F443016

General Info

Members Datasets Scaffolds Average Seq Length
434 200 434 66

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100006802|Ga0070682_1000068025
Length 71
Sequence MRAGYPPAMSEPTLPIDAARGDARHRDVRAEVFAAVPQARASIGKRAFWRIVLFVARFPAGLRLLRRLRGS

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.76
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10107760 3300002244 Unclassified 543
2 Ga0070676_10056153 3300005328 Unclassified 2326
3 Ga0070676_10794852 3300005328 Unclassified 698
4 Ga0070690_100009236 3300005330 Bacteria 5707
5 Ga0070690_100094505 3300005330 Bacteria 1973
6 Ga0070670_100086323 3300005331 Unclassified 2696
7 Ga0070670_101752739 3300005331 Unclassified 572
8 Ga0070677_10009641 3300005333 Unclassified 3280
9 Ga0070677_10032506 3300005333 Unclassified 2002
10 Ga0070677_10392143 3300005333 Bacteria 730
11 Ga0068869_100034768 3300005334 Bacteria 3567
12 Ga0068869_100111239 3300005334 Bacteria 2084
13 Ga0068869_102062318 3300005334 Unclassified 512
14 Ga0070666_10779823 3300005335 Bacteria 703
15 Ga0070682_100006802 3300005337 Bacteria 6419
16 Ga0070682_100227308 3300005337 Bacteria 1332
17 Ga0070682_100312913 3300005337 Unclassified 1157
18 Ga0068868_100358265 3300005338 Bacteria 1251
19 Ga0068868_101096909 3300005338 Unclassified 732
20 Ga0070660_101512734 3300005339 Unclassified 571
21 Ga0070689_100089499 3300005340 Bacteria 2424
22 Ga0070689_100213402 3300005340 Bacteria 1581
23 Ga0070689_100598271 3300005340 Unclassified 955
24 Ga0070689_100680627 3300005340 Unclassified 897
25 Ga0070691_10410146 3300005341 Unclassified 765
26 Ga0070687_100111513 3300005343 Bacteria 1549
27 Ga0070687_100244044 3300005343 Unclassified 1112
28 Ga0070687_100987976 3300005343 Bacteria 609
29 Ga0070687_101055934 3300005343 Bacteria 592
30 Ga0070687_101221842 3300005343 Unclassified 555
31 Ga0070692_10046828 3300005345 Bacteria 2236
32 Ga0070692_10062762 3300005345 Bacteria 1961
33 Ga0070692_10456054 3300005345 Bacteria 819
34 Ga0070668_100374676 3300005347 Bacteria 1210
35 Ga0070668_100667470 3300005347 Unclassified 914
36 Ga0070669_100148945 3300005353 Bacteria 1810
37 Ga0070669_100751977 3300005353 Unclassified 826
38 Ga0070669_101089165 3300005353 Unclassified 688
39 Ga0070669_101177286 3300005353 Unclassified 662
40 Ga0070675_100010804 3300005354 Bacteria 7139
41 Ga0070675_100074200 3300005354 Bacteria 2825
42 Ga0070675_100184823 3300005354 Bacteria 1803
43 Ga0070675_101784236 3300005354 Unclassified 568
44 Ga0070674_100044274 3300005356 Unclassified 3034
45 Ga0070674_100076457 3300005356 Unclassified 2380
46 Ga0070674_100222831 3300005356 Bacteria 1468
47 Ga0070674_100766130 3300005356 Unclassified 830
48 Ga0070673_100091123 3300005364 Unclassified 2492
49 Ga0070673_100115329 3300005364 Unclassified 2233
50 Ga0070673_100300960 3300005364 Bacteria 1412
51 Ga0070673_101060135 3300005364 Bacteria 756
52 Ga0070659_100518139 3300005366 Bacteria 1018
53 Ga0070659_100858204 3300005366 Unclassified 792
54 Ga0070667_100496008 3300005367 Bacteria 1119
55 Ga0070667_102291174 3300005367 Unclassified 509
56 Ga0070703_10472169 3300005406 Bacteria 559
57 Ga0070701_10006786 3300005438 Bacteria 4839
58 Ga0070701_10055731 3300005438 Bacteria 2066
59 Ga0070701_10168452 3300005438 Bacteria 1274
60 Ga0070701_11175980 3300005438 Bacteria 543
61 Ga0070705_100136300 3300005440 Bacteria 1609
62 Ga0070700_100083518 3300005441 Unclassified 2068
63 Ga0070700_100257811 3300005441 Bacteria 1254
64 Ga0070700_100262781 3300005441 Bacteria 1244
65 Ga0070700_100293390 3300005441 Bacteria 1184
66 Ga0070700_100431814 3300005441 Bacteria 998
67 Ga0070694_100009113 3300005444 Bacteria 6086
68 Ga0070694_100299742 3300005444 Unclassified 1231
69 Ga0070708_100986361 3300005445 Bacteria 790
70 Ga0070663_101987196 3300005455 Unclassified 523
71 Ga0070678_100011503 3300005456 Bacteria 5464
72 Ga0070678_100034322 3300005456 Bacteria 3531
73 Ga0070678_100478545 3300005456 Unclassified 1095
74 Ga0070662_100258705 3300005457 Bacteria 1402
75 Ga0070662_100682439 3300005457 Bacteria 868
76 Ga0068867_100075694 3300005459 Bacteria 2525
77 Ga0068867_100114093 3300005459 Bacteria 2080
78 Ga0068867_100284958 3300005459 Bacteria 1356
79 Ga0068867_100374805 3300005459 Bacteria 1194
80 Ga0070685_10154512 3300005466 Bacteria 1457
81 Ga0070685_10271480 3300005466 Bacteria 1132
82 Ga0070685_11074066 3300005466 Bacteria 607
83 Ga0070672_100004220 3300005543 Bacteria 9396
84 Ga0070672_100026026 3300005543 Bacteria 4347
85 Ga0070672_100084373 3300005543 Bacteria 2551
86 Ga0070672_100160755 3300005543 Unclassified 1863
87 Ga0070672_100422341 3300005543 Unclassified 1145
88 Ga0070686_100078752 3300005544 Bacteria 2177
89 Ga0070686_100129588 3300005544 Bacteria 1742
90 Ga0070686_100277972 3300005544 Bacteria 1234
91 Ga0070686_100769104 3300005544 Bacteria 774
92 Ga0070695_100286699 3300005545 Bacteria 1212
93 Ga0070696_100165412 3300005546 Bacteria 1632
94 Ga0070693_100028368 3300005547 Bacteria 3043
95 Ga0070693_101438515 3300005547 Unclassified 537
96 Ga0070665_100005029 3300005548 Bacteria 13711
97 Ga0070665_100508613 3300005548 Unclassified 1216
98 Ga0070665_101810726 3300005548 Bacteria 617
99 Ga0070665_102226930 3300005548 Unclassified 552
100 Ga0070704_100099199 3300005549 Unclassified 2190
101 Ga0070704_100317399 3300005549 Bacteria 1304
102 Ga0068855_101864896 3300005563 Bacteria 610
103 Ga0070664_100093483 3300005564 Bacteria 2605
104 Ga0070664_100426168 3300005564 Bacteria 1216
105 Ga0068857_100136847 3300005577 Bacteria 2212
106 Ga0068854_101513677 3300005578 Bacteria 609
107 Ga0070702_100219612 3300005615 Bacteria 1270
108 Ga0070702_100380705 3300005615 Bacteria 1003
109 Ga0070702_101607676 3300005615 Bacteria 538
110 Ga0068852_101427902 3300005616 Unclassified 714
111 Ga0068859_100124036 3300005617 Bacteria 2651
112 Ga0068859_100159276 3300005617 Bacteria 2336
113 Ga0068859_100504587 3300005617 Bacteria 1305
