F443023

General Info

Members Datasets Scaffolds Average Seq Length
434 203 868 328

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100030576|Ga0070669_1000305764
Length 374
Sequence MTGPQRVLIAHAHVAYSPALSSHVHVGCITFDRHAQRVAKDEVMTKHALMTLLCLLAMIVLVPANAPAQTFKVEKFDIKGEGGTDYVTVESATGRVFVSRQTHMMVVDGSTGKVVGDIMNTPGVHGAGLATKYGHGFTTNSGDQTVTMFDLKTLAPIKQIKVGPGLDGIMFDEPDDKIILTNHSRPGTLTAIDPQSGDIVATVELEDAAPEGAAADGRGHIFVNNEGTNTIQVIDVKTWKATASWPLAPCEGPTGIAYDRATNRIFSGCSRTSVVVDAASGKVVASIPNGTRVDALGWDPATKLIYIPNGGDGTVTVAHQDSPDKYSVVATVPTFAGAKTITVDPKTHKAYLFQPERGPPQGPIVAAWFISITQ

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 5.07
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 23.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100030576 3300005353 Bacteria 3887
2 Ga0058863_11549018 3300004799 Bacteria 1257
3 Ga0065712_10019478 3300005290 Unclassified 2677
4 Ga0065712_10067948 3300005290 Bacteria 19699
5 Ga0065715_10156144 3300005293 Bacteria 1675
6 Ga0070658_10153651 3300005327 Unclassified 1928
7 Ga0070683_100001092 3300005329 Bacteria 20437
8 Ga0070683_100004934 3300005329 Bacteria 11064
9 Ga0070683_100128857 3300005329 Unclassified 2393
10 Ga0070683_100266204 3300005329 Bacteria 1630
11 Ga0070690_100154603 3300005330 Unclassified 1567
12 Ga0070690_100190499 3300005330 Bacteria 1422
13 Ga0070670_100004339 3300005331 Bacteria 11863
14 Ga0070670_100005683 3300005331 Bacteria 10533
15 Ga0070670_100025964 3300005331 Bacteria 5041
16 Ga0070670_100068122 3300005331 Bacteria 3055
17 Ga0068869_100016706 3300005334 Bacteria 4952
18 Ga0070666_10066169 3300005335 Unclassified 2452
19 Ga0070680_100001941 3300005336 Bacteria 15204
20 Ga0068868_100137284 3300005338 Bacteria 2005
21 Ga0070660_100004274 3300005339 Bacteria 9865
22 Ga0070660_100041303 3300005339 Unclassified 3515
23 Ga0070660_100211392 3300005339 Bacteria 1575
24 Ga0070689_100205975 3300005340 Unclassified 1608
25 Ga0070691_10004844 3300005341 Bacteria 6127
26 Ga0070687_100092914 3300005343 Unclassified 1673
27 Ga0070661_100044379 3300005344 Bacteria 3248
28 Ga0070661_100092793 3300005344 Bacteria 2237
29 Ga0070661_100226289 3300005344 Bacteria 1436
30 Ga0070669_100307983 3300005353 Bacteria 1276
31 Ga0070675_100020240 3300005354 Bacteria 5309
32 Ga0070675_100124286 3300005354 Unclassified 2194
33 Ga0070675_100168417 3300005354 Bacteria 1888
34 Ga0070675_100298578 3300005354 Bacteria 1419
35 Ga0070671_100033198 3300005355 Bacteria 4267
36 Ga0070671_100293189 3300005355 Bacteria 1384
37 Ga0070673_100028764 3300005364 Unclassified 4137
38 Ga0070673_100116733 3300005364 Bacteria 2220
39 Ga0070673_100138946 3300005364 Unclassified 2048
40 Ga0070688_100041771 3300005365 Bacteria 2817
41 Ga0070688_100147757 3300005365 Unclassified 1603
42 Ga0070659_100031553 3300005366 Unclassified 4104
43 Ga0070659_100042077 3300005366 Bacteria 3572
44 Ga0070659_100104331 3300005366 Unclassified 2284
45 Ga0070659_100377890 3300005366 Unclassified 1193
46 Ga0070714_100009653 3300005435 Bacteria 7598
47 Ga0070713_100002515 3300005436 Bacteria 11987
48 Ga0070713_100007644 3300005436 Bacteria 7607
49 Ga0070713_100029212 3300005436 Bacteria 4364
50 Ga0070662_100029709 3300005457 Bacteria 3817
51 Ga0070662_100036439 3300005457 Bacteria 3480
52 Ga0070662_100139822 3300005457 Bacteria 1875
53 Ga0070681_10002721 3300005458 Bacteria 16280
54 Ga0070681_10013581 3300005458 Bacteria 8102
55 Ga0070681_10374516 3300005458 Bacteria 1334
56 Ga0068867_100063579 3300005459 Bacteria 2743
57 Ga0070685_10085035 3300005466 Bacteria 1904
58 Ga0070685_10157032 3300005466 Unclassified 1446
59 Ga0070707_100037344 3300005468 Bacteria 4636
60 Ga0070707_100061387 3300005468 Unclassified 3605
61 Ga0070698_100222250 3300005471 Bacteria 1822
62 Ga0070699_100031748 3300005518 Unclassified 4560
63 Ga0070699_100069854 3300005518 Bacteria 3052
64 Ga0070679_100003989 3300005530 Bacteria 13588
65 Ga0070679_100027541 3300005530 Bacteria 5594
66 Ga0070679_100265413 3300005530 Unclassified 1672
67 Ga0070684_100000401 3300005535 Bacteria 29645
68 Ga0070684_100011104 3300005535 Bacteria 7166
69 Ga0070697_100041225 3300005536 Unclassified 3735
70 Ga0070697_100058663 3300005536 Bacteria 3133
71 Ga0070672_100020574 3300005543 Bacteria 4816
