F442604

General Info

Members Datasets Scaffolds Average Seq Length
432 204 432 495

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10002525|Ga0182007_100025255
Length 520
Sequence MGYSRLKVRMFKKILIANRGEIAVRIIRACREMGIRSVAVYSDVDRSALHVRKADEAYRIGPAPATESYLDIGKILDAARRSGAEAIHPGYGFLSENARFAQACADEGLKFIGPSAHSMELMGSKTRARQEMEKAGVPFVPGTSRGLQSIGEAESVAQRIGYPVMLKAAAXXXGKGMRLVERPADLKSALEGAQSEAQRSFGDSEVYIEKYITNPRHIEMQVLADEYGNTVWLGERECSIQRRHQKVLEECPSPIVDDDMRRRMGEVAVRVAVAAGYANAGTVEFLVDSQKNFYFLEMNTRLQVEHPVTELVTGLDLVHLQIEIAAGARLPFTQKDVQLRGHAIECRIYAEDPDNNYFPSPGKITLLLAPSGPGIRRDSGMYEGWTVPVDYDPLLAKLIGYGTDREQATGRLIRALNEYFVGGIKTNISLFRRILSDPDFRAAKLDTGYLDRLLGRPERFPDKDGKAGMEVAAIAAGLFAIMDMQSASSPNGSAAGVSIDGKNPQCHSEWKRTGRQESLT