114 Ga0068859_100825640 3300005617 Bacteria 1014
115 Ga0068859_101386337 3300005617 Bacteria 775
116 Ga0068864_100067144 3300005618 Bacteria 3114
117 Ga0068864_100099598 3300005618 Bacteria 2575
118 Ga0068864_100265221 3300005618 Unclassified 1599
119 Ga0068864_101950674 3300005618 Unclassified 593
120 Ga0068866_10186458 3300005718 Bacteria 1229
121 Ga0068866_10965230 3300005718 Bacteria 603
122 Ga0068861_100005053 3300005719 Bacteria 8898
123 Ga0068861_100027211 3300005719 Bacteria 4163
124 Ga0068861_100065579 3300005719 Bacteria 2797
125 Ga0068861_100075642 3300005719 Bacteria 2622
126 Ga0068861_100471866 3300005719 Unclassified 1129
127 Ga0068861_100818975 3300005719 Unclassified 875
128 Ga0068861_102320026 3300005719 Bacteria 539
129 Ga0068851_10055180 3300005834 Bacteria 2024
130 Ga0068870_10030736 3300005840 Bacteria 2716
131 Ga0068870_10088079 3300005840 Unclassified 1730
132 Ga0068870_11191368 3300005840 Unclassified 551
133 Ga0068863_100051829 3300005841 Bacteria 3889
134 Ga0068863_100087085 3300005841 Bacteria 2959
135 Ga0068863_100091057 3300005841 Bacteria 2892
136 Ga0068863_100193860 3300005841 Bacteria 1953
137 Ga0068863_100300747 3300005841 Bacteria 1556
138 Ga0068863_101137893 3300005841 Bacteria 786
139 Ga0068858_101399093 3300005842 Bacteria 689
140 Ga0068860_100241389 3300005843 Bacteria 1757
141 Ga0068860_100539892 3300005843 Bacteria 1167
142 Ga0068860_101503136 3300005843 Bacteria 695
143 Ga0068860_102520803 3300005843 Unclassified 534
144 Ga0068862_100035097 3300005844 Bacteria 4245
145 Ga0068862_100098359 3300005844 Bacteria 2556
146 Ga0068862_100305493 3300005844 Unclassified 1465
147 Ga0068862_100374864 3300005844 Bacteria 1326
148 Ga0070715_10809868 3300006163 Bacteria 569
149 Ga0075362_10773697 3300006177 Bacteria 504
150 Ga0097621_100591815 3300006237 Bacteria 1013
151 Ga0097621_101509737 3300006237 Bacteria 638
152 Ga0068871_100046971 3300006358 Bacteria 3480
153 Ga0068871_100049648 3300006358 Bacteria 3392
154 Ga0068871_100485521 3300006358 Bacteria 1112
155 Ga0068871_100797242 3300006358 Bacteria 870
156 Ga0068871_100890241 3300006358 Bacteria 825
157 Ga0075434_102654641 3300006871 Unclassified 501
158 Ga0068865_100004964 3300006881 Bacteria 8046
159 Ga0068865_100070293 3300006881 Unclassified 2480
160 Ga0068865_100196943 3300006881 Bacteria 1562
161 Ga0068865_100710973 3300006881 Unclassified 859
162 Ga0097620_100124041 3300006931 Bacteria 2651
163 Ga0097620_100159280 3300006931 Bacteria 2336
164 Ga0097620_100504541 3300006931 Bacteria 1305
165 Ga0097620_100825614 3300006931 Bacteria 1014
166 Ga0097620_101386785 3300006931 Bacteria 775
167 Ga0111539_10879135 3300009094 Bacteria 1042
168 Ga0111539_11645017 3300009094 Bacteria 745
169 Ga0105245_11929197 3300009098 Unclassified 644
170 Ga0105243_10446676 3300009148 Unclassified 1212
171 Ga0105243_11799992 3300009148 Bacteria 643
172 Ga0105242_10040011 3300009176 Bacteria 3776
173 Ga0105248_10401678 3300009177 Unclassified 1543
174 Ga0105248_12958408 3300009177 Bacteria 541
175 Ga0105249_11938986 3300009553 Bacteria 662
176 Ga0105249_12618769 3300009553 Bacteria 577
177 Ga0105249_12806554 3300009553 Unclassified 559
178 Ga0105246_11670343 3300011119 Unclassified 604
179 Ga0105246_11722513 3300011119 Bacteria 596
180 Ga0157370_10451977 3300013104 Bacteria 1181
181 Ga0163162_10067869 3300013306 Bacteria 3617
182 Ga0163162_13192659 3300013306 Unclassified 526
183 Ga0157375_10033993 3300013308 Bacteria 4852
184 Ga0157375_10108768 3300013308 Bacteria 2868
185 Ga0157375_10446750 3300013308 Bacteria 1458
186 Ga0157375_10548314 3300013308 Bacteria 1318
187 Ga0163163_10075863 3300014325 Bacteria 3356
188 Ga0163163_10784732 3300014325 Unclassified 1016
189 Ga0163163_11187817 3300014325 Unclassified 826
190 Ga0163163_11649245 3300014325 Bacteria 702
191 Ga0157380_10017159 3300014326 Bacteria 5354
192 Ga0157380_10138400 3300014326 Bacteria 2088
193 Ga0157380_10260138 3300014326 Unclassified 1576
194 Ga0157380_10359684 3300014326 Bacteria 1365
195 Ga0157380_11047665 3300014326 Bacteria 852
196 Ga0157380_13358649 3300014326 Unclassified 512
197 Ga0157380_13510473 3300014326 Unclassified 502
198 Ga0157377_10243643 3300014745 Unclassified 1162
199 Ga0157377_11574816 3300014745 Unclassified 525
200 Ga0157379_10427680 3300014968 Bacteria 1220
201 Ga0157379_10869992 3300014968 Unclassified 854
202 Ga0157376_10449734 3300014969 Bacteria 1256
203 Ga0157376_10699269 3300014969 Bacteria 1019
204 Ga0157376_10748364 3300014969 Unclassified 986
205 Ga0157376_11718031 3300014969 Bacteria 663
206 Ga0163161_10069769 3300017792 Bacteria 2569
207 Ga0163161_10366108 3300017792 Bacteria 1149
208 Ga0207682_10003471 3300025893 Bacteria 6833
209 Ga0207682_10011375 3300025893 Unclassified 3475
210 Ga0207692_10125768 3300025898 Unclassified 1442
211 Ga0207642_11036888 3300025899 Bacteria 529
212 Ga0207685_10693184 3300025905 Bacteria 554
213 Ga0207645_10091529 3300025907 Bacteria 1956
214 Ga0207645_10688936 3300025907 Bacteria 694
215 Ga0207643_10040244 3300025908 Unclassified 2631
216 Ga0207643_10168402 3300025908 Bacteria 1321
217 Ga0207643_10806755 3300025908 Unclassified 608
218 Ga0207663_11015677 3300025916 Bacteria 665
219 Ga0207662_10047961 3300025918 Bacteria 2530
220 Ga0207662_10670393 3300025918 Unclassified 725
221 Ga0207662_11272384 3300025918 Bacteria 523
222 Ga0207657_10625434 3300025919 Bacteria 839
223 Ga0207649_10105939 3300025920 Bacteria 1869
224 Ga0207681_10107159 3300025923 Bacteria 2026
225 Ga0207681_10295959 3300025923 Bacteria 1279
226 Ga0207681_10815317 3300025923 Unclassified 780
227 Ga0207650_10033126 3300025925 Unclassified 3740
228 Ga0207650_10910020 3300025925 Unclassified 747
229 Ga0207659_10043919 3300025926 Bacteria 3143
230 Ga0207659_10200541 3300025926 Unclassified 1593
231 Ga0207659_10244186 3300025926 Unclassified 1454
232 Ga0207659_11079509 3300025926 Unclassified 691
233 Ga0207690_10413310 3300025932 Unclassified 1078
