169	Ga0105245_10004368	3300009098	Bacteria	12507
170	Ga0105245_10018365	3300009098	Bacteria	6115
171	Ga0105245_10058198	3300009098	Unclassified	3478
172	Ga0105245_10163811	3300009098	Bacteria	2112
173	Ga0114129_10076021	3300009147	Bacteria	4676
174	Ga0105241_10006114	3300009174	Bacteria	8873
175	Ga0105241_10010868	3300009174	Bacteria	6677
176	Ga0105241_10021209	3300009174	Unclassified	4801
177	Ga0105242_10017573	3300009176	Bacteria	5577
178	Ga0105242_10035100	3300009176	Bacteria	4021
179	Ga0105242_10077488	3300009176	Bacteria	2773
180	Ga0105248_10033775	3300009177	Bacteria	5716
181	Ga0105248_10294608	3300009177	Unclassified	1827
182	Ga0105237_10011540	3300009545	Bacteria	9345
183	Ga0105237_10025132	3300009545	Bacteria	6093
184	Ga0105237_10054139	3300009545	Unclassified	4020
185	Ga0105237_10065785	3300009545	Unclassified	3620
186	Ga0105237_10087554	3300009545	Unclassified	3104
187	Ga0105238_10006016	3300009551	Bacteria	12027
188	Ga0105238_10024518	3300009551	Bacteria	6148
189	Ga0105238_10215521	3300009551	Bacteria	1896
190	Ga0105249_10150560	3300009553	Unclassified	2240
191	Ga0105249_10151488	3300009553	Bacteria	2233
192	Ga0105239_10008471	3300010375	Bacteria	11690
193	Ga0105239_10080233	3300010375	Bacteria	3590
194	Ga0105239_10400117	3300010375	Unclassified	1554
195	Ga0105246_10014798	3300011119	Unclassified	4913
196	Ga0157373_10000778	3300013100	Bacteria	24598
197	Ga0157373_10001214	3300013100	Bacteria	19702
198	Ga0157373_10003605	3300013100	Bacteria	11693
199	Ga0157373_10105823	3300013100	Unclassified	1978
200	Ga0157373_10204831	3300013100	Unclassified	1391
201	Ga0157371_10008878	3300013102	Bacteria	7961
202	Ga0157371_10049046	3300013102	Unclassified	3000
203	Ga0157370_10030810	3300013104	Bacteria	5254
204	Ga0157369_10012944	3300013105	Bacteria	9452
205	Ga0157369_10023472	3300013105	Bacteria	6870
206	Ga0157369_10053086	3300013105	Bacteria	4382
207	Ga0157369_10061391	3300013105	Unclassified	4052
208	Ga0157369_10155996	3300013105	Unclassified	2411
209	Ga0157369_10165700	3300013105	Bacteria	2331
210	Ga0157374_10001614	3300013296	Bacteria	18911
211	Ga0157374_10002408	3300013296	Bacteria	15776
212	Ga0157374_10006520	3300013296	Bacteria	9911
213	Ga0157374_10008474	3300013296	Bacteria	8792
214	Ga0157374_10013521	3300013296	Bacteria	7124
215	Ga0157374_10017936	3300013296	Bacteria	6237
216	Ga0157378_10000070	3300013297	Bacteria	91609
217	Ga0157378_10002278	3300013297	Bacteria	17042
218	Ga0157378_10116075	3300013297	Bacteria	2461
219	Ga0163162_10011186	3300013306	Bacteria	8745
220	Ga0163162_10013913	3300013306	Bacteria	7859
221	Ga0163162_10048113	3300013306	Bacteria	4272
222	Ga0163162_10073558	3300013306	Bacteria	3474
223	Ga0163162_10076655	3300013306	Bacteria	3406
224	Ga0157372_10000696	3300013307	Bacteria	36907
225	Ga0157372_10005748	3300013307	Bacteria	13213
226	Ga0157372_10019573	3300013307	Bacteria	7296
227	Ga0157372_10398385	3300013307	Unclassified	1604
228	Ga0163163_10003146	3300014325	Bacteria	13993
229	Ga0163163_10003740	3300014325	Bacteria	12953
230	Ga0163163_10068413	3300014325	Bacteria	3534
231	Ga0163163_10292835	3300014325	Bacteria	1680
232	Ga0182008_10008236	3300014497	Bacteria	5703
233	Ga0182008_10008877	3300014497	Bacteria	5453
234	Ga0157377_10000838	3300014745	Bacteria	12736
235	Ga0157379_10000392	3300014968	Bacteria	35411
236	Ga0157379_10011544	3300014968	Bacteria	7709
237	Ga0157379_10012383	3300014968	Bacteria	7452
238	Ga0157376_10001844	3300014969	Bacteria	14126
239	Ga0157376_10011450	3300014969	Bacteria	6539
240	Ga0157376_10127727	3300014969	Unclassified	2264
241	Ga0157376_10207203	3300014969	Unclassified	1808
242	Ga0182006_1027412	3300015261	Bacteria	2325
243	Ga0182007_10002880	3300015262	Bacteria	8370
244	Ga0182007_10003033	3300015262	Bacteria	8108
245	Ga0163161_10011952	3300017792	Bacteria	6022
246	Ga0213874_10044243	3300021377	Bacteria	1344
247	Ga0213875_10002069	3300021388	Bacteria	12306
248	Ga0228598_1002426	3300024227	Bacteria	4071
249	Ga0207697_10009709	3300025315	Unclassified	4144
250	Ga0207680_10010184	3300025903	Unclassified	4694
251	Ga0207647_10002009	3300025904	Bacteria	15558
252	Ga0207685_10019606	3300025905	Bacteria	2232
253	Ga0207699_10046802	3300025906	Bacteria	2532
254	Ga0207645_10000051	3300025907	Bacteria	84255
255	Ga0207643_10000079	3300025908	Bacteria	63366
256	Ga0207684_10006297	3300025910	Bacteria	10823
257	Ga0207684_10050013	3300025910	Bacteria	3546
258	Ga0207684_10058290	3300025910	Unclassified	3276
259	Ga0207707_10002805	3300025912	Bacteria	15541
260	Ga0207707_10055353	3300025912	Bacteria	3450
261	Ga0207707_10070580	3300025912	Unclassified	3044
262	Ga0207707_10097154	3300025912	Bacteria	2574
263	Ga0207695_10075148	3300025913	Bacteria	3438
264	Ga0207695_10138692	3300025913	Bacteria	2383
265	Ga0207695_10338477	3300025913	Unclassified	1393
266	Ga0207693_10001125	3300025915	Bacteria	24011
267	Ga0207693_10020388	3300025915	Bacteria	5274
268	Ga0207693_10046087	3300025915	Bacteria	3425
269	Ga0207663_10010896	3300025916	Bacteria	4857
270	Ga0207663_10032029	3300025916	Bacteria	3118
271	Ga0207663_10037844	3300025916	Bacteria	2911
272	Ga0207660_10013152	3300025917	Bacteria	5419
273	Ga0207662_10039720	3300025918	Bacteria	2762
274	Ga0207657_10000292	3300025919	Bacteria	53366
275	Ga0207657_10007284	3300025919	Bacteria	11350
276	Ga0207657_10009968	3300025919	Bacteria	9510
277	Ga0207652_10004676	3300025921	Bacteria	11106
278	Ga0207652_10040474	3300025921	Unclassified	3958
279	Ga0207646_10002365	3300025922	Bacteria	22291
280	Ga0207650_10000209	3300025925	Bacteria	66904
281	Ga0207687_10008892	3300025927	Bacteria	6566
282	Ga0207687_10009240	3300025927	Bacteria	6449
