F443067

General Info

Members Datasets Scaffolds Average Seq Length
434 199 868 350

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10005391|Ga0075433_100053915
Length 333
Sequence MAARIKTAVLGATGYSGLELARLLLRHPRLEKPVLFRRPAEIGDAADLTKIFPALSGNGGYPLQPFSWSALKADEVEVLFLATPHEVSRGLAPEAVARGVRVIDLSGAWRLKQQQHRAIYGFPDSVSALNADRISGASLVANPGCYATSVILALAPLLAAKVIDREKGIVSDSKSGVSGAGKEPTSRTHFVSIANNLSAYSVFGHRHTGEILEQLQLNPRELIFTPHLLPIPRGILSTIYIHLNREMGPAEVQSCFQDFYVGKRWVRIFTTPTLPEIGFSLHTNYCDLGFCLADDRRRLVLISCVDNLLKGAAGQAVQNLNLMQGWQEDEGLA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.14
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 16.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10005391 3300006852 Bacteria 10051
2 Ga0065712_10076428 3300005290 Bacteria 3660
3 Ga0070658_10020573 3300005327 Bacteria 5289
4 Ga0070683_100030608 3300005329 Unclassified 4888
5 Ga0070683_100100816 3300005329 Unclassified 2718
6 Ga0070690_100032553 3300005330 Unclassified 3257
7 Ga0070670_100005675 3300005331 Bacteria 10537
8 Ga0068869_100015207 3300005334 Bacteria 5156
9 Ga0070666_10048448 3300005335 Bacteria 2855
10 Ga0070680_100004896 3300005336 Bacteria 10085
11 Ga0070682_100010558 3300005337 Bacteria 5242
12 Ga0070682_100164452 3300005337 Bacteria 1536
13 Ga0068868_100002898 3300005338 Bacteria 11907
14 Ga0068868_100027131 3300005338 Unclassified 4367
15 Ga0070689_100058582 3300005340 Bacteria 2991
16 Ga0070687_100051615 3300005343 Bacteria 2130
17 Ga0070661_100004572 3300005344 Bacteria 9515
18 Ga0070661_100211597 3300005344 Bacteria 1484
19 Ga0070668_100030105 3300005347 Unclassified 4126
20 Ga0070669_100074648 3300005353 Bacteria 2514
21 Ga0070659_100020283 3300005366 Bacteria 5047
22 Ga0070659_100111341 3300005366 Bacteria 2210
23 Ga0070709_10001402 3300005434 Bacteria 13089
24 Ga0070709_10008194 3300005434 Bacteria 5738
25 Ga0070714_100036370 3300005435 Bacteria 4129
26 Ga0070714_100239969 3300005435 Bacteria 1672
27 Ga0070714_100281034 3300005435 Bacteria 1546
28 Ga0070713_100000094 3300005436 Bacteria 57097
29 Ga0070713_100000488 3300005436 Bacteria 25295
30 Ga0070713_100017317 3300005436 Bacteria 5446
31 Ga0070713_100047984 3300005436 Bacteria 3513
32 Ga0070713_100052899 3300005436 Bacteria 3363
33 Ga0070713_100129742 3300005436 Unclassified 2222
34 Ga0070713_100139747 3300005436 Bacteria 2144
35 Ga0070713_100227884 3300005436 Bacteria 1693
36 Ga0070710_10000594 3300005437 Bacteria 17228
37 Ga0070710_10046238 3300005437 Bacteria 2423
38 Ga0070711_100001433 3300005439 Bacteria 13104
39 Ga0070711_100029561 3300005439 Bacteria 3617
40 Ga0070711_100066451 3300005439 Bacteria 2526
41 Ga0070711_100125648 3300005439 Unclassified 1903
42 Ga0070708_100001286 3300005445 Bacteria 19290
43 Ga0070708_100004377 3300005445 Bacteria 11094
44 Ga0070662_100007312 3300005457 Bacteria 7154
45 Ga0070681_10000105 3300005458 Bacteria 62694
46 Ga0070681_10001952 3300005458 Bacteria 18623
47 Ga0070681_10014021 3300005458 Bacteria 7977
48 Ga0070681_10030333 3300005458 Bacteria 5425
49 Ga0070681_10030895 3300005458 Bacteria 5376
50 Ga0070681_10043299 3300005458 Unclassified 4510
51 Ga0070681_10098899 3300005458 Unclassified 2863
52 Ga0068867_100039287 3300005459 Unclassified 3449
53 Ga0068867_100304844 3300005459 Bacteria 1314
54 Ga0070706_100000577 3300005467 Bacteria 42644
55 Ga0070706_100048603 3300005467 Bacteria 3915
56 Ga0070706_100061972 3300005467 Bacteria 3455
57 Ga0070706_100069069 3300005467 Bacteria 3268
58 Ga0070706_100103544 3300005467 Unclassified 2646
59 Ga0070707_100001900 3300005468 Bacteria 20031
60 Ga0070707_100012735 3300005468 Bacteria 7852
61 Ga0070707_100203455 3300005468 Bacteria 1930
62 Ga0070707_100289401 3300005468 Bacteria 1592
63 Ga0070698_100000749 3300005471 Bacteria 35011
64 Ga0070698_100008866 3300005471 Bacteria 10814
65 Ga0070698_100044891 3300005471 Bacteria 4524
66 Ga0070699_100004838 3300005518 Bacteria 11880
67 Ga0070699_100012336 3300005518 Bacteria 7374
68 Ga0070679_100002137 3300005530 Bacteria 17819
69 Ga0070679_100004614 3300005530 Bacteria 12720
70 Ga0070679_100036062 3300005530 Bacteria 4907
71 Ga0070684_100043348 3300005535 Bacteria 3885
72 Ga0070697_100039328 3300005536 Bacteria 3823