234 Ga0207706_11022458 3300025933 Bacteria 693
235 Ga0207686_10038200 3300025934 Bacteria 2903
236 Ga0207670_10013479 3300025936 Bacteria 4823
237 Ga0207670_10386829 3300025936 Bacteria 1115
238 Ga0207670_10682150 3300025936 Unclassified 849
239 Ga0207670_10786612 3300025936 Bacteria 792
240 Ga0207670_11252901 3300025936 Unclassified 628
241 Ga0207669_10005058 3300025937 Bacteria 5871
242 Ga0207669_10313014 3300025937 Unclassified 1198
243 Ga0207669_10437320 3300025937 Bacteria 1033
244 Ga0207669_11946031 3300025937 Unclassified 502
245 Ga0207704_10011411 3300025938 Bacteria 4374
246 Ga0207704_10047852 3300025938 Unclassified 2560
247 Ga0207704_10284546 3300025938 Bacteria 1258
248 Ga0207704_10617640 3300025938 Bacteria 889
249 Ga0207704_10808767 3300025938 Bacteria 783
250 Ga0207691_10002796 3300025940 Bacteria 17020
251 Ga0207691_10005612 3300025940 Bacteria 12127
252 Ga0207691_10008395 3300025940 Bacteria 9925
253 Ga0207691_10080293 3300025940 Bacteria 2934
254 Ga0207691_10100921 3300025940 Bacteria 2575
255 Ga0207691_10895499 3300025940 Unclassified 743
256 Ga0207711_10201687 3300025941 Bacteria 1815
257 Ga0207711_11827111 3300025941 Bacteria 551
258 Ga0207689_10012416 3300025942 Bacteria 7283
259 Ga0207689_10146086 3300025942 Bacteria 1948
260 Ga0207689_11646245 3300025942 Unclassified 533
261 Ga0207679_10050277 3300025945 Bacteria 3045
262 Ga0207679_10297406 3300025945 Bacteria 1390
263 Ga0207679_10387630 3300025945 Bacteria 1226
264 Ga0207667_11747943 3300025949 Bacteria 587
265 Ga0207651_10171606 3300025960 Unclassified 1711
266 Ga0207651_10265227 3300025960 Bacteria 1412
267 Ga0207651_10693753 3300025960 Unclassified 896
268 Ga0207651_10963687 3300025960 Bacteria 761
269 Ga0207651_11349986 3300025960 Unclassified 641
270 Ga0207651_12081674 3300025960 Unclassified 510
271 Ga0207668_10881358 3300025972 Unclassified 796
272 Ga0207640_11327994 3300025981 Unclassified 643
273 Ga0207658_10114661 3300025986 Unclassified 2137
274 Ga0207658_10491681 3300025986 Bacteria 1092
275 Ga0207658_11434167 3300025986 Bacteria 631
276 Ga0207677_10108616 3300026023 Unclassified 2061
277 Ga0207703_11958882 3300026035 Bacteria 562
278 Ga0207678_10280665 3300026067 Unclassified 1429
279 Ga0207678_10443770 3300026067 Unclassified 1127
280 Ga0207678_10466665 3300026067 Bacteria 1098
281 Ga0207708_10017993 3300026075 Bacteria 5317
282 Ga0207708_10223347 3300026075 Bacteria 1510
283 Ga0207708_10276458 3300026075 Bacteria 1360
284 Ga0207708_10326903 3300026075 Unclassified 1253
285 Ga0207708_10338866 3300026075 Bacteria 1231
286 Ga0207708_10655929 3300026075 Bacteria 894
287 Ga0207641_10059400 3300026088 Bacteria 3256
288 Ga0207641_10583883 3300026088 Unclassified 1092
289 Ga0207641_11241662 3300026088 Bacteria 745
290 Ga0207641_11749950 3300026088 Bacteria 623
291 Ga0207648_10037450 3300026089 Bacteria 4273
292 Ga0207648_10391343 3300026089 Bacteria 1258
293 Ga0207648_10419832 3300026089 Bacteria 1214
294 Ga0207648_10514782 3300026089 Unclassified 1096
295 Ga0207676_10028292 3300026095 Bacteria 4185
296 Ga0207676_10054328 3300026095 Bacteria 3139
297 Ga0207676_10426563 3300026095 Bacteria 1245
298 Ga0207676_10462968 3300026095 Bacteria 1198
299 Ga0207676_11745390 3300026095 Unclassified 621
300 Ga0207674_10367609 3300026116 Bacteria 1390
301 Ga0207675_100003178 3300026118 Bacteria 16109
302 Ga0207675_100056444 3300026118 Bacteria 3663
303 Ga0207675_100062248 3300026118 Bacteria 3484
304 Ga0207675_100111980 3300026118 Bacteria 2575
305 Ga0207675_100256202 3300026118 Bacteria 1695
306 Ga0207675_100289355 3300026118 Bacteria 1594
307 Ga0207675_100804553 3300026118 Unclassified 953
308 Ga0207675_102302877 3300026118 Unclassified 552
309 Ga0207683_10011668 3300026121 Bacteria 7500
310 Ga0207683_10025049 3300026121 Bacteria 5144
311 Ga0207683_10104686 3300026121 Unclassified 2529
312 Ga0207698_11710485 3300026142 Unclassified 644
313 Ga0268266_10289377 3300028379 Bacteria 1525
314 Ga0268266_10429394 3300028379 Bacteria 1253
315 Ga0268266_10552633 3300028379 Unclassified 1103
316 Ga0268266_11302112 3300028379 Unclassified 702
317 Ga0268266_11712387 3300028379 Bacteria 604
318 Ga0268265_10020410 3300028380 Bacteria 4624
319 Ga0268265_10092628 3300028380 Bacteria 2419
320 Ga0268265_10832784 3300028380 Bacteria 901
321 Ga0268264_10175783 3300028381 Bacteria 1940
322 Ga0268264_10492135 3300028381 Bacteria 1195
323 Ga0268264_10716228 3300028381 Bacteria 995
324 Ga0268264_11330489 3300028381 Bacteria 729
325 Ga0268264_12292336 3300028381 Unclassified 547
326 Ga0307515_10179328 3300028794 Bacteria 2075
327 Ga0307511_10288482 3300030521 Unclassified 752
328 Ga0307513_10005109 3300031456 Bacteria 17369
329 Ga0307513_10029257 3300031456 Bacteria 6284
330 Ga0307408_100135964 3300031548 Bacteria 1923
331 Ga0307514_10155194 3300031649 Bacteria 1527
332 Ga0307516_10608822 3300031730 Bacteria 747
333 Ga0307405_10282589 3300031731 Bacteria 1250
334 Ga0307413_10141238 3300031824 Unclassified 1664
335 Ga0307413_11114026 3300031824 Bacteria 682
336 Ga0307410_10098388 3300031852 Unclassified 2092
337 Ga0307406_11598898 3300031901 Bacteria 576
338 Ga0307407_10041978 3300031903 Unclassified 2561
339 Ga0307407_10334569 3300031903 Bacteria 1067
340 Ga0307409_100129854 3300031995 Bacteria 2151
341 Ga0307409_102646029 3300031995 Unclassified 530
342 Ga0307411_10032662 3300032005 Bacteria 3218
343 Ga0307411_10819390 3300032005 Unclassified 821
344 Ga0307411_10931045 3300032005 Bacteria 774
345 Ga0307411_11130300 3300032005 Bacteria 707
346 Ga0307415_100166762 3300032126 Bacteria 1713
347 Ga0307415_100202713 3300032126 Unclassified 1576
348 Ga0373944_0425064 3300035089 Unclassified 515
349 Ga0373955_0219760 3300035172 Unclassified 1135
350 Ga0373924_0112046 3300035410 Bacteria 1180
351 Ga0373937_0080339 3300036401 Bacteria 3015
352 Ga0451791_0183416 3300041451 Bacteria 1802
353 Ga0451793_0198010 3300041452 Unclassified 601
354 Ga0451793_1853135 3300041452 Bacteria 674