283	Ga0207687_10028925	3300025927	Unclassified	3725
284	Ga0207687_10085910	3300025927	Unclassified	2283
285	Ga0207700_10074336	3300025928	Unclassified	2629
286	Ga0207700_10111115	3300025928	Bacteria	2205
287	Ga0207664_10070248	3300025929	Unclassified	2818
288	Ga0207664_10137312	3300025929	Unclassified	2064
289	Ga0207664_10237856	3300025929	Bacteria	1585
290	Ga0207706_10001003	3300025933	Bacteria	28765
291	Ga0207706_10001055	3300025933	Bacteria	28007
292	Ga0207669_10137056	3300025937	Unclassified	1692
293	Ga0207704_10006321	3300025938	Bacteria	5517
294	Ga0207704_10063279	3300025938	Unclassified	2305
295	Ga0207665_10000098	3300025939	Bacteria	56075
296	Ga0207665_10008542	3300025939	Bacteria	6741
297	Ga0207665_10068869	3300025939	Bacteria	2412
298	Ga0207691_10003831	3300025940	Bacteria	14589
299	Ga0207711_10002778	3300025941	Bacteria	15403
300	Ga0207711_10014590	3300025941	Bacteria	6529
301	Ga0207711_10097535	3300025941	Bacteria	2595
302	Ga0207689_10000304	3300025942	Bacteria	45071
303	Ga0207689_10100192	3300025942	Unclassified	2380
304	Ga0207661_10019462	3300025944	Bacteria	5062
305	Ga0207679_10001050	3300025945	Bacteria	17577
306	Ga0207679_10017215	3300025945	Unclassified	4817
307	Ga0207679_10033237	3300025945	Bacteria	3628
308	Ga0207667_10012974	3300025949	Bacteria	9564
309	Ga0207667_10013521	3300025949	Bacteria	9333
310	Ga0207667_10072725	3300025949	Unclassified	3573
311	Ga0207667_10114442	3300025949	Unclassified	2780
312	Ga0207667_10185707	3300025949	Unclassified	2134
313	Ga0207712_10029211	3300025961	Bacteria	3696
314	Ga0207668_10024452	3300025972	Unclassified	3899
315	Ga0207640_10136362	3300025981	Unclassified	1782
316	Ga0207677_10009535	3300026023	Bacteria	5464
317	Ga0207677_10067377	3300026023	Bacteria	2508
318	Ga0207677_10068258	3300026023	Unclassified	2494
319	Ga0207677_10120365	3300026023	Bacteria	1973
320	Ga0207677_10147182	3300026023	Unclassified	1812
321	Ga0207703_10002954	3300026035	Bacteria	14420
322	Ga0207703_10026115	3300026035	Unclassified	4595
323	Ga0207678_10000204	3300026067	Bacteria	52306
324	Ga0207678_10000978	3300026067	Bacteria	26019
325	Ga0207702_10005087	3300026078	Bacteria	11554
326	Ga0207702_10077848	3300026078	Unclassified	2869
327	Ga0207641_10000291	3300026088	Bacteria	62707
328	Ga0207648_10004781	3300026089	Bacteria	13834
329	Ga0207648_10023223	3300026089	Bacteria	5562
330	Ga0207648_10081071	3300026089	Bacteria	2830
331	Ga0207676_10000113	3300026095	Bacteria	73022
332	Ga0207676_10021385	3300026095	Unclassified	4745
333	Ga0207674_10000076	3300026116	Bacteria	104404
334	Ga0207674_10002336	3300026116	Bacteria	23992
335	Ga0207674_10093173	3300026116	Bacteria	3001
336	Ga0207674_10169601	3300026116	Unclassified	2136
337	Ga0207675_100028146	3300026118	Bacteria	5233
338	Ga0207675_100212683	3300026118	Unclassified	1860
339	Ga0207683_10000889	3300026121	Bacteria	27468
340	Ga0207683_10031981	3300026121	Bacteria	4569
341	Ga0207698_10117518	3300026142	Bacteria	2243
342	Ga0268266_10008742	3300028379	Bacteria	8975
343	Ga0268266_10059601	3300028379	Unclassified	3289
344	Ga0268264_10016092	3300028381	Bacteria	6127
345	Ga0265338_10016997	3300028800	Bacteria	7870
346	Ga0265325_10046812	3300031241	Unclassified	2241
347	Ga0265340_10021802	3300031247	Unclassified	3281
348	Ga0265331_10049844	3300031250	Bacteria	2010
349	Ga0265327_10031762	3300031251	Bacteria	2963
350	Ga0265316_10075755	3300031344	Bacteria	2587
351	Ga0265313_10019333	3300031595	Bacteria	3793
352	Ga0265313_10020403	3300031595	Bacteria	3658
353	Ga0265314_10032007	3300031711	Unclassified	3875
354	Ga0307410_10041292	3300031852	Bacteria	3041
355	Ga0307411_10064247	3300032005	Bacteria	2457
356	Ga0373952_0011370	3300035092	Unclassified	1736
357	Ga0373941_0028641	3300035115	Unclassified	1637
358	Ga0373961_0022896	3300035241	Unclassified	1676
359	Ga0373924_0000457	3300035410	Bacteria	12525
360	Ga0373924_0026376	3300035410	Bacteria	2304
361	Ga0373924_0027399	3300035410	Unclassified	2265
362	Ga0373931_0006035	3300035691	Bacteria	5640
363	Ga0373931_0141469	3300035691	Bacteria	1394
364	Ga0373935_0010266	3300035692	Bacteria	5613
365	Ga0373935_0110619	3300035692	Bacteria	1823
366	Ga0373927_0116766	3300035695	Bacteria	1740
367	Ga0373947_0017027	3300035725	Bacteria	4178
368	Ga0373947_0029577	3300035725	Bacteria	3215
369	Ga0373937_0000139	3300036401	Bacteria	70018
370	Ga0373937_0068923	3300036401	Archaea	3261
371	Ga0373937_0082308	3300036401	Bacteria	2978
372	Ga0373937_0084766	3300036401	Bacteria	2932
373	Ga0373937_0226975	3300036401	Unclassified	1758
374	Ga0373925_0010248	3300037068	Bacteria	6800
375	Ga0373925_0028148	3300037068	Bacteria	4117
376	Ga0373925_0048433	3300037068	Bacteria	3166
377	Ga0395898_0027864	3300037466	Bacteria	5666
378	Ga0395905_0212591	3300037471	Unclassified	1812
379	Ga0436364_0121581	3300037853	Bacteria	44505
380	Ga0436363_1428474	3300039450	Bacteria	1384
381	Ga0436362_1174737	3300039453	Bacteria	9388
382	Ga0466963_0002968	3300044694	Bacteria	9579
383	Ga0466967_0000686	3300045976	Bacteria	17179
384	Ga0466967_0029308	3300045976	Bacteria	4605
385	Ga0466967_0042658	3300045976	Unclassified	3922
386	Ga0495580_0000306	3300046472	Bacteria	39953
387	Ga0495580_0000500	3300046472	Bacteria	32899
388	Ga0495580_0030679	3300046472	Bacteria	3890
389	Ga0495580_0052091	3300046472	Unclassified	2892
390	Ga0495639_0010324	3300046475	Bacteria	4020
391	Ga0495628_0134680	3300046516	Unclassified	1889
392	Ga0495630_0047860	3300046517	Bacteria	3200
393	Ga0495667_0061226	3300046559	Bacteria	2468
394	Ga0495667_0118894	3300046559	Bacteria	1707
395	Ga0495635_0029585	3300046663	Bacteria	3810
396	Ga0495624_0242347	3300046690	Bacteria	1091
397	Ga0496101_0229970	3300048904	Unclassified	1441