72 Ga0070672_100045292 3300005543 Unclassified 3401
73 Ga0070686_100050585 3300005544 Unclassified 2642
74 Ga0070686_100157685 3300005544 Unclassified 1595
75 Ga0070696_100229664 3300005546 Bacteria 1396
76 Ga0070665_100247748 3300005548 Unclassified 1782
77 Ga0070665_100249185 3300005548 Bacteria 1777
78 Ga0070704_100232478 3300005549 Bacteria 1505
79 Ga0068855_100019750 3300005563 Bacteria 8091
80 Ga0068855_100039926 3300005563 Bacteria 5571
81 Ga0068855_100277000 3300005563 Unclassified 1864
82 Ga0068855_100439482 3300005563 Bacteria 1425
83 Ga0070664_100001354 3300005564 Bacteria 19543
84 Ga0070664_100011951 3300005564 Bacteria 7049
85 Ga0070664_100040054 3300005564 Bacteria 3949
86 Ga0070664_100131098 3300005564 Bacteria 2202
87 Ga0070664_100183155 3300005564 Bacteria 1862
88 Ga0068857_100000083 3300005577 Bacteria 54933
89 Ga0068857_100016084 3300005577 Bacteria 6555
90 Ga0068857_100023059 3300005577 Bacteria 5474
91 Ga0068857_100306304 3300005577 Unclassified 1465
92 Ga0068854_100119321 3300005578 Bacteria 2000
93 Ga0068856_100012123 3300005614 Bacteria 8349
94 Ga0068856_100465934 3300005614 Bacteria 1284
95 Ga0070702_100091131 3300005615 Bacteria 1849
96 Ga0068852_100002631 3300005616 Bacteria 12407
97 Ga0068852_100112056 3300005616 Unclassified 2482
98 Ga0068852_100140383 3300005616 Bacteria 2235
99 Ga0068852_100166628 3300005616 Bacteria 2062
100 Ga0068859_100347254 3300005617 Unclassified 1578
101 Ga0068864_100019108 3300005618 Bacteria 5728
102 Ga0068864_100073806 3300005618 Unclassified 2975
103 Ga0068864_100244614 3300005618 Unclassified 1663
104 Ga0068858_100041346 3300005842 Bacteria 4275
105 Ga0068858_100042963 3300005842 Unclassified 4191
106 Ga0068860_100075384 3300005843 Unclassified 3208
107 Ga0068862_100193514 3300005844 Unclassified 1831
108 Ga0070717_10160986 3300006028 Bacteria 1947
109 Ga0070717_10469084 3300006028 Bacteria 1136
110 Ga0075364_10005539 3300006051 Bacteria 7351
111 Ga0075364_10039577 3300006051 Unclassified 3057
112 Ga0075362_10014111 3300006177 Bacteria 3218
113 Ga0075367_10085484 3300006178 Bacteria 1914
114 Ga0075367_10151240 3300006178 Unclassified 1440
115 Ga0075366_10016900 3300006195 Bacteria 4193
116 Ga0097621_100010209 3300006237 Bacteria 6857
117 Ga0097621_100082152 3300006237 Bacteria 2682
118 Ga0097621_100120340 3300006237 Unclassified 2226
119 Ga0097621_100319078 3300006237 Bacteria 1376
120 Ga0068871_100019085 3300006358 Bacteria 5228
121 Ga0075428_100001500 3300006844 Bacteria 24971
122 Ga0075428_100264220 3300006844 Bacteria 1853
123 Ga0075433_10001216 3300006852 Bacteria 18789
124 Ga0075433_10013477 3300006852 Bacteria 6647
125 Ga0075433_10058344 3300006852 Unclassified 3376
126 Ga0075434_100000392 3300006871 Bacteria 32043
127 Ga0075434_100007187 3300006871 Bacteria 10298
128 Ga0075434_100082026 3300006871 Bacteria 3222
129 Ga0075434_100190887 3300006871 Bacteria 2069
130 Ga0075434_100261057 3300006871 Unclassified 1751
131 Ga0075434_100391465 3300006871 Bacteria 1411
132 Ga0075429_100019459 3300006880 Bacteria 5881
133 Ga0075429_100066404 3300006880 Unclassified 3140
134 Ga0068865_100075015 3300006881 Bacteria 2410
135 Ga0075436_100037506 3300006914 Bacteria 3346
136 Ga0097620_100347258 3300006931 Unclassified 1578
137 Ga0075435_100014723 3300007076 Bacteria 5861
138 Ga0075435_100018605 3300007076 Bacteria 5290
139 Ga0075435_100067377 3300007076 Bacteria 2915
140 Ga0075435_100177719 3300007076 Bacteria 1798
141 Ga0075435_100194112 3300007076 Bacteria 1719
142 Ga0105240_10024437 3300009093 Bacteria 7961
143 Ga0105240_10038323 3300009093 Bacteria 6149
144 Ga0105240_10106602 3300009093 Bacteria 3398
145 Ga0105240_10413140 3300009093 Bacteria 1517
146 Ga0111539_10013700 3300009094 Bacteria 10129
147 Ga0111539_10216816 3300009094 Bacteria 2229
148 Ga0111539_10243111 3300009094 Bacteria 2095
149 Ga0105245_10000442 3300009098 Bacteria 38079
150 Ga0105245_10063025 3300009098 Bacteria 3347
151 Ga0105245_10137142 3300009098 Unclassified 2300
152 Ga0105245_10278835 3300009098 Bacteria 1633
153 Ga0105245_10428151 3300009098 Bacteria 1328
154 Ga0114129_10013157 3300009147 Bacteria 11791
155 Ga0114129_10015999 3300009147 Bacteria 10668
156 Ga0114129_10040514 3300009147 Bacteria 6566