355 Ga0451802_2030988 3300041460 Bacteria 2939
356 Ga0451804_0442523 3300041463 Unclassified 669
357 Ga0451804_0962700 3300041463 Unclassified 566
358 Ga0451807_0531483 3300041486 Bacteria 2210
359 Ga0451807_1486005 3300041486 Bacteria 2580
360 Ga0451807_2513484 3300041486 Unclassified 1863
361 Ga0451833_0184934 3300041491 Unclassified 595
362 Ga0451837_0875959 3300041494 Unclassified 537
363 Ga0451845_0801249 3300041501 Unclassified 595
364 Ga0451849_0529754 3300041505 Unclassified 612
365 Ga0451851_0977781 3300041507 Unclassified 565
366 Ga0451843_0186968 3300041509 Unclassified 569
367 Ga0451843_0979549 3300041509 Bacteria 560
368 Ga0451843_1132209 3300041509 Bacteria 602
369 Ga0451855_1377682 3300041511 Bacteria 609
370 Ga0451853_0287723 3300041512 Unclassified 917
371 Ga0439459_0230420 3300042438 Unclassified 516
372 Ga0451576_1762256 3300045051 Unclassified 641
373 Ga0495590_0006836 3300046457 Bacteria 4432
374 Ga0495638_0003707 3300046460 Bacteria 11891
375 Ga0495638_0108464 3300046460 Unclassified 1651
376 Ga0495641_0294495 3300046461 Unclassified 731
377 Ga0495616_0004107 3300046513 Bacteria 9231
378 Ga0495616_0184258 3300046513 Unclassified 926
379 Ga0495620_0141627 3300046515 Unclassified 940
380 Ga0495628_1174437 3300046516 Unclassified 522
381 Ga0495632_0176419 3300046519 Bacteria 980
382 Ga0495632_0260223 3300046519 Bacteria 776
383 Ga0495637_0183971 3300046520 Unclassified 774
384 Ga0495663_0266099 3300046525 Unclassified 612
385 Ga0495621_0155087 3300046539 Unclassified 903
386 Ga0495621_0494105 3300046539 Bacteria 527
387 Ga0495625_0033400 3300046660 Bacteria 3805
388 Ga0495625_0110705 3300046660 Bacteria 1877
389 Ga0495625_0155959 3300046660 Bacteria 1532
390 Ga0495625_0322554 3300046660 Unclassified 983
391 Ga0495635_0293002 3300046663 Bacteria 1092
392 Ga0495671_0203779 3300046692 Unclassified 959
393 Ga0495649_0001447 3300046694 Bacteria 17893
394 Ga0495649_0678151 3300046694 Unclassified 506
395 Ga0495649_0680990 3300046694 Bacteria 505
396 Ga0495600_0448972 3300046809 Unclassified 798
397 Ga0495674_1398071 3300047319 Unclassified 522
398 Ga0495680_0352864 3300047322 Bacteria 1024
399 Ga0495686_0429770 3300047472 Bacteria 705
400 Ga0496108_0688625 3300048911 Unclassified 887
401 Ga0496110_1427562 3300048913 Unclassified 602
402 Ga0496114_0031023 3300048917 Bacteria 4397
403 Ga0495678_075842 3300049459 Bacteria 1220
404 Ga0501032_0674444 3300049569 Unclassified 656
405 Ga0501037_0898566 3300049573 Unclassified 581
406 Ga0501039_0190916 3300049575 Unclassified 1611
407 Ga0501043_0587724 3300049579 Unclassified 824
408 Ga0501067_0022089 3300049583 Bacteria 3521
409 Ga0501068_0009603 3300049584 Bacteria 5417
410 Ga0501068_0594245 3300049584 Bacteria 721
411 Ga0501070_0191195 3300049586 Unclassified 1682
412 Ga0501071_0170028 3300049587 Unclassified 1631
413 Ga0501072_0357544 3300049588 Bacteria 1159
414 Ga0501074_0004546 3300049590 Bacteria 9930
415 Ga0501074_1045919 3300049590 Unclassified 574
416 Ga0501075_0058036 3300049591 Unclassified 2915
417 Ga0501076_0057673 3300049592 Unclassified 3084
418 Ga0501077_0061521 3300049593 Bacteria 2382
419 Ga0501079_0014314 3300049741 Bacteria 6047
420 Ga0501080_0044312 3300049742 Bacteria 4142
421 Ga0501081_0092339 3300049743 Unclassified 2130
422 Ga0501083_0025029 3300049744 Unclassified 4134
423 Ga0501044_1169351 3300049823 Unclassified 638
424 Ga0501045_0547771 3300049824 Unclassified 858
425 nmdc:mga0qj67_1523378_c1 3300050509 Unclassified 514
426 nmdc:mga08y16_1286730_c1 3300050511 Bacteria 698
427 nmdc:mga08y16_2177355_c1 3300050511 Bacteria 501
428 Ga0500644_0403691 3300053088 Bacteria 596
429 Ga0500611_178837 3300053727 Bacteria 594
430 Ga0501084_0153814 3300054114 Unclassified 1939
431 Ga0501084_1695892 3300054114 Bacteria 528
432 Ga0501082_0050697 3300060353 Bacteria 3579
433 Ga0501082_0118193 3300060353 Unclassified 2297
434 Ga0501082_1500474 3300060353 Bacteria 589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100202713 Ga0307415_1002027133 60
2 3300041451 Ga0451791_0183416 Ga0451791_0183416_131_325 60
3 3300041452 Ga0451793_0198010 Ga0451793_0198010_279_473 60
4 3300041460 Ga0451802_2030988 Ga0451802_2030988_38_232 60
5 3300041463 Ga0451804_0962700 Ga0451804_0962700_157_351 60
6 3300041486 Ga0451807_0531483 Ga0451807_0531483_1942_2136 60
7 3300041491 Ga0451833_0184934 Ga0451833_0184934_354_548 60
8 3300041494 Ga0451837_0875959 Ga0451837_0875959_70_264 60
9 3300041505 Ga0451849_0529754 Ga0451849_0529754_185_379 60
10 3300005343 Ga0070687_100244044 Ga0070687_1002440441 61
11 3300028794 Ga0307515_10179328 Ga0307515_101793283 61
12 3300031824 Ga0307413_10141238 Ga0307413_101412382 61
13 3300031852 Ga0307410_10098388 Ga0307410_100983882 61
14 3300031903 Ga0307407_10041978 Ga0307407_100419783 61
15 3300031995 Ga0307409_100129854 Ga0307409_1001298543 61
16 3300032005 Ga0307411_10032662 Ga0307411_100326624 61
17 3300049590 Ga0501074_1045919 Ga0501074_1045919_173_370 61
18 3300005335 Ga0070666_10779823 Ga0070666_107798232 62
19 3300005547 Ga0070693_101438515 Ga0070693_1014385152 62
20 3300005548 Ga0070665_101810726 Ga0070665_1018107262 62
21 3300005617 Ga0068859_101386337 Ga0068859_1013863372 62
22 3300005841 Ga0068863_100193860 Ga0068863_1001938603 62
23 3300005843 Ga0068860_102520803 Ga0068860_1025208032 62
24 3300006237 Ga0097621_100591815 Ga0097621_1005918152 62
25 3300006931 Ga0097620_101386785 Ga0097620_1013867852 62
26 3300026088 Ga0207641_11241662 Ga0207641_112416622 62
27 3300028379 Ga0268266_11712387 Ga0268266_117123872 62
28 3300028381 Ga0268264_12292336 Ga0268264_122923362 62
29 3300041452 Ga0451793_1853135 Ga0451793_1853135_239_439 62
30 3300041501 Ga0451845_0801249 Ga0451845_0801249_60_260 62
31 3300046457 Ga0495590_0006836 Ga0495590_0006836_2714_2902 62
32 3300046460 Ga0495638_0108464 Ga0495638_0108464_1210_1410 62
33 3300046513 Ga0495616_0004107 Ga0495616_0004107_1688_1888 62