73 Ga0070697_100062206 3300005536 Bacteria 3046
74 Ga0068853_100025294 3300005539 Bacteria 4981
75 Ga0068853_100030308 3300005539 Bacteria 4568
76 Ga0068853_100316995 3300005539 Unclassified 1445
77 Ga0070686_100115394 3300005544 Bacteria 1836
78 Ga0070695_100131257 3300005545 Unclassified 1727
79 Ga0070696_100028509 3300005546 Unclassified 3811
80 Ga0068855_100000143 3300005563 Bacteria 91719
81 Ga0068855_100002068 3300005563 Bacteria 24857
82 Ga0068855_100114213 3300005563 Unclassified 3096
83 Ga0070664_100001793 3300005564 Bacteria 17228
84 Ga0070664_100039245 3300005564 Unclassified 3989
85 Ga0068857_100009909 3300005577 Bacteria 8269
86 Ga0068857_100016899 3300005577 Bacteria 6393
87 Ga0068854_100001681 3300005578 Bacteria 13475
88 Ga0068854_100007758 3300005578 Bacteria 6862
89 Ga0068856_100000072 3300005614 Bacteria 95094
90 Ga0068856_100000148 3300005614 Bacteria 71173
91 Ga0068856_100003575 3300005614 Bacteria 15645
92 Ga0068856_100130236 3300005614 Bacteria 2520
93 Ga0070702_100021597 3300005615 Bacteria 3390
94 Ga0068852_100226824 3300005616 Bacteria 1779
95 Ga0068859_100006967 3300005617 Bacteria 11474
96 Ga0068859_100125329 3300005617 Unclassified 2637
97 Ga0068866_10098160 3300005718 Bacteria 1610
98 Ga0068851_10001128 3300005834 Bacteria 11580
99 Ga0068870_10015292 3300005840 Bacteria 3638
100 Ga0068863_100046878 3300005841 Bacteria 4102
101 Ga0068863_100262657 3300005841 Bacteria 1669
102 Ga0068858_100005798 3300005842 Bacteria 12062
103 Ga0068860_100208146 3300005843 Unclassified 1897
104 Ga0068862_100010623 3300005844 Bacteria 7607
105 Ga0070717_10008672 3300006028 Bacteria 7605
106 Ga0070717_10015736 3300006028 Bacteria 5847
107 Ga0070717_10035914 3300006028 Bacteria 4017
108 Ga0070717_10095098 3300006028 Bacteria 2521
109 Ga0070717_10108947 3300006028 Unclassified 2360
110 Ga0070717_10239632 3300006028 Bacteria 1599
111 Ga0070715_10000870 3300006163 Bacteria 8338
112 Ga0070716_100003238 3300006173 Bacteria 7645
113 Ga0070716_100074322 3300006173 Bacteria 2008
114 Ga0070716_100142122 3300006173 Unclassified 1532
115 Ga0070712_100000163 3300006175 Bacteria 36018
116 Ga0070712_100001932 3300006175 Bacteria 12686
117 Ga0070712_100002973 3300006175 Bacteria 10491
118 Ga0070712_100008297 3300006175 Bacteria 6528
119 Ga0070712_100065963 3300006175 Bacteria 2571
120 Ga0097621_100000136 3300006237 Bacteria 43536
121 Ga0068871_100000845 3300006358 Bacteria 20520
122 Ga0068871_100071678 3300006358 Unclassified 2850
123 Ga0075433_10116258 3300006852 Bacteria 2373
124 Ga0075434_100000335 3300006871 Bacteria 33966
125 Ga0075434_100001404 3300006871 Bacteria 20234
126 Ga0075434_100211206 3300006871 Bacteria 1961
127 Ga0068865_100009917 3300006881 Bacteria 5919
128 Ga0068865_100133543 3300006881 Bacteria 1862
129 Ga0075436_100001842 3300006914 Bacteria 14541
130 Ga0075436_100031097 3300006914 Bacteria 3674
131 Ga0097620_100006967 3300006931 Bacteria 11474
132 Ga0097620_100125332 3300006931 Unclassified 2637
133 Ga0075435_100004130 3300007076 Bacteria 9964
134 Ga0075435_100080218 3300007076 Bacteria 2679
135 Ga0075435_100116401 3300007076 Bacteria 2227
136 Ga0075435_100197288 3300007076 Bacteria 1705
137 Ga0075435_100406630 3300007076 Bacteria 1171
138 Ga0099794_10005178 3300007265 Bacteria 5209
139 Ga0105240_10008527 3300009093 Bacteria 14646
140 Ga0105240_10018581 3300009093 Bacteria 9327
141 Ga0105240_10029032 3300009093 Bacteria 7214
142 Ga0105240_10230464 3300009093 Bacteria 2153
143 Ga0105240_10443543 3300009093 Bacteria 1454
144 Ga0105245_10040121 3300009098 Bacteria 4169
145 Ga0105245_10042725 3300009098 Unclassified 4043
146 Ga0105245_10230183 3300009098 Bacteria 1792
147 Ga0105247_10057216 3300009101 Bacteria 2410
148 Ga0114129_10115076 3300009147 Bacteria 3708
149 Ga0105243_10030858 3300009148 Unclassified 4130
150 Ga0105241_10025187 3300009174 Bacteria 4422
151 Ga0105241_10042537 3300009174 Bacteria 3438
152 Ga0105241_10047380 3300009174 Unclassified 3268
153 Ga0105241_10069077 3300009174 Bacteria 2739
154 Ga0105241_10080975 3300009174 Unclassified 2543
155 Ga0105242_10068927 3300009176 Bacteria 2928
156 Ga0105242_10117518 3300009176 Bacteria 2277