398	Ga0496102_0085843	3300048905	Unclassified	2907
399	Ga0496102_0094338	3300048905	Bacteria	2773
400	Ga0496102_0139876	3300048905	Bacteria	2269
401	Ga0496102_0239608	3300048905	Bacteria	1710
402	Ga0496103_0003431	3300048906	Bacteria	9688
403	Ga0496103_0044746	3300048906	Bacteria	2729
404	Ga0496104_0015467	3300048907	Bacteria	6910
405	Ga0496104_0020196	3300048907	Bacteria	6103
406	Ga0496104_0397596	3300048907	Unclassified	1290
407	Ga0496105_0321890	3300048908	Bacteria	1239
408	Ga0496106_0032610	3300048909	Unclassified	3885
409	Ga0496107_0052838	3300048910	Unclassified	2931
410	Ga0496107_0057665	3300048910	Bacteria	2807
411	Ga0496108_0001738	3300048911	Bacteria	17312
412	Ga0496109_0000008	3300048912	Bacteria	245809
413	Ga0496109_0116858	3300048912	Bacteria	2482
414	Ga0496110_0003559	3300048913	Bacteria	11964
415	Ga0496110_0176142	3300048913	Unclassified	1941
416	Ga0496111_0007450	3300048914	Bacteria	7176
417	Ga0496112_0000106	3300048915	Bacteria	52415
418	Ga0496112_0009001	3300048915	Bacteria	8963
419	Ga0496112_0037090	3300048915	Unclassified	4759
420	Ga0496112_0063205	3300048915	Unclassified	3651
421	Ga0496112_0104034	3300048915	Bacteria	2810
422	Ga0496112_0225316	3300048915	Bacteria	1830
423	Ga0496113_0000562	3300048916	Bacteria	18450
424	Ga0496113_0045620	3300048916	Unclassified	3251
425	Ga0496113_0055685	3300048916	Bacteria	2965
426	Ga0496113_0208568	3300048916	Unclassified	1555
427	Ga0496115_0211155	3300048918	Unclassified	1603
428	Ga0496115_0230447	3300048918	Unclassified	1527
429	nmdc:mga0n895_195586_c1	3300050512	Bacteria	2053
430	nmdc:mga0n895_414338_c1	3300050512	Bacteria	1362
431	nmdc:mga0n895_9968_c1	3300050512	Bacteria	8359
432	nmdc:mga0rr50_68532_c1	3300050513	Bacteria	2698
433	nmdc:mga08x19_10832_c1	3300050514	Bacteria	5483
434	nmdc:mga08x19_64043_c1	3300050514	Unclassified	2386
435	nmdc:mga0a205_2123_c1	3300050515	Bacteria	17394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050514	nmdc:mga08x19_10832_c1	nmdc:mga08x19_10832_c1_66_968	294
2	3300048906	Ga0496103_0044746	Ga0496103_0044746_87_1025	312
3	3300048910	Ga0496107_0052838	Ga0496107_0052838_1604_2542	312
4	3300048905	Ga0496102_0139876	Ga0496102_0139876_1276_2256	314
5	3300048912	Ga0496109_0116858	Ga0496109_0116858_23_1003	314
6	3300048916	Ga0496113_0055685	Ga0496113_0055685_47_1027	314
7	3300039450	Ga0436363_1428474	Ga0436363_1428474_89_1081	320
8	3300037466	Ga0395898_0027864	Ga0395898_0027864_4574_5584	323
9	3300045976	Ga0466967_0029308	Ga0466967_0029308_2080_3063	323
10	3300046690	Ga0495624_0242347	Ga0495624_0242347_19_1002	323
11	3300006852	Ga0075433_10082116	Ga0075433_100821162	325
12	3300006871	Ga0075434_100001995	Ga0075434_10000199516	325
13	3300007076	Ga0075435_100014264	Ga0075435_1000142642	325
14	3300005336	Ga0070680_100079227	Ga0070680_1000792271	328
15	3300005546	Ga0070696_100033558	Ga0070696_1000335582	328
16	3300005937	Ga0081455_10021337	Ga0081455_100213379	330
17	3300009093	Ga0105240_10068300	Ga0105240_100683003	330
18	3300035725	Ga0373947_0029577	Ga0373947_0029577_561_1649	330
19	3300037068	Ga0373925_0048433	Ga0373925_0048433_1567_2655	330
20	3300046472	Ga0495580_0030679	Ga0495580_0030679_1351_2439	330
21	3300048918	Ga0496115_0211155	Ga0496115_0211155_563_1582	330
22	3300005545	Ga0070695_100061923	Ga0070695_1000619233	331
23	3300005546	Ga0070696_100017473	Ga0070696_1000174734	331
24	3300009174	Ga0105241_10021209	Ga0105241_100212091	331
25	3300009177	Ga0105248_10294608	Ga0105248_102946082	331
26	3300014968	Ga0157379_10000392	Ga0157379_100003928	331
27	3300048906	Ga0496103_0003431	Ga0496103_0003431_2596_3675	331
28	3300048907	Ga0496104_0397596	Ga0496104_0397596_126_1205	331
29	3300014969	Ga0157376_10001844	Ga0157376_1000184410	332
30	3300005445	Ga0070708_100005132	Ga0070708_1000051328	334
31	3300005467	Ga0070706_100002421	Ga0070706_10000242112	334
32	3300005468	Ga0070707_100105892	Ga0070707_1001058923	334
33	3300005471	Ga0070698_100000638	Ga0070698_10000063818	334
34	3300005536	Ga0070697_100001593	Ga0070697_10000159314	334
35	3300025910	Ga0207684_10006297	Ga0207684_100062977	334
36	3300025922	Ga0207646_10002365	Ga0207646_1000236516	334
37	3300005435	Ga0070714_100095429	Ga0070714_1000954292	335
38	3300005445	Ga0070708_100008883	Ga0070708_1000088837	337
39	3300005467	Ga0070706_100042582	Ga0070706_1000425823	337
40	3300005468	Ga0070707_100039635	Ga0070707_1000396353	337
41	3300005536	Ga0070697_100100852	Ga0070697_1001008522	337
42	3300025910	Ga0207684_10050013	Ga0207684_100500132	337
43	3300045976	Ga0466967_0042658	Ga0466967_0042658_2738_3817	338
44	3300046517	Ga0495630_0047860	Ga0495630_0047860_1749_2882	338
45	3300046559	Ga0495667_0118894	Ga0495667_0118894_44_1132	338
46	3300048907	Ga0496104_0020196	Ga0496104_0020196_2267_3355	338
47	3300048908	Ga0496105_0321890	Ga0496105_0321890_24_1112	338
48	3300048915	Ga0496112_0009001	Ga0496112_0009001_5556_6644	338
49	3300048916	Ga0496113_0000562	Ga0496113_0000562_3975_5063	338
50	3300014325	Ga0163163_10292835	Ga0163163_102928352	340
51	3300048915	Ga0496112_0225316	Ga0496112_0225316_177_1262	344
52	3300005445	Ga0070708_100004252	Ga0070708_1000042529	345
53	3300005467	Ga0070706_100000706	Ga0070706_10000070619	345
54	3300005518	Ga0070699_100031042	Ga0070699_1000310426	345
55	3300005536	Ga0070697_100000122	Ga0070697_10000012258	345
56	3300005536	Ga0070697_100000190	Ga0070697_10000019043	345
57	3300006173	Ga0070716_100158965	Ga0070716_1001589651	345
58	3300021388	Ga0213875_10002069	Ga0213875_100020697	345
59	3300025910	Ga0207684_10058290	Ga0207684_100582902	345
60	3300037853	Ga0436364_0121581	Ga0436364_0121581_14736_15782	345
61	3300006914	Ga0075436_100000180	Ga0075436_10000018020	346