34 3300046513 Ga0495616_0184258 Ga0495616_0184258_444_632 62
35 3300046519 Ga0495632_0176419 Ga0495632_0176419_410_598 62
36 3300046660 Ga0495625_0110705 Ga0495625_0110705_1480_1680 62
37 3300046660 Ga0495625_0155959 Ga0495625_0155959_927_1115 62
38 3300046694 Ga0495649_0680990 Ga0495649_0680990_77_265 62
39 3300049459 Ga0495678_075842 Ga0495678_075842_948_1136 62
40 3300053088 Ga0500644_0403691 Ga0500644_0403691_375_563 62
41 3300053727 Ga0500611_178837 Ga0500611_178837_330_530 62
42 3300002244 JGI24742J22300_10107760 JGI24742J22300_101077602 63
43 3300005328 Ga0070676_10056153 Ga0070676_100561533 63
44 3300005328 Ga0070676_10794852 Ga0070676_107948522 63
45 3300005330 Ga0070690_100009236 Ga0070690_1000092364 63
46 3300005330 Ga0070690_100094505 Ga0070690_1000945055 63
47 3300005331 Ga0070670_100086323 Ga0070670_1000863231 63
48 3300005331 Ga0070670_101752739 Ga0070670_1017527392 63
49 3300005333 Ga0070677_10009641 Ga0070677_100096413 63
50 3300005333 Ga0070677_10032506 Ga0070677_100325062 63
51 3300005333 Ga0070677_10392143 Ga0070677_103921432 63
52 3300005334 Ga0068869_100034768 Ga0068869_1000347684 63
53 3300005334 Ga0068869_100111239 Ga0068869_1001112393 63
54 3300005334 Ga0068869_102062318 Ga0068869_1020623182 63
55 3300005337 Ga0070682_100006802 Ga0070682_1000068025 63
56 3300005337 Ga0070682_100227308 Ga0070682_1002273082 63
57 3300005337 Ga0070682_100312913 Ga0070682_1003129133 63
58 3300005338 Ga0068868_100358265 Ga0068868_1003582652 63
59 3300005338 Ga0068868_101096909 Ga0068868_1010969092 63
60 3300005339 Ga0070660_101512734 Ga0070660_1015127342 63
61 3300005340 Ga0070689_100089499 Ga0070689_1000894993 63
62 3300005340 Ga0070689_100213402 Ga0070689_1002134021 63
63 3300005340 Ga0070689_100598271 Ga0070689_1005982712 63
64 3300005340 Ga0070689_100680627 Ga0070689_1006806272 63
65 3300005341 Ga0070691_10410146 Ga0070691_104101462 63
66 3300005343 Ga0070687_100111513 Ga0070687_1001115133 63
67 3300005343 Ga0070687_100987976 Ga0070687_1009879761 63
68 3300005343 Ga0070687_101055934 Ga0070687_1010559342 63
69 3300005343 Ga0070687_101221842 Ga0070687_1012218422 63
70 3300005345 Ga0070692_10046828 Ga0070692_100468283 63
71 3300005345 Ga0070692_10062762 Ga0070692_100627626 63
72 3300005345 Ga0070692_10456054 Ga0070692_104560542 63
73 3300005347 Ga0070668_100374676 Ga0070668_1003746763 63
74 3300005347 Ga0070668_100667470 Ga0070668_1006674702 63
75 3300005353 Ga0070669_100148945 Ga0070669_1001489453 63
76 3300005353 Ga0070669_100751977 Ga0070669_1007519772 63
77 3300005353 Ga0070669_101089165 Ga0070669_1010891652 63
78 3300005353 Ga0070669_101177286 Ga0070669_1011772862 63
79 3300005354 Ga0070675_100010804 Ga0070675_1000108046 63
80 3300005354 Ga0070675_100074200 Ga0070675_1000742003 63
81 3300005354 Ga0070675_100184823 Ga0070675_1001848233 63
82 3300005354 Ga0070675_101784236 Ga0070675_1017842362 63
83 3300005356 Ga0070674_100044274 Ga0070674_1000442746 63
84 3300005356 Ga0070674_100076457 Ga0070674_1000764572 63
85 3300005356 Ga0070674_100222831 Ga0070674_1002228312 63
86 3300005356 Ga0070674_100766130 Ga0070674_1007661302 63
87 3300005364 Ga0070673_100091123 Ga0070673_1000911232 63
88 3300005364 Ga0070673_100115329 Ga0070673_1001153292 63
89 3300005364 Ga0070673_100300960 Ga0070673_1003009602 63
90 3300005364 Ga0070673_101060135 Ga0070673_1010601352 63
91 3300005366 Ga0070659_100518139 Ga0070659_1005181391 63
92 3300005366 Ga0070659_100858204 Ga0070659_1008582041 63
93 3300005367 Ga0070667_100496008 Ga0070667_1004960083 63
94 3300005367 Ga0070667_102291174 Ga0070667_1022911742 63
95 3300005406 Ga0070703_10472169 Ga0070703_104721692 63
96 3300005438 Ga0070701_10006786 Ga0070701_100067867 63
97 3300005438 Ga0070701_10055731 Ga0070701_100557312 63
98 3300005438 Ga0070701_10168452 Ga0070701_101684522 63
99 3300005438 Ga0070701_11175980 Ga0070701_111759802 63
100 3300005440 Ga0070705_100136300 Ga0070705_1001363003 63
101 3300005441 Ga0070700_100083518 Ga0070700_1000835182 63
102 3300005441 Ga0070700_100257811 Ga0070700_1002578112 63
103 3300005441 Ga0070700_100262781 Ga0070700_1002627813 63
104 3300005441 Ga0070700_100293390 Ga0070700_1002933902 63
105 3300005441 Ga0070700_100431814 Ga0070700_1004318142 63
106 3300005444 Ga0070694_100009113 Ga0070694_1000091133 63
107 3300005444 Ga0070694_100299742 Ga0070694_1002997422 63
108 3300005445 Ga0070708_100986361 Ga0070708_1009863612 63
109 3300005455 Ga0070663_101987196 Ga0070663_1019871961 63
110 3300005456 Ga0070678_100011503 Ga0070678_1000115034 63
111 3300005456 Ga0070678_100034322 Ga0070678_1000343222 63
112 3300005456 Ga0070678_100478545 Ga0070678_1004785453 63
113 3300005457 Ga0070662_100258705 Ga0070662_1002587053 63
114 3300005457 Ga0070662_100682439 Ga0070662_1006824391 63
115 3300005459 Ga0068867_100075694 Ga0068867_1000756945 63
116 3300005459 Ga0068867_100114093 Ga0068867_1001140933 63
117 3300005459 Ga0068867_100284958 Ga0068867_1002849583 63
118 3300005459 Ga0068867_100374805 Ga0068867_1003748052 63
119 3300005466 Ga0070685_10154512 Ga0070685_101545122 63
120 3300005466 Ga0070685_10271480 Ga0070685_102714803 63
121 3300005466 Ga0070685_11074066 Ga0070685_110740662 63
122 3300005543 Ga0070672_100004220 Ga0070672_1000042202 63
123 3300005543 Ga0070672_100026026 Ga0070672_1000260263 63
124 3300005543 Ga0070672_100084373 Ga0070672_1000843732 63
125 3300005543 Ga0070672_100160755 Ga0070672_1001607552 63
126 3300005543 Ga0070672_100422341 Ga0070672_1004223413 63
127 3300005544 Ga0070686_100078752 Ga0070686_1000787522 63
128 3300005544 Ga0070686_100129588 Ga0070686_1001295883 63
129 3300005544 Ga0070686_100277972 Ga0070686_1002779721 63
130 3300005544 Ga0070686_100769104 Ga0070686_1007691042 63
131 3300005545 Ga0070695_100286699 Ga0070695_1002866992 63
132 3300005546 Ga0070696_100165412 Ga0070696_1001654123 63
133 3300005547 Ga0070693_100028368 Ga0070693_1000283685 63
134 3300005548 Ga0070665_100005029 Ga0070665_1000050292 63