157 Ga0105242_10308527 3300009176 Bacteria 1447
158 Ga0105248_10086439 3300009177 Bacteria 3529
159 Ga0105248_10086466 3300009177 Unclassified 3528
160 Ga0105248_10112122 3300009177 Bacteria 3076
161 Ga0105237_10196180 3300009545 Unclassified 2019
162 Ga0105238_10000344 3300009551 Bacteria 50133
163 Ga0105238_10065114 3300009551 Bacteria 3645
164 Ga0105249_10003300 3300009553 Bacteria 13978
165 Ga0105239_10187992 3300010375 Unclassified 2312
166 Ga0105246_10112619 3300011119 Bacteria 2002
167 Ga0157373_10022817 3300013100 Bacteria 4539
168 Ga0157371_10032217 3300013102 Bacteria 3773
169 Ga0157370_10223207 3300013104 Bacteria 1745
170 Ga0157369_10000187 3300013105 Bacteria 85960
171 Ga0157369_10051927 3300013105 Unclassified 4436
172 Ga0157369_10111513 3300013105 Unclassified 2907
173 Ga0157369_10114568 3300013105 Bacteria 2863
174 Ga0157369_10342058 3300013105 Bacteria 1554
175 Ga0157369_10393294 3300013105 Bacteria 1438
176 Ga0157374_10000240 3300013296 Bacteria 50992
177 Ga0157374_10001799 3300013296 Bacteria 18040
178 Ga0157374_10008275 3300013296 Bacteria 8878
179 Ga0157374_10024540 3300013296 Bacteria 5407
180 Ga0157374_10106153 3300013296 Unclassified 2698
181 Ga0157378_10000604 3300013297 Bacteria 33691
182 Ga0157378_10042449 3300013297 Bacteria 4037
183 Ga0157378_10070910 3300013297 Bacteria 3129
184 Ga0163162_10003176 3300013306 Bacteria 15711
185 Ga0163162_10084827 3300013306 Bacteria 3244
186 Ga0157372_10000083 3300013307 Bacteria 99009
187 Ga0157372_10000359 3300013307 Bacteria 50182
188 Ga0157372_10120845 3300013307 Unclassified 3009
189 Ga0157372_10299468 3300013307 Bacteria 1871
190 Ga0157372_10310632 3300013307 Bacteria 1835
191 Ga0157372_10386897 3300013307 Bacteria 1630
192 Ga0163163_10031391 3300014325 Bacteria 5127
193 Ga0163163_10037455 3300014325 Bacteria 4718
194 Ga0182008_10002389 3300014497 Bacteria 11801
195 Ga0157379_10001497 3300014968 Bacteria 19233
196 Ga0157376_10068751 3300014969 Bacteria 3000
197 Ga0157376_10071125 3300014969 Bacteria 2955
198 Ga0157376_10162969 3300014969 Unclassified 2023
199 Ga0224572_1000803 3300024225 Bacteria 4162
200 Ga0224572_1007347 3300024225 Bacteria 2017
201 Ga0228598_1000001 3300024227 Bacteria 38540
202 Ga0228598_1000277 3300024227 Bacteria 9902
203 Ga0207692_10012265 3300025898 Bacteria 3676
204 Ga0207642_10011356 3300025899 Unclassified 3174
205 Ga0207642_10101607 3300025899 Bacteria 1445
206 Ga0207680_10015637 3300025903 Unclassified 3966
207 Ga0207647_10040695 3300025904 Unclassified 2926
208 Ga0207685_10019125 3300025905 Bacteria 2251
209 Ga0207699_10001036 3300025906 Bacteria 13109
210 Ga0207699_10025295 3300025906 Bacteria 3257
211 Ga0207684_10000859 3300025910 Bacteria 34855
212 Ga0207684_10001665 3300025910 Bacteria 23622
213 Ga0207684_10018341 3300025910 Bacteria 5991
214 Ga0207684_10087654 3300025910 Unclassified 2652
215 Ga0207684_10397779 3300025910 Bacteria 1184
216 Ga0207654_10011881 3300025911 Bacteria 4452
217 Ga0207654_10027044 3300025911 Bacteria 3114
218 Ga0207654_10029102 3300025911 Bacteria 3019
219 Ga0207707_10000573 3300025912 Bacteria 37371
220 Ga0207707_10001316 3300025912 Bacteria 23106
221 Ga0207707_10032513 3300025912 Bacteria 4566
222 Ga0207707_10097919 3300025912 Bacteria 2564
223 Ga0207707_10150818 3300025912 Bacteria 2032
224 Ga0207695_10008432 3300025913 Bacteria 12906
225 Ga0207695_10021320 3300025913 Bacteria 7398
226 Ga0207695_10190294 3300025913 Bacteria 1969
227 Ga0207671_10025322 3300025914 Unclassified 4457
228 Ga0207693_10000061 3300025915 Bacteria 92703
229 Ga0207693_10000066 3300025915 Bacteria 91088
230 Ga0207693_10003892 3300025915 Bacteria 12713
231 Ga0207693_10004093 3300025915 Bacteria 12394
232 Ga0207693_10006442 3300025915 Bacteria 9728
233 Ga0207693_10014186 3300025915 Bacteria 6414
234 Ga0207693_10057141 3300025915 Unclassified 3059
235 Ga0207693_10129235 3300025915 Bacteria 1986
236 Ga0207663_10012197 3300025916 Bacteria 4638
237 Ga0207663_10052455 3300025916 Bacteria 2544
238 Ga0207663_10105547 3300025916 Bacteria 1902
239 Ga0207660_10001401 3300025917 Bacteria 16195
240 Ga0207660_10115892 3300025917 Unclassified 2023
241 Ga0207660_10120328 3300025917 Unclassified 1988