62	3300009093	Ga0105240_10698985	Ga0105240_106989851	346
63	3300009174	Ga0105241_10010868	Ga0105241_100108686	346
64	3300013105	Ga0157369_10165700	Ga0157369_101657002	346
65	3300014325	Ga0163163_10003740	Ga0163163_100037408	346
66	3300025912	Ga0207707_10055353	Ga0207707_100553532	346
67	3300025913	Ga0207695_10075148	Ga0207695_100751481	346
68	3300036401	Ga0373937_0084766	Ga0373937_0084766_252_1331	346
69	3300046475	Ga0495639_0010324	Ga0495639_0010324_1264_2343	346
70	3300046559	Ga0495667_0061226	Ga0495667_0061226_652_1731	346
71	3300046663	Ga0495635_0029585	Ga0495635_0029585_478_1557	346
72	3300048915	Ga0496112_0063205	Ga0496112_0063205_2103_3161	346
73	3300005335	Ga0070666_10074013	Ga0070666_100740133	349
74	3300005338	Ga0068868_100104634	Ga0068868_1001046342	349
75	3300005578	Ga0068854_100009407	Ga0068854_1000094077	349
76	3300005841	Ga0068863_100039512	Ga0068863_1000395123	349
77	3300005842	Ga0068858_100018877	Ga0068858_1000188773	349
78	3300006028	Ga0070717_10001335	Ga0070717_100013355	349
79	3300006237	Ga0097621_100010364	Ga0097621_1000103642	349
80	3300006358	Ga0068871_100002182	Ga0068871_1000021829	349
81	3300009098	Ga0105245_10004368	Ga0105245_100043686	349
82	3300009176	Ga0105242_10077488	Ga0105242_100774882	349
83	3300013100	Ga0157373_10105823	Ga0157373_101058232	349
84	3300013297	Ga0157378_10002278	Ga0157378_1000227815	349
85	3300013306	Ga0163162_10048113	Ga0163162_100481136	349
86	3300014969	Ga0157376_10207203	Ga0157376_102072032	349
87	3300025927	Ga0207687_10008892	Ga0207687_100088925	349
88	3300026023	Ga0207677_10147182	Ga0207677_101471822	349
89	3300021377	Ga0213874_10044243	Ga0213874_100442431	350
90	3300005468	Ga0070707_100407758	Ga0070707_1004077581	352
91	3300005536	Ga0070697_100037221	Ga0070697_1000372214	352
92	3300006028	Ga0070717_10247237	Ga0070717_102472372	352
93	3300006871	Ga0075434_100135266	Ga0075434_1001352662	352
94	3300007076	Ga0075435_100000142	Ga0075435_10000014230	352
95	3300025928	Ga0207700_10111115	Ga0207700_101111152	352
96	3300050512	nmdc:mga0n895_195586_c1	nmdc:mga0n895_195586_c1_817_1959	352
97	3300050514	nmdc:mga08x19_64043_c1	nmdc:mga08x19_64043_c1_1075_2151	352
98	3300005290	Ga0065712_10003616	Ga0065712_100036163	353
99	3300005329	Ga0070683_100082811	Ga0070683_1000828112	353
100	3300005329	Ga0070683_100387515	Ga0070683_1003875151	353
101	3300005336	Ga0070680_100006626	Ga0070680_1000066267	353
102	3300005344	Ga0070661_100007120	Ga0070661_1000071205	353
103	3300005355	Ga0070671_100042661	Ga0070671_1000426613	353
104	3300005458	Ga0070681_10003328	Ga0070681_100033286	353
105	3300005458	Ga0070681_10038346	Ga0070681_100383463	353
106	3300005458	Ga0070681_10120934	Ga0070681_101209342	353
107	3300005458	Ga0070681_10168770	Ga0070681_101687703	353
108	3300005530	Ga0070679_100002191	Ga0070679_1000021912	353
109	3300005539	Ga0068853_100071099	Ga0068853_1000710993	353
110	3300005539	Ga0068853_100265583	Ga0068853_1002655832	353
111	3300005563	Ga0068855_100012428	Ga0068855_1000124286	353
112	3300005563	Ga0068855_100120606	Ga0068855_1001206062	353
113	3300005564	Ga0070664_100006027	Ga0070664_1000060279	353
114	3300005577	Ga0068857_100082117	Ga0068857_1000821172	353
115	3300005578	Ga0068854_100017053	Ga0068854_1000170533	353
116	3300005614	Ga0068856_100121444	Ga0068856_1001214443	353
117	3300005616	Ga0068852_100086947	Ga0068852_1000869472	353
118	3300005834	Ga0068851_10033423	Ga0068851_100334233	353
119	3300005842	Ga0068858_100227401	Ga0068858_1002274012	353
120	3300006871	Ga0075434_100126761	Ga0075434_1001267613	353
121	3300009093	Ga0105240_10015526	Ga0105240_100155264	353
122	3300009098	Ga0105245_10000539	Ga0105245_100005398	353
123	3300009098	Ga0105245_10163811	Ga0105245_101638113	353
124	3300009545	Ga0105237_10011540	Ga0105237_100115404	353
125	3300009551	Ga0105238_10006016	Ga0105238_1000601610	353
126	3300009551	Ga0105238_10024518	Ga0105238_100245183	353
127	3300010375	Ga0105239_10080233	Ga0105239_100802333	353
128	3300013105	Ga0157369_10023472	Ga0157369_100234726	353
129	3300013105	Ga0157369_10053086	Ga0157369_100530864	353
130	3300013105	Ga0157369_10155996	Ga0157369_101559961	353
131	3300013296	Ga0157374_10008474	Ga0157374_100084744	353
132	3300013297	Ga0157378_10116075	Ga0157378_101160752	353
133	3300013307	Ga0157372_10398385	Ga0157372_103983852	353
134	3300014497	Ga0182008_10008236	Ga0182008_100082367	353
135	3300015261	Ga0182006_1027412	Ga0182006_10274122	353
136	3300015262	Ga0182007_10003033	Ga0182007_100030338	353
137	3300025912	Ga0207707_10002805	Ga0207707_100028055	353
138	3300025912	Ga0207707_10097154	Ga0207707_100971542	353
139	3300025913	Ga0207695_10138692	Ga0207695_101386922	353
140	3300025913	Ga0207695_10338477	Ga0207695_103384772	353
141	3300025917	Ga0207660_10013152	Ga0207660_100131523	353
142	3300025919	Ga0207657_10007284	Ga0207657_100072843	353
143	3300025921	Ga0207652_10004676	Ga0207652_1000467610	353
144	3300025927	Ga0207687_10009240	Ga0207687_100092403	353
145	3300025941	Ga0207711_10097535	Ga0207711_100975353	353
146	3300025944	Ga0207661_10019462	Ga0207661_100194622	353
147	3300025945	Ga0207679_10033237	Ga0207679_100332374	353
148	3300025949	Ga0207667_10012974	Ga0207667_100129745	353
149	3300025949	Ga0207667_10114442	Ga0207667_101144422	353
150	3300026116	Ga0207674_10093173	Ga0207674_100931734	353
151	3300031852	Ga0307410_10041292	Ga0307410_100412922	353
152	3300032005	Ga0307411_10064247	Ga0307411_100642472	353
153	3300035410	Ga0373924_0026376	Ga0373924_0026376_1049_2122	353
154	3300035692	Ga0373935_0110619	Ga0373935_0110619_235_1308	353
155	3300035725	Ga0373947_0017027	Ga0373947_0017027_1454_2533	353