135 3300005548 Ga0070665_100508613 Ga0070665_1005086132 63
136 3300005548 Ga0070665_102226930 Ga0070665_1022269301 63
137 3300005549 Ga0070704_100099199 Ga0070704_1000991992 63
138 3300005549 Ga0070704_100317399 Ga0070704_1003173992 63
139 3300005563 Ga0068855_101864896 Ga0068855_1018648962 63
140 3300005564 Ga0070664_100093483 Ga0070664_1000934833 63
141 3300005564 Ga0070664_100426168 Ga0070664_1004261682 63
142 3300005577 Ga0068857_100136847 Ga0068857_1001368474 63
143 3300005578 Ga0068854_101513677 Ga0068854_1015136771 63
144 3300005615 Ga0070702_100219612 Ga0070702_1002196122 63
145 3300005615 Ga0070702_100380705 Ga0070702_1003807052 63
146 3300005615 Ga0070702_101607676 Ga0070702_1016076761 63
147 3300005616 Ga0068852_101427902 Ga0068852_1014279022 63
148 3300005617 Ga0068859_100124036 Ga0068859_1001240363 63
149 3300005617 Ga0068859_100159276 Ga0068859_1001592763 63
150 3300005617 Ga0068859_100504587 Ga0068859_1005045873 63
151 3300005617 Ga0068859_100825640 Ga0068859_1008256403 63
152 3300005618 Ga0068864_100067144 Ga0068864_1000671444 63
153 3300005618 Ga0068864_100099598 Ga0068864_1000995983 63
154 3300005618 Ga0068864_100265221 Ga0068864_1002652212 63
155 3300005618 Ga0068864_101950674 Ga0068864_1019506742 63
156 3300005718 Ga0068866_10186458 Ga0068866_101864582 63
157 3300005718 Ga0068866_10965230 Ga0068866_109652302 63
158 3300005719 Ga0068861_100005053 Ga0068861_10000505311 63
159 3300005719 Ga0068861_100027211 Ga0068861_1000272117 63
160 3300005719 Ga0068861_100065579 Ga0068861_1000655792 63
161 3300005719 Ga0068861_100075642 Ga0068861_1000756423 63
162 3300005719 Ga0068861_100471866 Ga0068861_1004718662 63
163 3300005719 Ga0068861_100818975 Ga0068861_1008189752 63
164 3300005719 Ga0068861_102320026 Ga0068861_1023200262 63
165 3300005834 Ga0068851_10055180 Ga0068851_100551803 63
166 3300005840 Ga0068870_10030736 Ga0068870_100307366 63
167 3300005840 Ga0068870_10088079 Ga0068870_100880793 63
168 3300005840 Ga0068870_11191368 Ga0068870_111913682 63
169 3300005841 Ga0068863_100051829 Ga0068863_1000518297 63
170 3300005841 Ga0068863_100087085 Ga0068863_1000870852 63
171 3300005841 Ga0068863_100091057 Ga0068863_1000910576 63
172 3300005841 Ga0068863_100300747 Ga0068863_1003007472 63
173 3300005841 Ga0068863_101137893 Ga0068863_1011378932 63
174 3300005842 Ga0068858_101399093 Ga0068858_1013990932 63
175 3300005843 Ga0068860_100241389 Ga0068860_1002413893 63
176 3300005843 Ga0068860_100539892 Ga0068860_1005398922 63
177 3300005843 Ga0068860_101503136 Ga0068860_1015031362 63
178 3300005844 Ga0068862_100035097 Ga0068862_1000350977 63
179 3300005844 Ga0068862_100098359 Ga0068862_1000983595 63
180 3300005844 Ga0068862_100305493 Ga0068862_1003054933 63
181 3300005844 Ga0068862_100374864 Ga0068862_1003748643 63
182 3300006163 Ga0070715_10809868 Ga0070715_108098682 63
183 3300006177 Ga0075362_10773697 Ga0075362_107736972 63
184 3300006237 Ga0097621_101509737 Ga0097621_1015097372 63
185 3300006358 Ga0068871_100046971 Ga0068871_1000469716 63
186 3300006358 Ga0068871_100049648 Ga0068871_1000496483 63
187 3300006358 Ga0068871_100485521 Ga0068871_1004855213 63
188 3300006358 Ga0068871_100797242 Ga0068871_1007972422 63
189 3300006358 Ga0068871_100890241 Ga0068871_1008902412 63
190 3300006871 Ga0075434_102654641 Ga0075434_1026546412 63
191 3300006881 Ga0068865_100004964 Ga0068865_10000496410 63
192 3300006881 Ga0068865_100070293 Ga0068865_1000702933 63
193 3300006881 Ga0068865_100196943 Ga0068865_1001969432 63
194 3300006881 Ga0068865_100710973 Ga0068865_1007109732 63
195 3300006931 Ga0097620_100124041 Ga0097620_1001240413 63
196 3300006931 Ga0097620_100159280 Ga0097620_1001592803 63
197 3300006931 Ga0097620_100504541 Ga0097620_1005045413 63
198 3300006931 Ga0097620_100825614 Ga0097620_1008256143 63
199 3300009094 Ga0111539_10879135 Ga0111539_108791353 63
200 3300009094 Ga0111539_11645017 Ga0111539_116450172 63
201 3300009098 Ga0105245_11929197 Ga0105245_119291972 63
202 3300009148 Ga0105243_10446676 Ga0105243_104466762 63
203 3300009148 Ga0105243_11799992 Ga0105243_117999921 63
204 3300009176 Ga0105242_10040011 Ga0105242_100400112 63
205 3300009177 Ga0105248_10401678 Ga0105248_104016783 63
206 3300009177 Ga0105248_12958408 Ga0105248_129584082 63
207 3300009553 Ga0105249_11938986 Ga0105249_119389862 63
208 3300009553 Ga0105249_12618769 Ga0105249_126187692 63
209 3300009553 Ga0105249_12806554 Ga0105249_128065541 63
210 3300011119 Ga0105246_11670343 Ga0105246_116703432 63
211 3300011119 Ga0105246_11722513 Ga0105246_117225132 63
212 3300013104 Ga0157370_10451977 Ga0157370_104519773 63
213 3300013306 Ga0163162_10067869 Ga0163162_100678692 63
214 3300013306 Ga0163162_13192659 Ga0163162_131926592 63
215 3300013308 Ga0157375_10033993 Ga0157375_100339935 63
216 3300013308 Ga0157375_10108768 Ga0157375_101087687 63
217 3300013308 Ga0157375_10446750 Ga0157375_104467503 63
218 3300013308 Ga0157375_10548314 Ga0157375_105483143 63
219 3300014325 Ga0163163_10075863 Ga0163163_100758636 63
220 3300014325 Ga0163163_10784732 Ga0163163_107847323 63
221 3300014325 Ga0163163_11187817 Ga0163163_111878172 63
222 3300014325 Ga0163163_11649245 Ga0163163_116492452 63
223 3300014326 Ga0157380_10017159 Ga0157380_100171592 63
224 3300014326 Ga0157380_10138400 Ga0157380_101384002 63
225 3300014326 Ga0157380_10260138 Ga0157380_102601382 63
226 3300014326 Ga0157380_10359684 Ga0157380_103596843 63
227 3300014326 Ga0157380_11047665 Ga0157380_110476652 63
228 3300014326 Ga0157380_13358649 Ga0157380_133586492 63
229 3300014326 Ga0157380_13510473 Ga0157380_135104732 63
230 3300014745 Ga0157377_10243643 Ga0157377_102436432 63
231 3300014745 Ga0157377_11574816 Ga0157377_115748162 63
232 3300014968 Ga0157379_10427680 Ga0157379_104276801 63
233 3300014968 Ga0157379_10869992 Ga0157379_108699922 63
234 3300014969 Ga0157376_10449734 Ga0157376_104497342 63
235 3300014969 Ga0157376_10699269 Ga0157376_106992692 63
236 3300014969 Ga0157376_10748364 Ga0157376_107483642 63