242 Ga0207662_10041274 3300025918 Bacteria 2716
243 Ga0207657_10000343 3300025919 Bacteria 49280
244 Ga0207657_10002823 3300025919 Bacteria 18671
245 Ga0207649_10213317 3300025920 Bacteria 1371
246 Ga0207652_10001736 3300025921 Bacteria 19014
247 Ga0207652_10071956 3300025921 Bacteria 3006
248 Ga0207652_10100041 3300025921 Bacteria 2559
249 Ga0207652_10192373 3300025921 Bacteria 1835
250 Ga0207646_10001994 3300025922 Bacteria 24538
251 Ga0207646_10003219 3300025922 Bacteria 18638
252 Ga0207681_10019785 3300025923 Unclassified 4260
253 Ga0207694_10000178 3300025924 Bacteria 65835
254 Ga0207694_10048400 3300025924 Bacteria 3290
255 Ga0207694_10165269 3300025924 Unclassified 1789
256 Ga0207650_10008670 3300025925 Bacteria 6947
257 Ga0207687_10071585 3300025927 Bacteria 2478
258 Ga0207687_10353343 3300025927 Unclassified 1198
259 Ga0207700_10000201 3300025928 Bacteria 35738
260 Ga0207700_10001417 3300025928 Bacteria 13620
261 Ga0207700_10001934 3300025928 Bacteria 11790
262 Ga0207700_10032026 3300025928 Bacteria 3744
263 Ga0207700_10043350 3300025928 Bacteria 3304
264 Ga0207700_10142089 3300025928 Unclassified 1974
265 Ga0207700_10157996 3300025928 Bacteria 1880
266 Ga0207700_10197500 3300025928 Bacteria 1694
267 Ga0207700_10294038 3300025928 Unclassified 1401
268 Ga0207700_10444456 3300025928 Unclassified 1142
269 Ga0207664_10024869 3300025929 Bacteria 4503
270 Ga0207664_10045534 3300025929 Bacteria 3441
271 Ga0207664_10046189 3300025929 Bacteria 3418
272 Ga0207664_10346140 3300025929 Unclassified 1315
273 Ga0207690_10175864 3300025932 Bacteria 1607
274 Ga0207706_10008236 3300025933 Bacteria 9621
275 Ga0207706_10008891 3300025933 Bacteria 9247
276 Ga0207686_10191943 3300025934 Bacteria 1457
277 Ga0207709_10094890 3300025935 Bacteria 1959
278 Ga0207704_10012381 3300025938 Bacteria 4236
279 Ga0207704_10134423 3300025938 Bacteria 1719
280 Ga0207665_10001298 3300025939 Bacteria 16869
281 Ga0207665_10009979 3300025939 Bacteria 6233
282 Ga0207665_10123627 3300025939 Bacteria 1830
283 Ga0207665_10140989 3300025939 Bacteria 1719
284 Ga0207665_10346220 3300025939 Unclassified 1121
285 Ga0207711_10000528 3300025941 Bacteria 39213
286 Ga0207711_10072833 3300025941 Bacteria 2985
287 Ga0207689_10150380 3300025942 Unclassified 1919
288 Ga0207689_10207878 3300025942 Bacteria 1617
289 Ga0207661_10005546 3300025944 Bacteria 8905
290 Ga0207661_10117408 3300025944 Bacteria 2260
291 Ga0207679_10012201 3300025945 Bacteria 5597
292 Ga0207679_10032713 3300025945 Unclassified 3654
293 Ga0207679_10085068 3300025945 Bacteria 2428
294 Ga0207667_10000281 3300025949 Bacteria 70283
295 Ga0207667_10018616 3300025949 Bacteria 7783
296 Ga0207667_10090922 3300025949 Unclassified 3154
297 Ga0207712_10011777 3300025961 Bacteria 5577
298 Ga0207640_10005644 3300025981 Bacteria 6822
299 Ga0207677_10030850 3300026023 Unclassified 3427
300 Ga0207677_10048822 3300026023 Bacteria 2852
301 Ga0207703_10026887 3300026035 Bacteria 4531
302 Ga0207639_10119033 3300026041 Unclassified 2166
303 Ga0207639_10142898 3300026041 Unclassified 1996
304 Ga0207678_10000632 3300026067 Bacteria 32252
305 Ga0207702_10000436 3300026078 Bacteria 47578
306 Ga0207702_10000906 3300026078 Bacteria 30750
307 Ga0207702_10002110 3300026078 Bacteria 19148
308 Ga0207702_10009271 3300026078 Bacteria 8271
309 Ga0207641_10030053 3300026088 Bacteria 4498
310 Ga0207641_10341393 3300026088 Unclassified 1425
311 Ga0207648_10010570 3300026089 Bacteria 8734
312 Ga0207648_10082415 3300026089 Bacteria 2805
313 Ga0207674_10000916 3300026116 Bacteria 38450
314 Ga0207674_10002198 3300026116 Bacteria 24689
315 Ga0207674_10029341 3300026116 Bacteria 5791
316 Ga0207698_10094797 3300026142 Bacteria 2455
317 Ga0207698_10110736 3300026142 Bacteria 2300
318 Ga0209588_1040782 3300027671 Bacteria 1498
319 Ga0265356_1000707 3300028017 Bacteria 5703
320 Ga0268265_10005946 3300028380 Bacteria 8305
321 Ga0265338_10002211 3300028800 Bacteria 29688
322 Ga0265338_10003148 3300028800 Bacteria 23541
323 Ga0265338_10062971 3300028800 Unclassified 3238
324 Ga0265338_10126976 3300028800 Bacteria 2022
325 Ga0265760_10004067 3300031090 Bacteria 4216
326 Ga0265760_10006777 3300031090 Bacteria 3280