157 Ga0114129_10154615 3300009147 Bacteria 3138
158 Ga0114129_10253459 3300009147 Unclassified 2361
159 Ga0114129_10448893 3300009147 Bacteria 1691
160 Ga0105243_10246679 3300009148 Bacteria 1592
161 Ga0105241_10004939 3300009174 Bacteria 9834
162 Ga0105241_10011322 3300009174 Bacteria 6539
163 Ga0105241_10150743 3300009174 Bacteria 1902
164 Ga0105241_10323812 3300009174 Unclassified 1330
165 Ga0105242_10036773 3300009176 Unclassified 3929
166 Ga0105242_10047539 3300009176 Bacteria 3484
167 Ga0105242_10184784 3300009176 Bacteria 1841
168 Ga0105248_10004943 3300009177 Bacteria 14721
169 Ga0105248_10005934 3300009177 Bacteria 13425
170 Ga0105248_10020724 3300009177 Bacteria 7283
171 Ga0105248_10059940 3300009177 Bacteria 4274
172 Ga0105248_10063987 3300009177 Bacteria 4129
173 Ga0105248_10069160 3300009177 Bacteria 3964
174 Ga0105248_10358700 3300009177 Unclassified 1641
175 Ga0105237_10003000 3300009545 Bacteria 20390
176 Ga0105237_10069235 3300009545 Unclassified 3524
177 Ga0105237_10208287 3300009545 Unclassified 1955
178 Ga0105237_10284779 3300009545 Bacteria 1655
179 Ga0105238_10004254 3300009551 Bacteria 14226
180 Ga0105238_10009457 3300009551 Bacteria 9756
181 Ga0105238_10230967 3300009551 Bacteria 1827
182 Ga0105239_10016569 3300010375 Bacteria 8146
183 Ga0105239_10040224 3300010375 Bacteria 5123
184 Ga0105246_10004013 3300011119 Bacteria 8936
185 Ga0157370_10008910 3300013104 Bacteria 10779
186 Ga0157370_10010469 3300013104 Bacteria 9767
187 Ga0157369_10010761 3300013105 Bacteria 10414
188 Ga0157374_10025229 3300013296 Bacteria 5334
189 Ga0157378_10046996 3300013297 Bacteria 3838
190 Ga0157378_10228059 3300013297 Bacteria 1773
191 Ga0163162_10043971 3300013306 Bacteria 4472
192 Ga0163162_10236510 3300013306 Unclassified 1957
193 Ga0157372_10004760 3300013307 Bacteria 14409
194 Ga0157372_10032654 3300013307 Bacteria 5709
195 Ga0157372_10091643 3300013307 Bacteria 3457
196 Ga0157372_10637247 3300013307 Unclassified 1241
197 Ga0157375_10015259 3300013308 Bacteria 6875
198 Ga0157375_10029348 3300013308 Bacteria 5171
199 Ga0157375_10134503 3300013308 Unclassified 2594
200 Ga0157375_10239149 3300013308 Bacteria 1975
201 Ga0157375_10413054 3300013308 Bacteria 1516
202 Ga0163163_10000003 3300014325 Bacteria 455102
203 Ga0163163_10000967 3300014325 Bacteria 24414
204 Ga0163163_10021237 3300014325 Bacteria 6123
205 Ga0163163_10123048 3300014325 Unclassified 2629
206 Ga0163163_10204126 3300014325 Bacteria 2025
207 Ga0163163_10210888 3300014325 Bacteria 1992
208 Ga0163163_10265425 3300014325 Unclassified 1768
209 Ga0157377_10041869 3300014745 Unclassified 2542
210 Ga0157379_10162595 3300014968 Bacteria 2015
211 Ga0157379_10386744 3300014968 Unclassified 1284
212 Ga0157376_10031769 3300014969 Unclassified 4233
213 Ga0157376_10076587 3300014969 Unclassified 2858
214 Ga0157376_10511470 3300014969 Bacteria 1182
215 Ga0163161_10017651 3300017792 Bacteria 4999
216 Ga0207697_10002359 3300025315 Bacteria 9836
217 Ga0207680_10062383 3300025903 Bacteria 2277
218 Ga0207680_10133078 3300025903 Bacteria 1641
219 Ga0207680_10181607 3300025903 Unclassified 1423
220 Ga0207654_10001867 3300025911 Bacteria 10906
221 Ga0207707_10000635 3300025912 Bacteria 34780
222 Ga0207707_10012357 3300025912 Bacteria 7421
223 Ga0207707_10180733 3300025912 Unclassified 1842
224 Ga0207707_10322414 3300025912 Bacteria 1334
225 Ga0207695_10001870 3300025913 Bacteria 32956
226 Ga0207695_10012893 3300025913 Bacteria 10003
227 Ga0207695_10204258 3300025913 Unclassified 1889
228 Ga0207671_10018616 3300025914 Bacteria 5321
229 Ga0207663_10036895 3300025916 Unclassified 2943
230 Ga0207660_10007814 3300025917 Bacteria 6921
231 Ga0207662_10061303 3300025918 Bacteria 2258
232 Ga0207662_10078640 3300025918 Unclassified 2008
233 Ga0207657_10053570 3300025919 Unclassified 3494
234 Ga0207657_10261624 3300025919 Bacteria 1377
235 Ga0207652_10007553 3300025921 Bacteria 8752
236 Ga0207652_10008592 3300025921 Bacteria 8218
237 Ga0207646_10073936 3300025922 Bacteria 3045
238 Ga0207646_10160687 3300025922 Bacteria 2027
239 Ga0207646_10216989 3300025922 Bacteria 1728
240 Ga0207646_10245448 3300025922 Bacteria 1617
241 Ga0207694_10002109 3300025924 Bacteria 16406
242 Ga0207694_10002548 3300025924 Bacteria 14793