156	3300036401	Ga0373937_0000139	Ga0373937_0000139_67179_68252	353
157	3300036401	Ga0373937_0082308	Ga0373937_0082308_1334_2407	353
158	3300037068	Ga0373925_0010248	Ga0373925_0010248_2788_3861	353
159	3300039453	Ga0436362_1174737	Ga0436362_1174737_7805_8893	353
160	3300044694	Ga0466963_0002968	Ga0466963_0002968_3114_4187	353
161	3300045976	Ga0466967_0000686	Ga0466967_0000686_13229_14302	353
162	3300048905	Ga0496102_0239608	Ga0496102_0239608_397_1470	353
163	3300048907	Ga0496104_0015467	Ga0496104_0015467_3820_4917	353
164	3300048910	Ga0496107_0057665	Ga0496107_0057665_1375_2472	353
165	3300048915	Ga0496112_0104034	Ga0496112_0104034_596_1669	353
166	3300048916	Ga0496113_0208568	Ga0496113_0208568_455_1528	353
167	3300006028	Ga0070717_10136474	Ga0070717_101364743	354
168	3300005329	Ga0070683_100005653	Ga0070683_1000056536	355
169	3300005330	Ga0070690_100043237	Ga0070690_1000432373	355
170	3300005335	Ga0070666_10105799	Ga0070666_101057992	355
171	3300005338	Ga0068868_100054988	Ga0068868_1000549883	355
172	3300005344	Ga0070661_100113330	Ga0070661_1001133302	355
173	3300005436	Ga0070713_100042784	Ga0070713_1000427843	355
174	3300005436	Ga0070713_100078251	Ga0070713_1000782513	355
175	3300005439	Ga0070711_100024599	Ga0070711_1000245993	355
176	3300005455	Ga0070663_100006374	Ga0070663_1000063746	355
177	3300005535	Ga0070684_100203774	Ga0070684_1002037742	355
178	3300005539	Ga0068853_100021411	Ga0068853_1000214115	355
179	3300005544	Ga0070686_100012111	Ga0070686_1000121113	355
180	3300005545	Ga0070695_100010995	Ga0070695_1000109954	355
181	3300005547	Ga0070693_100024095	Ga0070693_1000240953	355
182	3300005548	Ga0070665_100021665	Ga0070665_1000216656	355
183	3300005563	Ga0068855_100167097	Ga0068855_1001670971	355
184	3300005577	Ga0068857_100145367	Ga0068857_1001453671	355
185	3300005614	Ga0068856_100021683	Ga0068856_1000216832	355
186	3300005842	Ga0068858_100078058	Ga0068858_1000780585	355
187	3300006028	Ga0070717_10076375	Ga0070717_100763752	355
188	3300006028	Ga0070717_10270872	Ga0070717_102708721	355
189	3300006881	Ga0068865_100014491	Ga0068865_1000144915	355
190	3300006914	Ga0075436_100148602	Ga0075436_1001486021	355
191	3300009147	Ga0114129_10076021	Ga0114129_100760215	355
192	3300009176	Ga0105242_10017573	Ga0105242_100175734	355
193	3300009176	Ga0105242_10035100	Ga0105242_100351003	355
194	3300009545	Ga0105237_10054139	Ga0105237_100541393	355
195	3300009551	Ga0105238_10215521	Ga0105238_102155212	355
196	3300013100	Ga0157373_10204831	Ga0157373_102048311	355
197	3300013296	Ga0157374_10006520	Ga0157374_100065203	355
198	3300013306	Ga0163162_10011186	Ga0163162_100111863	355
199	3300014968	Ga0157379_10012383	Ga0157379_100123835	355
200	3300014969	Ga0157376_10011450	Ga0157376_100114502	355
201	3300025919	Ga0207657_10009968	Ga0207657_100099688	355
202	3300025927	Ga0207687_10028925	Ga0207687_100289253	355
203	3300025933	Ga0207706_10001003	Ga0207706_1000100312	355
204	3300025941	Ga0207711_10014590	Ga0207711_100145907	355
205	3300025949	Ga0207667_10185707	Ga0207667_101857072	355
206	3300025961	Ga0207712_10029211	Ga0207712_100292112	355
207	3300026023	Ga0207677_10068258	Ga0207677_100682583	355
208	3300026067	Ga0207678_10000978	Ga0207678_1000097820	355
209	3300026089	Ga0207648_10081071	Ga0207648_100810711	355
210	3300026116	Ga0207674_10169601	Ga0207674_101696011	355
211	3300028379	Ga0268266_10059601	Ga0268266_100596014	355
212	3300035092	Ga0373952_0011370	Ga0373952_0011370_276_1370	355
213	3300035115	Ga0373941_0028641	Ga0373941_0028641_341_1435	355
214	3300035241	Ga0373961_0022896	Ga0373961_0022896_346_1440	355
215	3300035410	Ga0373924_0000457	Ga0373924_0000457_10075_11163	355
216	3300035410	Ga0373924_0027399	Ga0373924_0027399_233_1366	355
217	3300035692	Ga0373935_0010266	Ga0373935_0010266_3053_4141	355
218	3300036401	Ga0373937_0226975	Ga0373937_0226975_40_1185	355
219	3300046516	Ga0495628_0134680	Ga0495628_0134680_409_1542	355
220	3300048913	Ga0496110_0176142	Ga0496110_0176142_273_1367	355
221	3300005338	Ga0068868_100016922	Ga0068868_1000169226	356
222	3300005340	Ga0070689_100040080	Ga0070689_1000400803	356
223	3300005435	Ga0070714_100074262	Ga0070714_1000742624	356
224	3300005436	Ga0070713_100017082	Ga0070713_1000170823	356
225	3300005439	Ga0070711_100075940	Ga0070711_1000759402	356
226	3300005440	Ga0070705_100052063	Ga0070705_1000520633	356
227	3300005459	Ga0068867_100024180	Ga0068867_1000241802	356
228	3300005563	Ga0068855_100124402	Ga0068855_1001244022	356
229	3300005564	Ga0070664_100002532	Ga0070664_10000253211	356
230	3300005577	Ga0068857_100000471	Ga0068857_1000004713	356
231	3300005578	Ga0068854_100004795	Ga0068854_1000047952	356
232	3300005614	Ga0068856_100004473	Ga0068856_10000447313	356
233	3300005614	Ga0068856_100198182	Ga0068856_1001981822	356
234	3300005617	Ga0068859_100002581	Ga0068859_10000258117	356
235	3300005618	Ga0068864_100004299	Ga0068864_10000429911	356
236	3300005719	Ga0068861_100179701	Ga0068861_1001797012	356
237	3300005842	Ga0068858_100011937	Ga0068858_1000119372	356
238	3300006237	Ga0097621_100009020	Ga0097621_1000090203	356
239	3300006358	Ga0068871_100025356	Ga0068871_1000253562	356
240	3300006881	Ga0068865_100075808	Ga0068865_1000758083	356
241	3300006931	Ga0097620_100002580	Ga0097620_10000258017	356
242	3300009093	Ga0105240_10419641	Ga0105240_104196412	356
243	3300009093	Ga0105240_10472702	Ga0105240_104727022	356
244	3300009098	Ga0105245_10058198	Ga0105245_100581983	356
245	3300009174	Ga0105241_10006114	Ga0105241_100061148	356
246	3300009545	Ga0105237_10025132	Ga0105237_100251325	356
247	3300009545	Ga0105237_10087554	Ga0105237_100875542	356
248	3300009553	Ga0105249_10150560	Ga0105249_101505602	356