327 Ga0265760_10009627 3300031090 Bacteria 2760
328 Ga0265328_10020574 3300031239 Bacteria 2525
329 Ga0265339_10004659 3300031249 Bacteria 9316
330 Ga0265339_10008715 3300031249 Bacteria 6431
331 Ga0265316_10090549 3300031344 Bacteria 2334
332 Ga0265314_10040916 3300031711 Bacteria 3322
333 Ga0265342_10015020 3300031712 Bacteria 5113
334 Ga0373926_0015564 3300035083 Bacteria 2594
335 Ga0373934_0030982 3300035086 Bacteria 2093
336 Ga0373944_0046614 3300035089 Bacteria 1355
337 Ga0373923_0101555 3300035111 Bacteria 1269
338 Ga0373936_0013708 3300035113 Bacteria 3093
339 Ga0373936_0017374 3300035113 Bacteria 2769
340 Ga0373936_0037392 3300035113 Bacteria 1938
341 Ga0373945_0004650 3300035116 Bacteria 4373
342 Ga0373953_0041296 3300035117 Bacteria 1835
343 Ga0373960_0022835 3300035121 Unclassified 1680
344 Ga0373943_0043197 3300035170 Bacteria 2188
345 Ga0373955_0033394 3300035172 Bacteria 2710
346 Ga0373924_0000079 3300035410 Bacteria 25860
347 Ga0373931_0065905 3300035691 Bacteria 1964
348 Ga0373931_0094357 3300035691 Unclassified 1672
349 Ga0373935_0008163 3300035692 Bacteria 6275
350 Ga0373935_0017058 3300035692 Bacteria 4400
351 Ga0373935_0078567 3300035692 Bacteria 2141
352 Ga0373927_0016608 3300035695 Bacteria 4856
353 Ga0373927_0203083 3300035695 Bacteria 1301
354 Ga0373947_0009566 3300035725 Bacteria 5562
355 Ga0373947_0010115 3300035725 Bacteria 5415
356 Ga0373947_0011452 3300035725 Bacteria 5088
357 Ga0373937_0000827 3300036401 Bacteria 26530
358 Ga0373937_0134335 3300036401 Bacteria 2312
359 Ga0373937_0166476 3300036401 Bacteria 2067
360 Ga0373937_0189876 3300036401 Bacteria 1930
361 Ga0373937_0223379 3300036401 Bacteria 1773
362 Ga0373925_0009625 3300037068 Bacteria 7042
363 Ga0373925_0021654 3300037068 Bacteria 4685
364 Ga0373925_0048588 3300037068 Bacteria 3161
365 Ga0373925_0144919 3300037068 Bacteria 1861
366 Ga0373925_0164800 3300037068 Bacteria 1747
367 Ga0373925_0199501 3300037068 Bacteria 1591
368 Ga0436364_1177317 3300037853 Unclassified 2947
369 Ga0436365_1472387 3300039437 Bacteria 1507
370 Ga0436360_0450277 3300039438 Bacteria 1625
371 Ga0466963_0006463 3300044694 Bacteria 6933
372 Ga0453684_0303873 3300044712 Bacteria 1813
373 Ga0466967_0002540 3300045976 Bacteria 11429
374 Ga0495629_0002716 3300046459 Bacteria 13546
375 Ga0495580_0000012 3300046472 Bacteria 97735
376 Ga0495580_0000187 3300046472 Bacteria 46797
377 Ga0495580_0000624 3300046472 Bacteria 29941
378 Ga0495580_0001935 3300046472 Bacteria 18202
379 Ga0495580_0017540 3300046472 Bacteria 5352
380 Ga0495580_0021490 3300046472 Bacteria 4760
381 Ga0495582_0001194 3300046473 Bacteria 14631
382 Ga0495582_0006518 3300046473 Bacteria 6478
383 Ga0495582_0009826 3300046473 Bacteria 5268
384 Ga0495664_0136935 3300046477 Bacteria 1484
385 Ga0495628_0035645 3300046516 Bacteria 3997
386 Ga0495630_0013941 3300046517 Bacteria 5848
387 Ga0495630_0220827 3300046517 Bacteria 1447
388 Ga0495665_0011518 3300046531 Bacteria 4788
389 Ga0495665_0044675 3300046531 Bacteria 2353
390 Ga0495635_0256238 3300046663 Bacteria 1179
391 Ga0495623_0130680 3300046679 Unclassified 1504
392 Ga0495658_0157822 3300046683 Bacteria 1397
393 Ga0495613_0062060 3300046689 Unclassified 2736
394 Ga0495680_0151841 3300047322 Bacteria 1688
395 Ga0496102_0000680 3300048905 Bacteria 34024
396 Ga0496102_0007958 3300048905 Bacteria 9059
397 Ga0496102_0038575 3300048905 Bacteria 4312
398 Ga0496102_0082601 3300048905 Unclassified 2963
399 Ga0496103_0002368 3300048906 Bacteria 11886
400 Ga0496104_0022523 3300048907 Bacteria 5787
401 Ga0496104_0055766 3300048907 Bacteria 3736
402 Ga0496105_0002291 3300048908 Bacteria 13884
403 Ga0496105_0024034 3300048908 Bacteria 4950
404 Ga0496105_0036205 3300048908 Bacteria 4065
405 Ga0496105_0048838 3300048908 Bacteria 3493
406 Ga0496105_0088002 3300048908 Bacteria 2566
407 Ga0496105_0203841 3300048908 Bacteria 1614
408 Ga0496107_0057535 3300048910 Bacteria 2811
409 Ga0496107_0208202 3300048910 Unclassified 1454
410 Ga0496108_0003497 3300048911 Bacteria 12594
411 Ga0496109_0013233 3300048912 Bacteria 7144
412 Ga0496109_0068287 3300048912 Unclassified 3259
413 Ga0496109_0072870 3300048912 Bacteria 3156