243 Ga0207694_10054905 3300025924 Unclassified 3092
244 Ga0207694_10241175 3300025924 Bacteria 1477
245 Ga0207650_10001284 3300025925 Bacteria 18210
246 Ga0207650_10001775 3300025925 Bacteria 15259
247 Ga0207650_10012642 3300025925 Bacteria 5825
248 Ga0207650_10013843 3300025925 Bacteria 5594
249 Ga0207659_10036786 3300025926 Unclassified 3394
250 Ga0207687_10000967 3300025927 Bacteria 19513
251 Ga0207687_10089755 3300025927 Unclassified 2239
252 Ga0207687_10090685 3300025927 Bacteria 2228
253 Ga0207687_10280811 3300025927 Bacteria 1334
254 Ga0207700_10001539 3300025928 Bacteria 13063
255 Ga0207700_10013656 3300025928 Bacteria 5293
256 Ga0207700_10019961 3300025928 Bacteria 4539
257 Ga0207664_10007071 3300025929 Bacteria 7775
258 Ga0207644_10142609 3300025931 Bacteria 1846
259 Ga0207644_10206089 3300025931 Unclassified 1553
260 Ga0207690_10119948 3300025932 Bacteria 1909
261 Ga0207690_10239891 3300025932 Unclassified 1396
262 Ga0207706_10067838 3300025933 Bacteria 3139
263 Ga0207706_10094853 3300025933 Bacteria 2625
264 Ga0207706_10199413 3300025933 Bacteria 1755
265 Ga0207686_10023447 3300025934 Unclassified 3565
266 Ga0207709_10175546 3300025935 Unclassified 1508
267 Ga0207670_10030901 3300025936 Unclassified 3425
268 Ga0207670_10116272 3300025936 Unclassified 1936
269 Ga0207670_10116705 3300025936 Bacteria 1933
270 Ga0207670_10189348 3300025936 Bacteria 1556
271 Ga0207665_10164681 3300025939 Bacteria 1597
272 Ga0207691_10030170 3300025940 Bacteria 5068
273 Ga0207691_10032012 3300025940 Bacteria 4906
274 Ga0207711_10002964 3300025941 Bacteria 14832
275 Ga0207711_10014525 3300025941 Bacteria 6545
276 Ga0207711_10335992 3300025941 Bacteria 1398
277 Ga0207689_10007461 3300025942 Bacteria 9586
278 Ga0207661_10001003 3300025944 Bacteria 18642
279 Ga0207661_10050411 3300025944 Bacteria 3316
280 Ga0207679_10008404 3300025945 Bacteria 6577
281 Ga0207679_10024509 3300025945 Bacteria 4138
282 Ga0207679_10071135 3300025945 Bacteria 2623
283 Ga0207679_10092814 3300025945 Unclassified 2339
284 Ga0207667_10006553 3300025949 Bacteria 14084
285 Ga0207667_10235330 3300025949 Unclassified 1875
286 Ga0207667_10340731 3300025949 Bacteria 1530
287 Ga0207651_10080343 3300025960 Bacteria 2346
288 Ga0207712_10028756 3300025961 Unclassified 3721
289 Ga0207640_10115390 3300025981 Bacteria 1912
290 Ga0207677_10014439 3300026023 Bacteria 4613
291 Ga0207677_10104469 3300026023 Bacteria 2094
292 Ga0207703_10031381 3300026035 Bacteria 4201
293 Ga0207703_10036134 3300026035 Unclassified 3930
294 Ga0207639_10160177 3300026041 Unclassified 1895
295 Ga0207702_10005075 3300026078 Bacteria 11566
296 Ga0207702_10178924 3300026078 Bacteria 1951
297 Ga0207641_10160936 3300026088 Bacteria 2041
298 Ga0207641_10251861 3300026088 Bacteria 1650
299 Ga0207648_10023586 3300026089 Bacteria 5509
300 Ga0207648_10115749 3300026089 Bacteria 2356
301 Ga0207676_10018384 3300026095 Bacteria 5080
302 Ga0207676_10045282 3300026095 Bacteria 3399
303 Ga0207676_10506592 3300026095 Bacteria 1147
304 Ga0207674_10002313 3300026116 Bacteria 24141
305 Ga0207674_10004784 3300026116 Bacteria 16226
306 Ga0207674_10008498 3300026116 Bacteria 11854
307 Ga0207674_10393535 3300026116 Bacteria 1339
308 Ga0207698_10004972 3300026142 Bacteria 8150
309 Ga0207698_10040980 3300026142 Unclassified 3447
310 Ga0207698_10311883 3300026142 Unclassified 1469
311 Ga0265316_10018680 3300031344 Bacteria 5954
312 Ga0265316_10113947 3300031344 Unclassified 2045
313 Ga0265314_10000404 3300031711 Bacteria 58582
314 Ga0265314_10015274 3300031711 Bacteria 6097
315 Ga0265342_10014968 3300031712 Bacteria 5125
316 Ga0373928_0013462 3300035084 Bacteria 1643
317 Ga0373949_0045912 3300035090 Bacteria 1087
318 Ga0373923_0033300 3300035111 Bacteria 2086
319 Ga0373939_0023427 3300035114 Bacteria 1711
320 Ga0373941_0004876 3300035115 Bacteria 3128
321 Ga0373954_0000291 3300035118 Bacteria 18131
322 Ga0373954_0074854 3300035118 Bacteria 1612
323 Ga0373956_0137249 3300035119 Bacteria 1147
324 Ga0373955_0049496 3300035172 Bacteria 2282
325 Ga0373962_0004732 3300035242 Bacteria 3285
326 Ga0373931_0012831 3300035691 Bacteria 4068
327 Ga0373931_0304820 3300035691 Unclassified 985
328 Ga0373935_0157831 3300035692 Bacteria 1544