249	3300010375	Ga0105239_10400117	Ga0105239_104001172	356
250	3300013100	Ga0157373_10001214	Ga0157373_1000121410	356
251	3300013100	Ga0157373_10003605	Ga0157373_100036058	356
252	3300013102	Ga0157371_10049046	Ga0157371_100490462	356
253	3300013104	Ga0157370_10030810	Ga0157370_100308104	356
254	3300013105	Ga0157369_10012944	Ga0157369_100129445	356
255	3300013296	Ga0157374_10001614	Ga0157374_1000161418	356
256	3300013296	Ga0157374_10017936	Ga0157374_100179363	356
257	3300013297	Ga0157378_10000070	Ga0157378_100000704	356
258	3300013307	Ga0157372_10000696	Ga0157372_1000069621	356
259	3300013307	Ga0157372_10019573	Ga0157372_100195738	356
260	3300025912	Ga0207707_10070580	Ga0207707_100705803	356
261	3300025921	Ga0207652_10040474	Ga0207652_100404743	356
262	3300025927	Ga0207687_10085910	Ga0207687_100859102	356
263	3300025929	Ga0207664_10137312	Ga0207664_101373122	356
264	3300025929	Ga0207664_10237856	Ga0207664_102378561	356
265	3300025938	Ga0207704_10063279	Ga0207704_100632792	356
266	3300025942	Ga0207689_10100192	Ga0207689_101001922	356
267	3300025945	Ga0207679_10017215	Ga0207679_100172153	356
268	3300025949	Ga0207667_10013521	Ga0207667_100135218	356
269	3300025981	Ga0207640_10136362	Ga0207640_101363622	356
270	3300026023	Ga0207677_10009535	Ga0207677_100095355	356
271	3300026035	Ga0207703_10002954	Ga0207703_100029547	356
272	3300026078	Ga0207702_10005087	Ga0207702_100050879	356
273	3300026078	Ga0207702_10077848	Ga0207702_100778482	356
274	3300026089	Ga0207648_10023223	Ga0207648_100232233	356
275	3300026095	Ga0207676_10021385	Ga0207676_100213852	356
276	3300026116	Ga0207674_10002336	Ga0207674_1000233622	356
277	3300026118	Ga0207675_100212683	Ga0207675_1002126832	356
278	3300026121	Ga0207683_10031981	Ga0207683_100319813	356
279	3300031250	Ga0265331_10049844	Ga0265331_100498442	356
280	3300031595	Ga0265313_10019333	Ga0265313_100193333	356
281	3300031711	Ga0265314_10032007	Ga0265314_100320074	356
282	3300035691	Ga0373931_0006035	Ga0373931_0006035_2461_3561	356
283	3300035691	Ga0373931_0141469	Ga0373931_0141469_195_1304	356
284	3300037471	Ga0395905_0212591	Ga0395905_0212591_514_1608	356
285	3300046472	Ga0495580_0052091	Ga0495580_0052091_1323_2426	356
286	3300048915	Ga0496112_0037090	Ga0496112_0037090_2437_3537	356
287	3300050512	nmdc:mga0n895_414338_c1	nmdc:mga0n895_414338_c1_206_1300	356
288	3300005445	Ga0070708_100013639	Ga0070708_1000136393	357
289	3300005445	Ga0070708_100033647	Ga0070708_1000336475	357
290	3300009093	Ga0105240_10120242	Ga0105240_101202424	357
291	3300013296	Ga0157374_10013521	Ga0157374_100135218	357
292	3300013306	Ga0163162_10013913	Ga0163162_100139138	357
293	3300036401	Ga0373937_0068923	Ga0373937_0068923_1050_2150	357
294	3300037068	Ga0373925_0028148	Ga0373925_0028148_2932_4032	357
295	3300048904	Ga0496101_0229970	Ga0496101_0229970_61_1161	357
296	3300048905	Ga0496102_0094338	Ga0496102_0094338_25_1125	357
297	3300048918	Ga0496115_0230447	Ga0496115_0230447_371_1477	357
298	3300050512	nmdc:mga0n895_9968_c1	nmdc:mga0n895_9968_c1_2765_3892	357
299	3300050513	nmdc:mga0rr50_68532_c1	nmdc:mga0rr50_68532_c1_325_1452	357
300	3300050515	nmdc:mga0a205_2123_c1	nmdc:mga0a205_2123_c1_13108_14235	357
301	3300005437	Ga0070710_10043083	Ga0070710_100430833	358
302	3300005439	Ga0070711_100005193	Ga0070711_1000051937	358
303	3300006173	Ga0070716_100008007	Ga0070716_1000080073	358
304	3300006175	Ga0070712_100002243	Ga0070712_1000022435	358
305	3300025915	Ga0207693_10001125	Ga0207693_1000112515	358
306	3300025916	Ga0207663_10037844	Ga0207663_100378442	358
307	3300025939	Ga0207665_10008542	Ga0207665_100085425	358
308	3300025939	Ga0207665_10068869	Ga0207665_100688692	358
309	3300031251	Ga0265327_10031762	Ga0265327_100317622	358
310	3300031344	Ga0265316_10075755	Ga0265316_100757552	358
311	3300005439	Ga0070711_100016426	Ga0070711_1000164265	359
312	3300006175	Ga0070712_100009698	Ga0070712_1000096985	359
313	3300024227	Ga0228598_1002426	Ga0228598_10024262	359
314	3300025915	Ga0207693_10020388	Ga0207693_100203883	359
315	3300025916	Ga0207663_10010896	Ga0207663_100108962	359
316	3300028800	Ga0265338_10016997	Ga0265338_100169978	359
317	3300031241	Ga0265325_10046812	Ga0265325_100468121	359
318	3300031247	Ga0265340_10021802	Ga0265340_100218022	359
319	3300031595	Ga0265313_10020403	Ga0265313_100204033	359
320	3300035695	Ga0373927_0116766	Ga0373927_0116766_115_1251	359
321	3300046472	Ga0495580_0000306	Ga0495580_0000306_38331_39467	359
322	3300005445	Ga0070708_100003088	Ga0070708_1000030883	360
323	3300025928	Ga0207700_10074336	Ga0207700_100743363	360
324	3300005338	Ga0068868_100020658	Ga0068868_1000206586	361
325	3300005434	Ga0070709_10072592	Ga0070709_100725921	361
326	3300005435	Ga0070714_100412522	Ga0070714_1004125221	361
327	3300005436	Ga0070713_100132057	Ga0070713_1001320571	361
328	3300005439	Ga0070711_100015088	Ga0070711_1000150884	361
329	3300006163	Ga0070715_10013081	Ga0070715_100130815	361
330	3300006173	Ga0070716_100000080	Ga0070716_10000008027	361
331	3300006175	Ga0070712_100010904	Ga0070712_1000109045	361
332	3300013296	Ga0157374_10002408	Ga0157374_100024083	361
333	3300013306	Ga0163162_10073558	Ga0163162_100735584	361
334	3300014325	Ga0163163_10068413	Ga0163163_100684132	361
335	3300025905	Ga0207685_10019606	Ga0207685_100196063	361
336	3300025906	Ga0207699_10046802	Ga0207699_100468021	361
337	3300025915	Ga0207693_10046087	Ga0207693_100460873	361
338	3300025916	Ga0207663_10032029	Ga0207663_100320292	361
339	3300025929	Ga0207664_10070248	Ga0207664_100702482	361
340	3300025939	Ga0207665_10000098	Ga0207665_1000009843	361
341	3300026023	Ga0207677_10067377	Ga0207677_100673773	361
342	3300048905	Ga0496102_0085843	Ga0496102_0085843_583_1677	361