414 Ga0496110_0001521 3300048913 Bacteria 16829
415 Ga0496110_0029060 3300048913 Bacteria 4753
416 Ga0496110_0054550 3300048913 Unclassified 3516
417 Ga0496110_0245632 3300048913 Unclassified 1629
418 Ga0496111_0000262 3300048914 Bacteria 25661
419 Ga0496111_0008842 3300048914 Bacteria 6691
420 Ga0496112_0000850 3300048915 Bacteria 21801
421 Ga0496112_0024473 3300048915 Bacteria 5782
422 Ga0496112_0027927 3300048915 Bacteria 5443
423 Ga0496113_0042259 3300048916 Bacteria 3367
424 Ga0496113_0087115 3300048916 Unclassified 2400
425 Ga0496115_0076575 3300048918 Unclassified 2719
426 nmdc:mga0n895_13036_c1 3300050512 Bacteria 7480
427 nmdc:mga0n895_757_c1 3300050512 Bacteria 22874
428 nmdc:mga0rr50_17948_c1 3300050513 Bacteria 4739
429 nmdc:mga0rr50_280549_c1 3300050513 Bacteria 1390
430 nmdc:mga0rr50_4369_c1 3300050513 Bacteria 8303
431 nmdc:mga08x19_3319_c1 3300050514 Bacteria 9623
432 nmdc:mga08x19_7338_c1 3300050514 Bacteria 6549
433 nmdc:mga0a205_2235_c1 3300050515 Bacteria 17048
434 nmdc:mga0a205_74343_c1 3300050515 Bacteria 3284
435 Ga0075433_10005391
436 Ga0065712_10076428
437 Ga0070658_10020573
438 Ga0070683_100030608
439 Ga0070683_100100816
440 Ga0070690_100032553
441 Ga0070670_100005675
442 Ga0068869_100015207
443 Ga0070666_10048448
444 Ga0070680_100004896
445 Ga0070682_100010558
446 Ga0070682_100164452
447 Ga0068868_100002898
448 Ga0068868_100027131
449 Ga0070689_100058582
450 Ga0070687_100051615
451 Ga0070661_100004572
452 Ga0070661_100211597
453 Ga0070668_100030105
454 Ga0070669_100074648
455 Ga0070659_100020283
456 Ga0070659_100111341
457 Ga0070709_10001402
458 Ga0070709_10008194
459 Ga0070714_100036370
460 Ga0070714_100239969
461 Ga0070714_100281034
462 Ga0070713_100000094
463 Ga0070713_100000488
464 Ga0070713_100017317
465 Ga0070713_100047984
466 Ga0070713_100052899
467 Ga0070713_100129742
468 Ga0070713_100139747
469 Ga0070713_100227884
470 Ga0070710_10000594
471 Ga0070710_10046238
472 Ga0070711_100001433
473 Ga0070711_100029561
474 Ga0070711_100066451
475 Ga0070711_100125648
476 Ga0070708_100001286
477 Ga0070708_100004377
478 Ga0070662_100007312
479 Ga0070681_10000105
480 Ga0070681_10001952
481 Ga0070681_10014021
482 Ga0070681_10030333
483 Ga0070681_10030895
484 Ga0070681_10043299
485 Ga0070681_10098899
486 Ga0068867_100039287
487 Ga0068867_100304844
488 Ga0070706_100000577
489 Ga0070706_100048603
490 Ga0070706_100061972
491 Ga0070706_100069069
492 Ga0070706_100103544
493 Ga0070707_100001900
494 Ga0070707_100012735
495 Ga0070707_100203455
496 Ga0070707_100289401
497 Ga0070698_100000749
498 Ga0070698_100008866
499 Ga0070698_100044891
500 Ga0070699_100004838
501 Ga0070699_100012336
502 Ga0070679_100002137
503 Ga0070679_100004614
504 Ga0070679_100036062
505 Ga0070684_100043348
506 Ga0070697_100039328
507 Ga0070697_100062206
508 Ga0068853_100025294
509 Ga0068853_100030308
510 Ga0068853_100316995
511 Ga0070686_100115394
512 Ga0070695_100131257
513 Ga0070696_100028509
514 Ga0068855_100000143
515 Ga0068855_100002068
516 Ga0068855_100114213
517 Ga0070664_100001793
518 Ga0070664_100039245
519 Ga0068857_100009909
520 Ga0068857_100016899
521 Ga0068854_100001681
522 Ga0068854_100007758
523 Ga0068856_100000072
524 Ga0068856_100000148
525 Ga0068856_100003575
526 Ga0068856_100130236
527 Ga0070702_100021597
528 Ga0068852_100226824
529 Ga0068859_100006967
530 Ga0068859_100125329
531 Ga0068866_10098160
532 Ga0068851_10001128
533 Ga0068870_10015292
534 Ga0068863_100046878
535 Ga0068863_100262657
536 Ga0068858_100005798
537 Ga0068860_100208146
538 Ga0068862_100010623
539 Ga0070717_10008672
540 Ga0070717_10015736
541 Ga0070717_10035914
542 Ga0070717_10095098
543 Ga0070717_10108947
544 Ga0070717_10239632
545 Ga0070715_10000870
546 Ga0070716_100003238
547 Ga0070716_100074322
548 Ga0070716_100142122
549 Ga0070712_100000163
550 Ga0070712_100001932
551 Ga0070712_100002973
552 Ga0070712_100008297
553 Ga0070712_100065963
554 Ga0097621_100000136
555 Ga0068871_100000845
556 Ga0068871_100071678
557 Ga0075433_10116258
558 Ga0075434_100000335
559 Ga0075434_100001404
560 Ga0075434_100211206
561 Ga0068865_100009917
562 Ga0068865_100133543
563 Ga0075436_100001842
564 Ga0075436_100031097
565 Ga0097620_100006967