329 Ga0373935_0328208 3300035692 Bacteria 1087
330 Ga0373927_0092361 3300035695 Bacteria 1966
331 Ga0373933_0003388 3300035724 Bacteria 8888
332 Ga0373933_0144991 3300035724 Bacteria 1501
333 Ga0373947_0083647 3300035725 Bacteria 1979
334 Ga0373937_0027087 3300036401 Bacteria 5181
335 Ga0373937_0032805 3300036401 Bacteria 4712
336 Ga0373937_0058339 3300036401 Bacteria 3546
337 Ga0373937_0250563 3300036401 Bacteria 1670
338 Ga0373925_0205068 3300037068 Bacteria 1569
339 Ga0451576_0159791 3300045051 Unclassified 2351
340 Ga0495592_0036079 3300046454 Bacteria 3724
341 Ga0495592_0205715 3300046454 Unclassified 1325
342 Ga0495592_0228363 3300046454 Unclassified 1240
343 Ga0495603_0075564 3300046455 Bacteria 1978
344 Ga0495580_0065897 3300046472 Bacteria 2536
345 Ga0495580_0115099 3300046472 Bacteria 1868
346 Ga0495585_0077158 3300046492 Unclassified 1809
347 Ga0495594_0142874 3300046499 Bacteria 1358
348 Ga0495608_0004390 3300046511 Bacteria 10106
349 Ga0495628_0104059 3300046516 Unclassified 2188
350 Ga0495628_0118161 3300046516 Bacteria 2036
351 Ga0495630_0003496 3300046517 Bacteria 10918
352 Ga0495652_0109982 3300046529 Bacteria 2217
353 Ga0495652_0162002 3300046529 Bacteria 1736
354 Ga0495665_0071067 3300046531 Bacteria 1833
355 Ga0495621_0004109 3300046539 Bacteria 4056
356 Ga0495645_0028148 3300046543 Bacteria 4083
357 Ga0495633_0096785 3300046558 Bacteria 1371
358 Ga0495667_0002706 3300046559 Bacteria 11849
359 Ga0495667_0035356 3300046559 Bacteria 3339
360 Ga0495656_0098210 3300046615 Bacteria 1350
361 Ga0495657_0005272 3300046675 Bacteria 10229
362 Ga0495599_0051017 3300046678 Bacteria 2593
363 Ga0495599_0095717 3300046678 Bacteria 1852
364 Ga0495599_0160859 3300046678 Bacteria 1388
365 Ga0495646_0067273 3300046680 Bacteria 2118
366 Ga0495669_0002909 3300046684 Bacteria 7035
367 Ga0495670_0074107 3300046691 Bacteria 1726
368 Ga0495581_0105740 3300047315 Bacteria 1635
369 Ga0495674_0020899 3300047319 Bacteria 6060
370 Ga0495674_0071762 3300047319 Unclassified 2988
371 Ga0495675_0078143 3300047444 Bacteria 2084
372 Ga0495684_0000269 3300047471 Bacteria 41576
373 Ga0496101_0071786 3300048904 Unclassified 2539
374 Ga0496101_0212171 3300048904 Bacteria 1500
375 Ga0496102_0067177 3300048905 Unclassified 3288
376 Ga0496102_0299712 3300048905 Unclassified 1515
377 Ga0496104_0010783 3300048907 Bacteria 8174
378 Ga0496105_0181101 3300048908 Bacteria 1725
379 Ga0496106_0042601 3300048909 Bacteria 3404
380 Ga0496107_0149885 3300048910 Archaea 1725
381 Ga0496108_0029464 3300048911 Bacteria 4546
382 Ga0496108_0243283 3300048911 Unclassified 1565
383 Ga0496109_0000850 3300048912 Bacteria 25562
384 Ga0496109_0073358 3300048912 Unclassified 3145
385 Ga0496110_0009128 3300048913 Bacteria 8005
386 Ga0496110_0089307 3300048913 Bacteria 2754
387 Ga0496110_0110706 3300048913 Unclassified 2468
388 Ga0496111_0002110 3300048914 Bacteria 11868
389 Ga0496112_0001752 3300048915 Bacteria 17013
390 Ga0496112_0095066 3300048915 Bacteria 2951
391 Ga0496114_0000462 3300048917 Bacteria 29857
392 Ga0496114_0007438 3300048917 Bacteria 8659
393 Ga0496114_0253461 3300048917 Unclassified 1549
394 Ga0496114_0412244 3300048917 Unclassified 1196
395 Ga0501043_0091081 3300049579 Bacteria 2397
396 Ga0501073_0048110 3300049589 Bacteria 2994
397 nmdc:mga03683_6628_c1 3300050489 Unclassified 3976
398 nmdc:mga0k408_10068_c1 3300050493 Bacteria 5107
399 nmdc:mga06z11_5198_c1 3300050494 Bacteria 5200
400 nmdc:mga05p37_118479_c2 3300050507 Unclassified 2293
401 nmdc:mga05p37_17717_c1 3300050507 Bacteria 8594
402 nmdc:mga05p37_252048_c1 3300050507 Bacteria 2117
403 nmdc:mga05p37_366545_c1 3300050507 Bacteria 1692
404 nmdc:mga05p37_41355_c2 3300050507 Bacteria 3932
405 nmdc:mga05p37_4952_c1 3300050507 Bacteria 15605
406 nmdc:mga09592_131039_c1 3300050508 Bacteria 2157
407 nmdc:mga08y16_76364_c1 3300050511 Bacteria 3492
408 nmdc:mga0n895_13706_c1 3300050512 Bacteria 7328
409 nmdc:mga0n895_275294_c1 3300050512 Bacteria 1707
410 nmdc:mga0n895_388960_c1 3300050512 Bacteria 1411
411 nmdc:mga0n895_41554_c1 3300050512 Bacteria 4471
412 nmdc:mga0n895_419179_c1 3300050512 Bacteria 1353
413 nmdc:mga0n895_4208_c1 3300050512 Bacteria 11760
414 nmdc:mga0n895_633_c1 3300050512 Bacteria 24437