343	3300006028	Ga0070717_10051785	Ga0070717_100517852	362
344	3300046472	Ga0495580_0000500	Ga0495580_0000500_6293_7417	362
345	3300005530	Ga0070679_100370472	Ga0070679_1003704721	363
346	3300005543	Ga0070672_100001540	Ga0070672_10000154014	363
347	3300005563	Ga0068855_100094037	Ga0068855_1000940372	363
348	3300005577	Ga0068857_100001109	Ga0068857_10000110912	363
349	3300005578	Ga0068854_100062801	Ga0068854_1000628012	363
350	3300005616	Ga0068852_100013744	Ga0068852_1000137443	363
351	3300005719	Ga0068861_100130135	Ga0068861_1001301352	363
352	3300005834	Ga0068851_10001878	Ga0068851_100018787	363
353	3300005840	Ga0068870_10001080	Ga0068870_100010808	363
354	3300005842	Ga0068858_100015724	Ga0068858_1000157246	363
355	3300005843	Ga0068860_100019415	Ga0068860_1000194156	363
356	3300005844	Ga0068862_100008606	Ga0068862_1000086065	363
357	3300025315	Ga0207697_10009709	Ga0207697_100097094	363
358	3300025903	Ga0207680_10010184	Ga0207680_100101845	363
359	3300025904	Ga0207647_10002009	Ga0207647_100020097	363
360	3300025907	Ga0207645_10000051	Ga0207645_1000005113	363
361	3300025908	Ga0207643_10000079	Ga0207643_1000007914	363
362	3300025918	Ga0207662_10039720	Ga0207662_100397203	363
363	3300025919	Ga0207657_10000292	Ga0207657_1000029212	363
364	3300025925	Ga0207650_10000209	Ga0207650_1000020947	363
365	3300025933	Ga0207706_10001055	Ga0207706_1000105524	363
366	3300025937	Ga0207669_10137056	Ga0207669_101370562	363
367	3300025938	Ga0207704_10006321	Ga0207704_100063212	363
368	3300025940	Ga0207691_10003831	Ga0207691_100038317	363
369	3300025941	Ga0207711_10002778	Ga0207711_100027787	363
370	3300025942	Ga0207689_10000304	Ga0207689_1000030443	363
371	3300025945	Ga0207679_10001050	Ga0207679_100010508	363
372	3300025949	Ga0207667_10072725	Ga0207667_100727252	363
373	3300025972	Ga0207668_10024452	Ga0207668_100244523	363
374	3300026023	Ga0207677_10120365	Ga0207677_101203652	363
375	3300026035	Ga0207703_10026115	Ga0207703_100261153	363
376	3300026067	Ga0207678_10000204	Ga0207678_1000020412	363
377	3300026088	Ga0207641_10000291	Ga0207641_1000029111	363
378	3300026089	Ga0207648_10004781	Ga0207648_1000478114	363
379	3300026095	Ga0207676_10000113	Ga0207676_100001137	363
380	3300026116	Ga0207674_10000076	Ga0207674_1000007645	363
381	3300026118	Ga0207675_100028146	Ga0207675_1000281466	363
382	3300026121	Ga0207683_10000889	Ga0207683_1000088913	363
383	3300026142	Ga0207698_10117518	Ga0207698_101175182	363
384	3300028379	Ga0268266_10008742	Ga0268266_100087427	363
385	3300028381	Ga0268264_10016092	Ga0268264_100160927	363
386	3300014497	Ga0182008_10008877	Ga0182008_100088777	364
387	3300015262	Ga0182007_10002880	Ga0182007_1000288010	364
388	3300002459	JGI24751J29686_10000795	JGI24751J29686_100007957	367
389	3300005293	Ga0065715_10000935	Ga0065715_100009357	367
390	3300005295	Ga0065707_10124643	Ga0065707_101246432	367
391	3300005327	Ga0070658_10015209	Ga0070658_100152091	367
392	3300005328	Ga0070676_10002082	Ga0070676_100020827	367
393	3300005329	Ga0070683_100002442	Ga0070683_1000024426	367
394	3300005330	Ga0070690_100004402	Ga0070690_1000044028	367
395	3300005331	Ga0070670_100015218	Ga0070670_1000152186	367
396	3300005334	Ga0068869_100008080	Ga0068869_1000080803	367
397	3300005338	Ga0068868_100004143	Ga0068868_1000041437	367
398	3300005339	Ga0070660_100001360	Ga0070660_10000136014	367
399	3300005340	Ga0070689_100003898	Ga0070689_1000038987	367
400	3300005343	Ga0070687_100013787	Ga0070687_1000137873	367
401	3300005353	Ga0070669_100013597	Ga0070669_1000135977	367
402	3300005354	Ga0070675_100004266	Ga0070675_1000042663	367
403	3300005364	Ga0070673_100021297	Ga0070673_1000212973	367
404	3300005365	Ga0070688_100000903	Ga0070688_10000090314	367
405	3300005366	Ga0070659_100007344	Ga0070659_1000073447	367
406	3300005455	Ga0070663_100001055	Ga0070663_10000105510	367
407	3300005459	Ga0068867_100005145	Ga0068867_1000051459	367
408	3300005466	Ga0070685_10002197	Ga0070685_100021977	367
409	3300005535	Ga0070684_100002238	Ga0070684_1000022387	367
410	3300005539	Ga0068853_100015426	Ga0068853_1000154267	367
411	3300005544	Ga0070686_100017276	Ga0070686_1000172763	367
412	3300005547	Ga0070693_100020664	Ga0070693_1000206643	367
413	3300009098	Ga0105245_10018365	Ga0105245_100183651	367
414	3300009177	Ga0105248_10033775	Ga0105248_100337756	367
415	3300009545	Ga0105237_10065785	Ga0105237_100657852	367
416	3300009553	Ga0105249_10151488	Ga0105249_101514882	367
417	3300010375	Ga0105239_10008471	Ga0105239_1000847112	367
418	3300011119	Ga0105246_10014798	Ga0105246_100147987	367
419	3300013100	Ga0157373_10000778	Ga0157373_1000077814	367
420	3300013102	Ga0157371_10008878	Ga0157371_100088787	367
421	3300013105	Ga0157369_10061391	Ga0157369_100613912	367
422	3300013306	Ga0163162_10076655	Ga0163162_100766554	367
423	3300013307	Ga0157372_10005748	Ga0157372_1000574810	367
424	3300014325	Ga0163163_10003146	Ga0163163_1000314612	367
425	3300014745	Ga0157377_10000838	Ga0157377_100008383	367
426	3300014968	Ga0157379_10011544	Ga0157379_100115443	367
427	3300014969	Ga0157376_10127727	Ga0157376_101277272	367
428	3300017792	Ga0163161_10011952	Ga0163161_100119527	367
429	3300048909	Ga0496106_0032610	Ga0496106_0032610_2095_3198	367
430	3300048911	Ga0496108_0001738	Ga0496108_0001738_12586_13689	367
431	3300048912	Ga0496109_0000008	Ga0496109_0000008_42549_43652	367
432	3300048913	Ga0496110_0003559	Ga0496110_0003559_660_1763	367
433	3300048914	Ga0496111_0007450	Ga0496111_0007450_1566_2669	367
434	3300048915	Ga0496112_0000106	Ga0496112_0000106_47366_48469	367
435	3300048916	Ga0496113_0045620	Ga0496113_0045620_494_1597	367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12831