566 Ga0097620_100125332
567 Ga0075435_100004130
568 Ga0075435_100080218
569 Ga0075435_100116401
570 Ga0075435_100197288
571 Ga0075435_100406630
572 Ga0099794_10005178
573 Ga0105240_10008527
574 Ga0105240_10018581
575 Ga0105240_10029032
576 Ga0105240_10230464
577 Ga0105240_10443543
578 Ga0105245_10040121
579 Ga0105245_10042725
580 Ga0105245_10230183
581 Ga0105247_10057216
582 Ga0114129_10115076
583 Ga0105243_10030858
584 Ga0105241_10025187
585 Ga0105241_10042537
586 Ga0105241_10047380
587 Ga0105241_10069077
588 Ga0105241_10080975
589 Ga0105242_10068927
590 Ga0105242_10117518
591 Ga0105242_10308527
592 Ga0105248_10086439
593 Ga0105248_10086466
594 Ga0105248_10112122
595 Ga0105237_10196180
596 Ga0105238_10000344
597 Ga0105238_10065114
598 Ga0105249_10003300
599 Ga0105239_10187992
600 Ga0105246_10112619
601 Ga0157373_10022817
602 Ga0157371_10032217
603 Ga0157370_10223207
604 Ga0157369_10000187
605 Ga0157369_10051927
606 Ga0157369_10111513
607 Ga0157369_10114568
608 Ga0157369_10342058
609 Ga0157369_10393294
610 Ga0157374_10000240
611 Ga0157374_10001799
612 Ga0157374_10008275
613 Ga0157374_10024540
614 Ga0157374_10106153
615 Ga0157378_10000604
616 Ga0157378_10042449
617 Ga0157378_10070910
618 Ga0163162_10003176
619 Ga0163162_10084827
620 Ga0157372_10000083
621 Ga0157372_10000359
622 Ga0157372_10120845
623 Ga0157372_10299468
624 Ga0157372_10310632
625 Ga0157372_10386897
626 Ga0163163_10031391
627 Ga0163163_10037455
628 Ga0182008_10002389
629 Ga0157379_10001497
630 Ga0157376_10068751
631 Ga0157376_10071125
632 Ga0157376_10162969
633 Ga0224572_1000803
634 Ga0224572_1007347
635 Ga0228598_1000001
636 Ga0228598_1000277
637 Ga0207692_10012265
638 Ga0207642_10011356
639 Ga0207642_10101607
640 Ga0207680_10015637
641 Ga0207647_10040695
642 Ga0207685_10019125
643 Ga0207699_10001036
644 Ga0207699_10025295
645 Ga0207684_10000859
646 Ga0207684_10001665
647 Ga0207684_10018341
648 Ga0207684_10087654
649 Ga0207684_10397779
650 Ga0207654_10011881
651 Ga0207654_10027044
652 Ga0207654_10029102
653 Ga0207707_10000573
654 Ga0207707_10001316
655 Ga0207707_10032513
656 Ga0207707_10097919
657 Ga0207707_10150818
658 Ga0207695_10008432
659 Ga0207695_10021320
660 Ga0207695_10190294
661 Ga0207671_10025322
662 Ga0207693_10000061
663 Ga0207693_10000066
664 Ga0207693_10003892
665 Ga0207693_10004093
666 Ga0207693_10006442
667 Ga0207693_10014186
668 Ga0207693_10057141
669 Ga0207693_10129235
670 Ga0207663_10012197
671 Ga0207663_10052455
672 Ga0207663_10105547
673 Ga0207660_10001401
674 Ga0207660_10115892
675 Ga0207660_10120328
676 Ga0207662_10041274
677 Ga0207657_10000343
678 Ga0207657_10002823
679 Ga0207649_10213317
680 Ga0207652_10001736
681 Ga0207652_10071956
682 Ga0207652_10100041
683 Ga0207652_10192373
684 Ga0207646_10001994
685 Ga0207646_10003219
686 Ga0207681_10019785
687 Ga0207694_10000178
688 Ga0207694_10048400
689 Ga0207694_10165269
690 Ga0207650_10008670
691 Ga0207687_10071585
692 Ga0207687_10353343
693 Ga0207700_10000201
694 Ga0207700_10001417
695 Ga0207700_10001934
696 Ga0207700_10032026
697 Ga0207700_10043350
698 Ga0207700_10142089
699 Ga0207700_10157996
700 Ga0207700_10197500
701 Ga0207700_10294038
702 Ga0207700_10444456
703 Ga0207664_10024869
704 Ga0207664_10045534
705 Ga0207664_10046189
706 Ga0207664_10346140
707 Ga0207690_10175864
708 Ga0207706_10008236
709 Ga0207706_10008891
710 Ga0207686_10191943
711 Ga0207709_10094890
712 Ga0207704_10012381
713 Ga0207704_10134423
714 Ga0207665_10001298
715 Ga0207665_10009979
716 Ga0207665_10123627
717 Ga0207665_10140989
718 Ga0207665_10346220
719 Ga0207711_10000528
720 Ga0207711_10072833
721 Ga0207689_10150380
722 Ga0207689_10207878
723 Ga0207661_10005546
724 Ga0207661_10117408
725 Ga0207679_10012201
726 Ga0207679_10032713
727 Ga0207679_10085068
728 Ga0207667_10000281
729 Ga0207667_10018616
730 Ga0207667_10090922
731 Ga0207712_10011777
732 Ga0207640_10005644
733 Ga0207677_10030850
734 Ga0207677_10048822
735 Ga0207703_10026887
736 Ga0207639_10119033
737 Ga0207639_10142898
738 Ga0207678_10000632
739 Ga0207702_10000436
740 Ga0207702_10000906
741 Ga0207702_10002110
742 Ga0207702_10009271
743 Ga0207641_10030053
744 Ga0207641_10341393
745 Ga0207648_10010570
746 Ga0207648_10082415