415 nmdc:mga0n895_66398_c1 3300050512 Unclassified 3572
416 nmdc:mga0rr50_15096_c1 3300050513 Bacteria 5090
417 nmdc:mga0rr50_169018_c1 3300050513 Unclassified 1780
418 nmdc:mga0rr50_17735_c1 3300050513 Unclassified 4761
419 nmdc:mga0rr50_1973_c1 3300050513 Bacteria 11392
420 nmdc:mga0rr50_44596_c1 3300050513 Unclassified 3253
421 nmdc:mga0rr50_506_c1 3300050513 Bacteria 20754
422 nmdc:mga0rr50_60218_c1 3300050513 Bacteria 2855
423 nmdc:mga0rr50_86156_c1 3300050513 Bacteria 2436
424 nmdc:mga0a205_25135_c1 3300050515 Bacteria 5671
425 nmdc:mga0a205_4373_c1 3300050515 Bacteria 12669
426 nmdc:mga0a205_58984_c1 3300050515 Unclassified 3707
427 Ga0495601_0003015 3300053077 Bacteria 9601
428 Ga0495601_0061495 3300053077 Bacteria 2384
429 Ga0495601_0082609 3300053077 Bacteria 2063
430 Ga0495601_0127702 3300053077 Bacteria 1655
431 Ga0495595_0073519 3300053084 Bacteria 1619
432 Ga0495619_0004488 3300053085 Bacteria 8912
433 Ga0495619_0014013 3300053085 Bacteria 5059
434 Ga0495619_0159576 3300053085 Bacteria 1557
435 Ga0070669_100030576
436 Ga0058863_11549018
437 Ga0065712_10019478
438 Ga0065712_10067948
439 Ga0065715_10156144
440 Ga0070658_10153651
441 Ga0070683_100001092
442 Ga0070683_100004934
443 Ga0070683_100128857
444 Ga0070683_100266204
445 Ga0070690_100154603
446 Ga0070690_100190499
447 Ga0070670_100004339
448 Ga0070670_100005683
449 Ga0070670_100025964
450 Ga0070670_100068122
451 Ga0068869_100016706
452 Ga0070666_10066169
453 Ga0070680_100001941
454 Ga0068868_100137284
455 Ga0070660_100004274
456 Ga0070660_100041303
457 Ga0070660_100211392
458 Ga0070689_100205975
459 Ga0070691_10004844
460 Ga0070687_100092914
461 Ga0070661_100044379
462 Ga0070661_100092793
463 Ga0070661_100226289
464 Ga0070669_100307983
465 Ga0070675_100020240
466 Ga0070675_100124286
467 Ga0070675_100168417
468 Ga0070675_100298578
469 Ga0070671_100033198
470 Ga0070671_100293189
471 Ga0070673_100028764
472 Ga0070673_100116733
473 Ga0070673_100138946
474 Ga0070688_100041771
475 Ga0070688_100147757
476 Ga0070659_100031553
477 Ga0070659_100042077
478 Ga0070659_100104331
479 Ga0070659_100377890
480 Ga0070714_100009653
481 Ga0070713_100002515
482 Ga0070713_100007644
483 Ga0070713_100029212
484 Ga0070662_100029709
485 Ga0070662_100036439
486 Ga0070662_100139822
487 Ga0070681_10002721
488 Ga0070681_10013581
489 Ga0070681_10374516
490 Ga0068867_100063579
491 Ga0070685_10085035
492 Ga0070685_10157032
493 Ga0070707_100037344
494 Ga0070707_100061387
495 Ga0070698_100222250
496 Ga0070699_100031748
497 Ga0070699_100069854
498 Ga0070679_100003989
499 Ga0070679_100027541
500 Ga0070679_100265413
501 Ga0070684_100000401
502 Ga0070684_100011104
503 Ga0070697_100041225
504 Ga0070697_100058663
505 Ga0070672_100020574
506 Ga0070672_100045292
507 Ga0070686_100050585
508 Ga0070686_100157685
509 Ga0070696_100229664
510 Ga0070665_100247748
511 Ga0070665_100249185
512 Ga0070704_100232478
513 Ga0068855_100019750
514 Ga0068855_100039926
515 Ga0068855_100277000
516 Ga0068855_100439482
517 Ga0070664_100001354
518 Ga0070664_100011951
519 Ga0070664_100040054
520 Ga0070664_100131098
521 Ga0070664_100183155
522 Ga0068857_100000083
523 Ga0068857_100016084
524 Ga0068857_100023059
525 Ga0068857_100306304
526 Ga0068854_100119321
527 Ga0068856_100012123
528 Ga0068856_100465934
529 Ga0070702_100091131
530 Ga0068852_100002631
531 Ga0068852_100112056
532 Ga0068852_100140383
533 Ga0068852_100166628
534 Ga0068859_100347254
535 Ga0068864_100019108
536 Ga0068864_100073806
537 Ga0068864_100244614
538 Ga0068858_100041346
539 Ga0068858_100042963
540 Ga0068860_100075384
541 Ga0068862_100193514
542 Ga0070717_10160986
543 Ga0070717_10469084
544 Ga0075364_10005539
545 Ga0075364_10039577
546 Ga0075362_10014111
547 Ga0075367_10085484
548 Ga0075367_10151240
549 Ga0075366_10016900
550 Ga0097621_100010209
551 Ga0097621_100082152
552 Ga0097621_100120340
553 Ga0097621_100319078
554 Ga0068871_100019085
555 Ga0075428_100001500
556 Ga0075428_100264220
557 Ga0075433_10001216
558 Ga0075433_10013477
559 Ga0075433_10058344
560 Ga0075434_100000392
561 Ga0075434_100007187
562 Ga0075434_100082026
563 Ga0075434_100190887
564 Ga0075434_100261057
565 Ga0075434_100391465
566 Ga0075429_100019459
567 Ga0075429_100066404
568 Ga0068865_100075015