237 3300014969 Ga0157376_11718031 Ga0157376_117180312 63
238 3300017792 Ga0163161_10069769 Ga0163161_100697693 63
239 3300017792 Ga0163161_10366108 Ga0163161_103661082 63
240 3300025893 Ga0207682_10003471 Ga0207682_100034717 63
241 3300025893 Ga0207682_10011375 Ga0207682_100113753 63
242 3300025898 Ga0207692_10125768 Ga0207692_101257682 63
243 3300025899 Ga0207642_11036888 Ga0207642_110368881 63
244 3300025905 Ga0207685_10693184 Ga0207685_106931842 63
245 3300025907 Ga0207645_10091529 Ga0207645_100915293 63
246 3300025907 Ga0207645_10688936 Ga0207645_106889362 63
247 3300025908 Ga0207643_10040244 Ga0207643_100402445 63
248 3300025908 Ga0207643_10168402 Ga0207643_101684023 63
249 3300025908 Ga0207643_10806755 Ga0207643_108067551 63
250 3300025916 Ga0207663_11015677 Ga0207663_110156772 63
251 3300025918 Ga0207662_10047961 Ga0207662_100479613 63
252 3300025918 Ga0207662_10670393 Ga0207662_106703932 63
253 3300025918 Ga0207662_11272384 Ga0207662_112723841 63
254 3300025919 Ga0207657_10625434 Ga0207657_106254342 63
255 3300025920 Ga0207649_10105939 Ga0207649_101059392 63
256 3300025923 Ga0207681_10107159 Ga0207681_101071593 63
257 3300025923 Ga0207681_10295959 Ga0207681_102959593 63
258 3300025923 Ga0207681_10815317 Ga0207681_108153172 63
259 3300025925 Ga0207650_10033126 Ga0207650_100331263 63
260 3300025925 Ga0207650_10910020 Ga0207650_109100202 63
261 3300025926 Ga0207659_10043919 Ga0207659_100439193 63
262 3300025926 Ga0207659_10200541 Ga0207659_102005412 63
263 3300025926 Ga0207659_10244186 Ga0207659_102441862 63
264 3300025926 Ga0207659_11079509 Ga0207659_110795092 63
265 3300025932 Ga0207690_10413310 Ga0207690_104133103 63
266 3300025933 Ga0207706_11022458 Ga0207706_110224582 63
267 3300025934 Ga0207686_10038200 Ga0207686_100382007 63
268 3300025936 Ga0207670_10013479 Ga0207670_100134794 63
269 3300025936 Ga0207670_10386829 Ga0207670_103868291 63
270 3300025936 Ga0207670_10682150 Ga0207670_106821502 63
271 3300025936 Ga0207670_10786612 Ga0207670_107866122 63
272 3300025936 Ga0207670_11252901 Ga0207670_112529012 63
273 3300025937 Ga0207669_10005058 Ga0207669_100050583 63
274 3300025937 Ga0207669_10313014 Ga0207669_103130142 63
275 3300025937 Ga0207669_10437320 Ga0207669_104373202 63
276 3300025937 Ga0207669_11946031 Ga0207669_119460312 63
277 3300025938 Ga0207704_10011411 Ga0207704_100114117 63
278 3300025938 Ga0207704_10047852 Ga0207704_100478524 63
279 3300025938 Ga0207704_10284546 Ga0207704_102845462 63
280 3300025938 Ga0207704_10617640 Ga0207704_106176402 63
281 3300025938 Ga0207704_10808767 Ga0207704_108087672 63
282 3300025940 Ga0207691_10002796 Ga0207691_100027966 63
283 3300025940 Ga0207691_10005612 Ga0207691_100056122 63
284 3300025940 Ga0207691_10008395 Ga0207691_100083957 63
285 3300025940 Ga0207691_10080293 Ga0207691_100802933 63
286 3300025940 Ga0207691_10100921 Ga0207691_101009212 63
287 3300025940 Ga0207691_10895499 Ga0207691_108954992 63
288 3300025941 Ga0207711_10201687 Ga0207711_102016872 63
289 3300025941 Ga0207711_11827111 Ga0207711_118271112 63
290 3300025942 Ga0207689_10012416 Ga0207689_100124168 63
291 3300025942 Ga0207689_10146086 Ga0207689_101460862 63
292 3300025942 Ga0207689_11646245 Ga0207689_116462452 63
293 3300025945 Ga0207679_10050277 Ga0207679_100502775 63
294 3300025945 Ga0207679_10297406 Ga0207679_102974063 63
295 3300025945 Ga0207679_10387630 Ga0207679_103876302 63
296 3300025949 Ga0207667_11747943 Ga0207667_117479432 63
297 3300025960 Ga0207651_10171606 Ga0207651_101716063 63
298 3300025960 Ga0207651_10265227 Ga0207651_102652273 63
299 3300025960 Ga0207651_10693753 Ga0207651_106937532 63
300 3300025960 Ga0207651_10963687 Ga0207651_109636872 63
301 3300025960 Ga0207651_11349986 Ga0207651_113499862 63
302 3300025960 Ga0207651_12081674 Ga0207651_120816742 63
303 3300025972 Ga0207668_10881358 Ga0207668_108813582 63
304 3300025981 Ga0207640_11327994 Ga0207640_113279942 63
305 3300025986 Ga0207658_10114661 Ga0207658_101146612 63
306 3300025986 Ga0207658_10491681 Ga0207658_104916812 63
307 3300025986 Ga0207658_11434167 Ga0207658_114341672 63
308 3300026023 Ga0207677_10108616 Ga0207677_101086165 63
309 3300026035 Ga0207703_11958882 Ga0207703_119588822 63
310 3300026067 Ga0207678_10280665 Ga0207678_102806653 63
311 3300026067 Ga0207678_10443770 Ga0207678_104437702 63
312 3300026067 Ga0207678_10466665 Ga0207678_104666653 63
313 3300026075 Ga0207708_10017993 Ga0207708_100179936 63
314 3300026075 Ga0207708_10223347 Ga0207708_102233474 63
315 3300026075 Ga0207708_10276458 Ga0207708_102764582 63
316 3300026075 Ga0207708_10326903 Ga0207708_103269032 63
317 3300026075 Ga0207708_10338866 Ga0207708_103388662 63
318 3300026075 Ga0207708_10655929 Ga0207708_106559292 63
319 3300026088 Ga0207641_10059400 Ga0207641_100594003 63
320 3300026088 Ga0207641_10583883 Ga0207641_105838832 63
321 3300026088 Ga0207641_11749950 Ga0207641_117499502 63
322 3300026089 Ga0207648_10037450 Ga0207648_100374506 63
323 3300026089 Ga0207648_10391343 Ga0207648_103913432 63
324 3300026089 Ga0207648_10419832 Ga0207648_104198323 63
325 3300026089 Ga0207648_10514782 Ga0207648_105147822 63
326 3300026095 Ga0207676_10028292 Ga0207676_100282922 63
327 3300026095 Ga0207676_10054328 Ga0207676_100543284 63
328 3300026095 Ga0207676_10426563 Ga0207676_104265632 63
329 3300026095 Ga0207676_10462968 Ga0207676_104629682 63
330 3300026095 Ga0207676_11745390 Ga0207676_117453902 63
331 3300026116 Ga0207674_10367609 Ga0207674_103676093 63
332 3300026118 Ga0207675_100003178 Ga0207675_10000317823 63
333 3300026118 Ga0207675_100056444 Ga0207675_1000564447 63
334 3300026118 Ga0207675_100062248 Ga0207675_1000622482 63
335 3300026118 Ga0207675_100111980 Ga0207675_1001119803 63
336 3300026118 Ga0207675_100256202 Ga0207675_1002562022 63
337 3300026118 Ga0207675_100289355 Ga0207675_1002893553 63
338 3300026118 Ga0207675_100804553 Ga0207675_1008045532 63
339 3300026118 Ga0207675_102302877 Ga0207675_1023028772 63