747 Ga0207674_10000916
748 Ga0207674_10002198
749 Ga0207674_10029341
750 Ga0207698_10094797
751 Ga0207698_10110736
752 Ga0209588_1040782
753 Ga0265356_1000707
754 Ga0268265_10005946
755 Ga0265338_10002211
756 Ga0265338_10003148
757 Ga0265338_10062971
758 Ga0265338_10126976
759 Ga0265760_10004067
760 Ga0265760_10006777
761 Ga0265760_10009627
762 Ga0265328_10020574
763 Ga0265339_10004659
764 Ga0265339_10008715
765 Ga0265316_10090549
766 Ga0265314_10040916
767 Ga0265342_10015020
768 Ga0373926_0015564
769 Ga0373934_0030982
770 Ga0373944_0046614
771 Ga0373923_0101555
772 Ga0373936_0013708
773 Ga0373936_0017374
774 Ga0373936_0037392
775 Ga0373945_0004650
776 Ga0373953_0041296
777 Ga0373960_0022835
778 Ga0373943_0043197
779 Ga0373955_0033394
780 Ga0373924_0000079
781 Ga0373931_0065905
782 Ga0373931_0094357
783 Ga0373935_0008163
784 Ga0373935_0017058
785 Ga0373935_0078567
786 Ga0373927_0016608
787 Ga0373927_0203083
788 Ga0373947_0009566
789 Ga0373947_0010115
790 Ga0373947_0011452
791 Ga0373937_0000827
792 Ga0373937_0134335
793 Ga0373937_0166476
794 Ga0373937_0189876
795 Ga0373937_0223379
796 Ga0373925_0009625
797 Ga0373925_0021654
798 Ga0373925_0048588
799 Ga0373925_0144919
800 Ga0373925_0164800
801 Ga0373925_0199501
802 Ga0436364_1177317
803 Ga0436365_1472387
804 Ga0436360_0450277
805 Ga0466963_0006463
806 Ga0453684_0303873
807 Ga0466967_0002540
808 Ga0495629_0002716
809 Ga0495580_0000012
810 Ga0495580_0000187
811 Ga0495580_0000624
812 Ga0495580_0001935
813 Ga0495580_0017540
814 Ga0495580_0021490
815 Ga0495582_0001194
816 Ga0495582_0006518
817 Ga0495582_0009826
818 Ga0495664_0136935
819 Ga0495628_0035645
820 Ga0495630_0013941
821 Ga0495630_0220827
822 Ga0495665_0011518
823 Ga0495665_0044675
824 Ga0495635_0256238
825 Ga0495623_0130680
826 Ga0495658_0157822
827 Ga0495613_0062060
828 Ga0495680_0151841
829 Ga0496102_0000680
830 Ga0496102_0007958
831 Ga0496102_0038575
832 Ga0496102_0082601
833 Ga0496103_0002368
834 Ga0496104_0022523
835 Ga0496104_0055766
836 Ga0496105_0002291
837 Ga0496105_0024034
838 Ga0496105_0036205
839 Ga0496105_0048838
840 Ga0496105_0088002
841 Ga0496105_0203841
842 Ga0496107_0057535
843 Ga0496107_0208202
844 Ga0496108_0003497
845 Ga0496109_0013233
846 Ga0496109_0068287
847 Ga0496109_0072870
848 Ga0496110_0001521
849 Ga0496110_0029060
850 Ga0496110_0054550
851 Ga0496110_0245632
852 Ga0496111_0000262
853 Ga0496111_0008842
854 Ga0496112_0000850
855 Ga0496112_0024473
856 Ga0496112_0027927
857 Ga0496113_0042259
858 Ga0496113_0087115
859 Ga0496115_0076575
860 nmdc:mga0n895_13036_c1
861 nmdc:mga0n895_757_c1
862 nmdc:mga0rr50_17948_c1
863 nmdc:mga0rr50_280549_c1
864 nmdc:mga0rr50_4369_c1
865 nmdc:mga08x19_3319_c1
866 nmdc:mga08x19_7338_c1
867 nmdc:mga0a205_2235_c1
868 nmdc:mga0a205_74343_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

145

307

0.99

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

6

137

0.86

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

154

310

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.8986 1 348
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.896 1 348
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.8906 3 348
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.888 3 348
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8751 5 348
ID Description Score Start End Superfamily
af_P11446_1_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8933 5 107 3.40.50.720
2g17A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8809 2 158 3.40.50.720
af_P11446_1_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8774 5 107 3.40.50.720
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8411 159 326 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8361 159 326 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2V9W3Y8-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9726 236 348
AF-A0A2V9W3Y8-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9642 236 348
AF-A0A7C3LUL4-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9523 245 348 GO:0003942
AF-A0A381VVK2-F1-model_v4 Uncharacterized protein 0.9477 246 348
AF-A0A7V7B3P0-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9465 239 348

Map