569 Ga0075436_100037506
570 Ga0097620_100347258
571 Ga0075435_100014723
572 Ga0075435_100018605
573 Ga0075435_100067377
574 Ga0075435_100177719
575 Ga0075435_100194112
576 Ga0105240_10024437
577 Ga0105240_10038323
578 Ga0105240_10106602
579 Ga0105240_10413140
580 Ga0111539_10013700
581 Ga0111539_10216816
582 Ga0111539_10243111
583 Ga0105245_10000442
584 Ga0105245_10063025
585 Ga0105245_10137142
586 Ga0105245_10278835
587 Ga0105245_10428151
588 Ga0114129_10013157
589 Ga0114129_10015999
590 Ga0114129_10040514
591 Ga0114129_10154615
592 Ga0114129_10253459
593 Ga0114129_10448893
594 Ga0105243_10246679
595 Ga0105241_10004939
596 Ga0105241_10011322
597 Ga0105241_10150743
598 Ga0105241_10323812
599 Ga0105242_10036773
600 Ga0105242_10047539
601 Ga0105242_10184784
602 Ga0105248_10004943
603 Ga0105248_10005934
604 Ga0105248_10020724
605 Ga0105248_10059940
606 Ga0105248_10063987
607 Ga0105248_10069160
608 Ga0105248_10358700
609 Ga0105237_10003000
610 Ga0105237_10069235
611 Ga0105237_10208287
612 Ga0105237_10284779
613 Ga0105238_10004254
614 Ga0105238_10009457
615 Ga0105238_10230967
616 Ga0105239_10016569
617 Ga0105239_10040224
618 Ga0105246_10004013
619 Ga0157370_10008910
620 Ga0157370_10010469
621 Ga0157369_10010761
622 Ga0157374_10025229
623 Ga0157378_10046996
624 Ga0157378_10228059
625 Ga0163162_10043971
626 Ga0163162_10236510
627 Ga0157372_10004760
628 Ga0157372_10032654
629 Ga0157372_10091643
630 Ga0157372_10637247
631 Ga0157375_10015259
632 Ga0157375_10029348
633 Ga0157375_10134503
634 Ga0157375_10239149
635 Ga0157375_10413054
636 Ga0163163_10000003
637 Ga0163163_10000967
638 Ga0163163_10021237
639 Ga0163163_10123048
640 Ga0163163_10204126
641 Ga0163163_10210888
642 Ga0163163_10265425
643 Ga0157377_10041869
644 Ga0157379_10162595
645 Ga0157379_10386744
646 Ga0157376_10031769
647 Ga0157376_10076587
648 Ga0157376_10511470
649 Ga0163161_10017651
650 Ga0207697_10002359
651 Ga0207680_10062383
652 Ga0207680_10133078
653 Ga0207680_10181607
654 Ga0207654_10001867
655 Ga0207707_10000635
656 Ga0207707_10012357
657 Ga0207707_10180733
658 Ga0207707_10322414
659 Ga0207695_10001870
660 Ga0207695_10012893
661 Ga0207695_10204258
662 Ga0207671_10018616
663 Ga0207663_10036895
664 Ga0207660_10007814
665 Ga0207662_10061303
666 Ga0207662_10078640
667 Ga0207657_10053570
668 Ga0207657_10261624
669 Ga0207652_10007553
670 Ga0207652_10008592
671 Ga0207646_10073936
672 Ga0207646_10160687
673 Ga0207646_10216989
674 Ga0207646_10245448
675 Ga0207694_10002109
676 Ga0207694_10002548
677 Ga0207694_10054905
678 Ga0207694_10241175
679 Ga0207650_10001284
680 Ga0207650_10001775
681 Ga0207650_10012642
682 Ga0207650_10013843
683 Ga0207659_10036786
684 Ga0207687_10000967
685 Ga0207687_10089755
686 Ga0207687_10090685
687 Ga0207687_10280811
688 Ga0207700_10001539
689 Ga0207700_10013656
690 Ga0207700_10019961
691 Ga0207664_10007071
692 Ga0207644_10142609
693 Ga0207644_10206089
694 Ga0207690_10119948
695 Ga0207690_10239891
696 Ga0207706_10067838
697 Ga0207706_10094853
698 Ga0207706_10199413
699 Ga0207686_10023447
700 Ga0207709_10175546
701 Ga0207670_10030901
702 Ga0207670_10116272
703 Ga0207670_10116705
704 Ga0207670_10189348
705 Ga0207665_10164681
706 Ga0207691_10030170
707 Ga0207691_10032012
708 Ga0207711_10002964
709 Ga0207711_10014525
710 Ga0207711_10335992
711 Ga0207689_10007461
712 Ga0207661_10001003
713 Ga0207661_10050411
714 Ga0207679_10008404
715 Ga0207679_10024509
716 Ga0207679_10071135
717 Ga0207679_10092814
718 Ga0207667_10006553
719 Ga0207667_10235330
720 Ga0207667_10340731
721 Ga0207651_10080343
722 Ga0207712_10028756
723 Ga0207640_10115390
724 Ga0207677_10014439
725 Ga0207677_10104469
726 Ga0207703_10031381
727 Ga0207703_10036134
728 Ga0207639_10160177
729 Ga0207702_10005075
730 Ga0207702_10178924
731 Ga0207641_10160936
732 Ga0207641_10251861
733 Ga0207648_10023586
734 Ga0207648_10115749
735 Ga0207676_10018384
736 Ga0207676_10045282
737 Ga0207676_10506592
738 Ga0207674_10002313
739 Ga0207674_10004784
740 Ga0207674_10008498
741 Ga0207674_10393535
742 Ga0207698_10004972
743 Ga0207698_10040980
744 Ga0207698_10311883
745 Ga0265316_10018680
746 Ga0265316_10113947
747 Ga0265314_10000404
748 Ga0265314_10015274
749 Ga0265342_10014968
750 Ga0373928_0013462
751 Ga0373949_0045912