340 3300026121 Ga0207683_10011668 Ga0207683_100116685 63
341 3300026121 Ga0207683_10025049 Ga0207683_100250493 63
342 3300026121 Ga0207683_10104686 Ga0207683_101046862 63
343 3300026142 Ga0207698_11710485 Ga0207698_117104852 63
344 3300028379 Ga0268266_10289377 Ga0268266_102893772 63
345 3300028379 Ga0268266_10429394 Ga0268266_104293943 63
346 3300028379 Ga0268266_10552633 Ga0268266_105526332 63
347 3300028379 Ga0268266_11302112 Ga0268266_113021122 63
348 3300028380 Ga0268265_10020410 Ga0268265_100204103 63
349 3300028380 Ga0268265_10092628 Ga0268265_100926283 63
350 3300028380 Ga0268265_10832784 Ga0268265_108327842 63
351 3300028381 Ga0268264_10175783 Ga0268264_101757833 63
352 3300028381 Ga0268264_10492135 Ga0268264_104921353 63
353 3300028381 Ga0268264_10716228 Ga0268264_107162283 63
354 3300028381 Ga0268264_11330489 Ga0268264_113304892 63
355 3300030521 Ga0307511_10288482 Ga0307511_102884822 63
356 3300031456 Ga0307513_10005109 Ga0307513_100051095 63
357 3300031456 Ga0307513_10029257 Ga0307513_100292574 63
358 3300031548 Ga0307408_100135964 Ga0307408_1001359642 63
359 3300031649 Ga0307514_10155194 Ga0307514_101551943 63
360 3300031730 Ga0307516_10608822 Ga0307516_106088222 63
361 3300031731 Ga0307405_10282589 Ga0307405_102825892 63
362 3300031824 Ga0307413_11114026 Ga0307413_111140261 63
363 3300031901 Ga0307406_11598898 Ga0307406_115988982 63
364 3300031903 Ga0307407_10334569 Ga0307407_103345692 63
365 3300031995 Ga0307409_102646029 Ga0307409_1026460292 63
366 3300032005 Ga0307411_10819390 Ga0307411_108193902 63
367 3300032005 Ga0307411_10931045 Ga0307411_109310452 63
368 3300032005 Ga0307411_11130300 Ga0307411_111303002 63
369 3300032126 Ga0307415_100166762 Ga0307415_1001667623 63
370 3300035089 Ga0373944_0425064 Ga0373944_0425064_231_422 63
371 3300035172 Ga0373955_0219760 Ga0373955_0219760_467_670 63
372 3300035410 Ga0373924_0112046 Ga0373924_0112046_118_321 63
373 3300036401 Ga0373937_0080339 Ga0373937_0080339_1833_2036 63
374 3300041463 Ga0451804_0442523 Ga0451804_0442523_270_461 63
375 3300041486 Ga0451807_1486005 Ga0451807_1486005_1263_1478 63
376 3300041486 Ga0451807_2513484 Ga0451807_2513484_125_328 63
377 3300041507 Ga0451851_0977781 Ga0451851_0977781_36_242 63
378 3300041509 Ga0451843_0186968 Ga0451843_0186968_93_299 63
379 3300041509 Ga0451843_0979549 Ga0451843_0979549_347_538 63
380 3300041509 Ga0451843_1132209 Ga0451843_1132209_129_344 63
381 3300041511 Ga0451855_1377682 Ga0451855_1377682_317_508 63
382 3300041512 Ga0451853_0287723 Ga0451853_0287723_173_364 63
383 3300042438 Ga0439459_0230420 Ga0439459_0230420_226_423 63
384 3300045051 Ga0451576_1762256 Ga0451576_1762256_345_548 63
385 3300046460 Ga0495638_0003707 Ga0495638_0003707_8230_8421 63
386 3300046461 Ga0495641_0294495 Ga0495641_0294495_384_587 63
387 3300046515 Ga0495620_0141627 Ga0495620_0141627_235_426 63
388 3300046516 Ga0495628_1174437 Ga0495628_1174437_156_359 63
389 3300046519 Ga0495632_0260223 Ga0495632_0260223_192_383 63
390 3300046520 Ga0495637_0183971 Ga0495637_0183971_103_294 63
391 3300046525 Ga0495663_0266099 Ga0495663_0266099_209_400 63
392 3300046539 Ga0495621_0155087 Ga0495621_0155087_248_439 63
393 3300046539 Ga0495621_0494105 Ga0495621_0494105_25_216 63
394 3300046660 Ga0495625_0033400 Ga0495625_0033400_527_718 63
395 3300046660 Ga0495625_0322554 Ga0495625_0322554_146_337 63
396 3300046663 Ga0495635_0293002 Ga0495635_0293002_176_379 63
397 3300046692 Ga0495671_0203779 Ga0495671_0203779_610_801 63
398 3300046694 Ga0495649_0001447 Ga0495649_0001447_5856_6047 63
399 3300046694 Ga0495649_0678151 Ga0495649_0678151_256_447 63
400 3300046809 Ga0495600_0448972 Ga0495600_0448972_469_672 63
401 3300047319 Ga0495674_1398071 Ga0495674_1398071_67_270 63
402 3300047322 Ga0495680_0352864 Ga0495680_0352864_42_245 63
403 3300047472 Ga0495686_0429770 Ga0495686_0429770_19_210 63
404 3300048911 Ga0496108_0688625 Ga0496108_0688625_286_477 63
405 3300048913 Ga0496110_1427562 Ga0496110_1427562_281_472 63
406 3300048917 Ga0496114_0031023 Ga0496114_0031023_3447_3650 63
407 3300049569 Ga0501032_0674444 Ga0501032_0674444_372_575 63
408 3300049573 Ga0501037_0898566 Ga0501037_0898566_103_306 63
409 3300049575 Ga0501039_0190916 Ga0501039_0190916_1051_1254 63
410 3300049579 Ga0501043_0587724 Ga0501043_0587724_212_415 63
411 3300049583 Ga0501067_0022089 Ga0501067_0022089_623_826 63
412 3300049584 Ga0501068_0009603 Ga0501068_0009603_3949_4152 63
413 3300049584 Ga0501068_0594245 Ga0501068_0594245_194_397 63
414 3300049586 Ga0501070_0191195 Ga0501070_0191195_312_515 63
415 3300049587 Ga0501071_0170028 Ga0501071_0170028_995_1198 63
416 3300049588 Ga0501072_0357544 Ga0501072_0357544_328_531 63
417 3300049590 Ga0501074_0004546 Ga0501074_0004546_1871_2074 63
418 3300049591 Ga0501075_0058036 Ga0501075_0058036_1420_1623 63
419 3300049592 Ga0501076_0057673 Ga0501076_0057673_977_1180 63
420 3300049593 Ga0501077_0061521 Ga0501077_0061521_1191_1394 63
421 3300049741 Ga0501079_0014314 Ga0501079_0014314_4180_4383 63
422 3300049742 Ga0501080_0044312 Ga0501080_0044312_861_1067 63
423 3300049743 Ga0501081_0092339 Ga0501081_0092339_221_424 63
424 3300049744 Ga0501083_0025029 Ga0501083_0025029_2109_2312 63
425 3300049823 Ga0501044_1169351 Ga0501044_1169351_237_440 63
426 3300049824 Ga0501045_0547771 Ga0501045_0547771_460_663 63
427 3300050509 nmdc:mga0qj67_1523378_c1 nmdc:mga0qj67_1523378_c1_195_398 63
428 3300050511 nmdc:mga08y16_1286730_c1 nmdc:mga08y16_1286730_c1_480_683 63
429 3300050511 nmdc:mga08y16_2177355_c1 nmdc:mga08y16_2177355_c1_202_405 63
430 3300054114 Ga0501084_0153814 Ga0501084_0153814_1552_1755 63
431 3300054114 Ga0501084_1695892 Ga0501084_1695892_233_436 63
432 3300060353 Ga0501082_0050697 Ga0501082_0050697_972_1175 63
433 3300060353 Ga0501082_0118193 Ga0501082_0118193_1460_1663 63
434 3300060353 Ga0501082_1500474 Ga0501082_1500474_123_329 63

Feature Viewer

pLDDT pTM Quality
77.45 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map