FAD_oxidored

FAD dependent oxidoreductase

3

36

0.96 PF00890

FAD_binding_2

FAD binding domain

3

40

0.94 PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

2

202

0.91 PF01134

GIDA

Glucose inhibited division protein A

3

58

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4oqy-assembly1.cif.gz_B	streptomyces sp. gf3546 imine reductase	0.9463	9	38
4oqy-assembly1.cif.gz_A	streptomyces sp. gf3546 imine reductase	0.9461	9	38
8i4n-assembly1.cif.gz_B	crystal strcuture of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum	0.9451	8	38
7o4u-assembly2.cif.gz_B	structure of the alpha subunit of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide	0.9434	9	39
5a9r-assembly1.cif.gz_A	apo form of imine reductase from amycolatopsis orientalis	0.9416	9	40

ID	Description	Score	Start	End	Superfamily
af_A7YT47_359_542_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.979	9	38	3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9577	10	40	3.50.50.60
af_Q4DU92_1_145_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9499	9	38	3.40.50.720
4oqyB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9463	9	38	3.40.50.720
af_Q5AMP2_2_178_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.946	8	38	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A2V9P8W3-F1-model_v4	FAD-binding domain-containing protein	0.9693	8	364
AF-A0A2V8L9K3-F1-model_v4	FAD/NAD(P)-binding domain-containing protein	0.9569	13	367	GO:0016491
AF-A0A2V8L9K3-F1-model_v4	FAD/NAD(P)-binding domain-containing protein	0.9515	13	367	GO:0016491
AF-Q1IRI6-F1-model_v4	FAD dependent oxidoreductase	0.9487	4	367
AF-A0A2V9P8W3-F1-model_v4	FAD-binding domain-containing protein	0.9484	8	364

Feature Viewer

pLDDT	pTM	Quality
87.14	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F443305

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF12831

FAD_oxidored

FAD dependent oxidoreductase

3

36

0.96

PF00890

FAD_binding_2

FAD binding domain

3

40

0.94

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

2

202

0.91

PF01134

GIDA

Glucose inhibited division protein A

3

58

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map