752 Ga0373923_0033300
753 Ga0373939_0023427
754 Ga0373941_0004876
755 Ga0373954_0000291
756 Ga0373954_0074854
757 Ga0373956_0137249
758 Ga0373955_0049496
759 Ga0373962_0004732
760 Ga0373931_0012831
761 Ga0373931_0304820
762 Ga0373935_0157831
763 Ga0373935_0328208
764 Ga0373927_0092361
765 Ga0373933_0003388
766 Ga0373933_0144991
767 Ga0373947_0083647
768 Ga0373937_0027087
769 Ga0373937_0032805
770 Ga0373937_0058339
771 Ga0373937_0250563
772 Ga0373925_0205068
773 Ga0451576_0159791
774 Ga0495592_0036079
775 Ga0495592_0205715
776 Ga0495592_0228363
777 Ga0495603_0075564
778 Ga0495580_0065897
779 Ga0495580_0115099
780 Ga0495585_0077158
781 Ga0495594_0142874
782 Ga0495608_0004390
783 Ga0495628_0104059
784 Ga0495628_0118161
785 Ga0495630_0003496
786 Ga0495652_0109982
787 Ga0495652_0162002
788 Ga0495665_0071067
789 Ga0495621_0004109
790 Ga0495645_0028148
791 Ga0495633_0096785
792 Ga0495667_0002706
793 Ga0495667_0035356
794 Ga0495656_0098210
795 Ga0495657_0005272
796 Ga0495599_0051017
797 Ga0495599_0095717
798 Ga0495599_0160859
799 Ga0495646_0067273
800 Ga0495669_0002909
801 Ga0495670_0074107
802 Ga0495581_0105740
803 Ga0495674_0020899
804 Ga0495674_0071762
805 Ga0495675_0078143
806 Ga0495684_0000269
807 Ga0496101_0071786
808 Ga0496101_0212171
809 Ga0496102_0067177
810 Ga0496102_0299712
811 Ga0496104_0010783
812 Ga0496105_0181101
813 Ga0496106_0042601
814 Ga0496107_0149885
815 Ga0496108_0029464
816 Ga0496108_0243283
817 Ga0496109_0000850
818 Ga0496109_0073358
819 Ga0496110_0009128
820 Ga0496110_0089307
821 Ga0496110_0110706
822 Ga0496111_0002110
823 Ga0496112_0001752
824 Ga0496112_0095066
825 Ga0496114_0000462
826 Ga0496114_0007438
827 Ga0496114_0253461
828 Ga0496114_0412244
829 Ga0501043_0091081
830 Ga0501073_0048110
831 nmdc:mga03683_6628_c1
832 nmdc:mga0k408_10068_c1
833 nmdc:mga06z11_5198_c1
834 nmdc:mga05p37_118479_c2
835 nmdc:mga05p37_17717_c1
836 nmdc:mga05p37_252048_c1
837 nmdc:mga05p37_366545_c1
838 nmdc:mga05p37_41355_c2
839 nmdc:mga05p37_4952_c1
840 nmdc:mga09592_131039_c1
841 nmdc:mga08y16_76364_c1
842 nmdc:mga0n895_13706_c1
843 nmdc:mga0n895_275294_c1
844 nmdc:mga0n895_388960_c1
845 nmdc:mga0n895_41554_c1
846 nmdc:mga0n895_419179_c1
847 nmdc:mga0n895_4208_c1
848 nmdc:mga0n895_633_c1
849 nmdc:mga0n895_66398_c1
850 nmdc:mga0rr50_15096_c1
851 nmdc:mga0rr50_169018_c1
852 nmdc:mga0rr50_17735_c1
853 nmdc:mga0rr50_1973_c1
854 nmdc:mga0rr50_44596_c1
855 nmdc:mga0rr50_506_c1
856 nmdc:mga0rr50_60218_c1
857 nmdc:mga0rr50_86156_c1
858 nmdc:mga0a205_25135_c1
859 nmdc:mga0a205_4373_c1
860 nmdc:mga0a205_58984_c1
861 Ga0495601_0003015
862 Ga0495601_0061495
863 Ga0495601_0082609
864 Ga0495601_0127702
865 Ga0495595_0073519
866 Ga0495619_0004488
867 Ga0495619_0014013
868 Ga0495619_0159576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yzv-assembly1.cif.gz_B biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.874 30 329
7axx-assembly1.cif.gz_A structure of wdr5:cs-vip8 crystal after illumination at 405 nm and room temperature 0.872 27 332
5m89-assembly1.cif.gz_A spliceosome component 0.8698 23 332
2co0-assembly2.cif.gz_C wdr5 and unmodified histone h3 complex at 2.25 angstrom 0.8684 27 332
6u6w-assembly1.cif.gz_A discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the wdr5:myc protein-protein interaction 0.8667 27 332
ID Description Score Start End Superfamily
af_Q9Y0T2_1042_1160_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8921 133 238 2.130.10.10
af_I1JGD6_255_439_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8907 81 242 2.130.10.10
af_B3DM89_109_306_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.883 92 248 2.130.10.10
af_A0A1D6JNW9_551_722_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.882 81 228 2.130.10.10
af_Q7ZW33_33_230_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8787 81 269 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V7KLR9-F1-model_v4 Uncharacterized protein 0.9524 246 333
AF-A0A2V9LLH6-F1-model_v4 YncE family protein 0.9445 81 332
AF-A0A2V7YH87-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9435 147 333
AF-A0A2V5U9K7-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.935 97 333
AF-A0A1A2ZFA2-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9313 39 311 GO:0016020

Map