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.09
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000800 3300002459 Bacteria 7362
2 Ga0070658_10013389 3300005327 Bacteria 6580
3 Ga0070658_10128734 3300005327 Bacteria 2109
4 Ga0070683_100042185 3300005329 Bacteria 4201
5 Ga0070683_100049382 3300005329 Bacteria 3892
6 Ga0070670_100003458 3300005331 Bacteria 13109
7 Ga0070670_100010320 3300005331 Bacteria 7971
8 Ga0070670_100022721 3300005331 Bacteria 5397
9 Ga0068869_100015521 3300005334 Bacteria 5112
10 Ga0070666_10023589 3300005335 Bacteria 4005
11 Ga0070666_10029655 3300005335 Bacteria 3599
12 Ga0070680_100063689 3300005336 Bacteria 3021
13 Ga0070680_100186159 3300005336 Bacteria 1749
14 Ga0070682_100010222 3300005337 Bacteria 5322
15 Ga0068868_100006232 3300005338 Bacteria 8441
16 Ga0068868_100008261 3300005338 Bacteria 7453
17 Ga0068868_100072941 3300005338 Bacteria 2740
18 Ga0070660_100038642 3300005339 Bacteria 3624
19 Ga0070689_100004268 3300005340 Bacteria 9634
20 Ga0070689_100016196 3300005340 Bacteria 5451
21 Ga0070689_100064990 3300005340 Bacteria 2841
22 Ga0070661_100007361 3300005344 Bacteria 7590
23 Ga0070668_100010766 3300005347 Bacteria 6800
24 Ga0070669_100003235 3300005353 Bacteria 11698
25 Ga0070669_100056155 3300005353 Bacteria 2887
26 Ga0070675_100000090 3300005354 Bacteria 52154
27 Ga0070675_100000873 3300005354 Bacteria 21433
28 Ga0070675_100001363 3300005354 Bacteria 17893
29 Ga0070673_100165976 3300005364 Bacteria 1881
30 Ga0070659_100004349 3300005366 Bacteria 10111
31 Ga0070659_100023246 3300005366 Bacteria 4741
32 Ga0070667_100023665 3300005367 Bacteria 5098
33 Ga0070667_100036737 3300005367 Bacteria 4107
34 Ga0070667_100054874 3300005367 Bacteria 3365
35 Ga0070709_10007091 3300005434 Bacteria 6129
36 Ga0070709_10009622 3300005434 Bacteria 5338
37 Ga0070709_10021882 3300005434 Bacteria 3731
38 Ga0070709_10027582 3300005434 Bacteria 3378
39 Ga0070709_10031118 3300005434 Bacteria 3208
40 Ga0070714_100003667 3300005435 Bacteria 11496
41 Ga0070714_100184638 3300005435 Bacteria 1900
42 Ga0070713_100000123 3300005436 Bacteria 50592
43 Ga0070713_100000178 3300005436 Bacteria 42547
44 Ga0070713_100002212 3300005436 Bacteria 12602
45 Ga0070713_100005042 3300005436 Bacteria 8979
46 Ga0070713_100021243 3300005436 Bacteria 4989
47 Ga0070713_100078290 3300005436 Bacteria 2814
48 Ga0070713_100187726 3300005436 Bacteria 1861
49 Ga0070710_10022560 3300005437 Bacteria 3294
50 Ga0070711_100001975 3300005439 Bacteria 11519
51 Ga0070711_100041861 3300005439 Bacteria 3094
52 Ga0070708_100023165 3300005445 Bacteria 5276
53 Ga0070708_100063181 3300005445 Bacteria 3314
54 Ga0070708_100071812 3300005445 Bacteria 3117
55 Ga0070708_100082695 3300005445 Bacteria 2909
56 Ga0070678_100025006 3300005456 Bacteria 4009
57 Ga0070662_100000606 3300005457 Bacteria 21896
58 Ga0070662_100012879 3300005457 Bacteria 5557
59 Ga0070662_100044727 3300005457 Bacteria 3173
60 Ga0070681_10000049 3300005458 Bacteria 82355
61 Ga0070681_10016253 3300005458 Bacteria 7425
62 Ga0070681_10028948 3300005458 Bacteria 5565
63 Ga0068867_100002681 3300005459 Bacteria 12550
64 Ga0068867_100050511 3300005459 Bacteria 3065
65 Ga0070685_10002075 3300005466 Bacteria 10364
66 Ga0070685_10008454 3300005466 Bacteria 5291
67 Ga0070685_10045634 3300005466 Bacteria 2514
68 Ga0070706_100014904 3300005467 Bacteria 7181
69 Ga0070707_100060734 3300005468 Bacteria 3625
70 Ga0070707_100145776 3300005468 Bacteria 2304
71 Ga0070698_100006374 3300005471 Bacteria 12810
72 Ga0070679_100023601 3300005530 Bacteria 6024
73 Ga0070684_100003253 3300005535 Bacteria 12163
74 Ga0070684_100036603 3300005535 Bacteria 4206
75 Ga0070684_100097418 3300005535 Bacteria 2623
76 Ga0070697_100004760 3300005536 Bacteria 10405
77 Ga0070697_100011023 3300005536 Bacteria 7062
78 Ga0070697_100079332 3300005536 Bacteria 2703
79 Ga0068853_100012940 3300005539 Bacteria 6800
80 Ga0068853_100042496 3300005539 Bacteria 3886
81 Ga0070672_100001108 3300005543 Bacteria 16444
82 Ga0070665_100050106 3300005548 Bacteria 4190
83 Ga0068855_100000397 3300005563 Bacteria 53677
84 Ga0068855_100241475 3300005563 Bacteria 2018
85 Ga0068855_100253973 3300005563 Bacteria 1960
86 Ga0070664_100000468 3300005564 Bacteria 30654
87 Ga0070664_100016591 3300005564 Bacteria 6041
88 Ga0068857_100000474 3300005577 Bacteria 28698
89 Ga0068857_100002144 3300005577 Bacteria 16043
90 Ga0068857_100006761 3300005577 Bacteria 9865
91 Ga0068854_100006743 3300005578 Bacteria 7317
92 Ga0068854_100017349 3300005578 Bacteria 4817
93 Ga0068854_100017784 3300005578 Bacteria 4762
94 Ga0068854_100090199 3300005578 Bacteria 2279
95 Ga0068856_100000475 3300005614 Bacteria 44356
96 Ga0068856_100001356 3300005614 Bacteria 25733
97 Ga0068856_100022439 3300005614 Bacteria 6138
98 Ga0068856_100042985 3300005614 Bacteria 4446
99 Ga0068859_100000610 3300005617 Bacteria 35815
100 Ga0068859_100013091 3300005617 Bacteria 8335
101 Ga0068859_100074414 3300005617 Bacteria 3436
102 Ga0068859_100120306 3300005617 Bacteria 2692
103 Ga0068864_100000254 3300005618 Bacteria 47729
104 Ga0068864_100155958 3300005618 Bacteria 2072
105 Ga0068866_10004350 3300005718 Bacteria 5815
106 Ga0068866_10055300 3300005718 Bacteria 2038
107 Ga0068861_100018819 3300005719 Bacteria 4924
108 Ga0068870_10002067 3300005840 Bacteria 8306
109 Ga0068863_100001455 3300005841 Bacteria 23490
110 Ga0068863_100035905 3300005841 Bacteria 4720
111 Ga0068858_100001715 3300005842 Bacteria 22396
112 Ga0068858_100021338 3300005842 Bacteria 6050
113 Ga0068858_100128045 3300005842 Bacteria 2379
114 Ga0068858_100187304 3300005842 Bacteria 1955
115 Ga0068860_100018606 3300005843 Bacteria 6757
116 Ga0068860_100058031 3300005843 Bacteria 3679
117 Ga0068862_100004516 3300005844 Bacteria 11729
118 Ga0068862_100041028 3300005844 Bacteria 3936
119 Ga0070717_10000592 3300006028 Bacteria 23200
120 Ga0070717_10001318 3300006028 Bacteria 16995
121 Ga0070717_10001531 3300006028 Bacteria 16022
122 Ga0070717_10001886 3300006028 Bacteria 14660
123 Ga0070717_10003158 3300006028 Bacteria 11766
124 Ga0070717_10017256 3300006028 Bacteria 5613
125 Ga0070717_10020896 3300006028 Bacteria 5154
126 Ga0070717_10024378 3300006028 Bacteria 4804
127 Ga0070717_10061795 3300006028 Bacteria 3105
128 Ga0070717_10102003 3300006028 Bacteria 2437
129 Ga0070715_10022939 3300006163 Bacteria 2439
130 Ga0070716_100000267 3300006173 Bacteria 20932
131 Ga0070716_100007322 3300006173 Bacteria 5431
132 Ga0070716_100017437 3300006173 Bacteria 3723
133 Ga0070716_100021054 3300006173 Bacteria 3432
134 Ga0070716_100031095 3300006173 Bacteria 2901
135 Ga0070716_100032935 3300006173 Bacteria 2831
136 Ga0070712_100000088 3300006175 Bacteria 47639
137 Ga0070712_100000132 3300006175 Bacteria 39155
138 Ga0070712_100003349 3300006175 Bacteria 9848
139 Ga0070712_100023595 3300006175 Bacteria 4066
140 Ga0070712_100045453 3300006175 Bacteria 3032
141 Ga0097621_100002464 3300006237 Bacteria 12671
142 Ga0097621_100004628 3300006237 Bacteria 9601
143 Ga0097621_100033980 3300006237 Bacteria 4065
144 Ga0068871_100001432 3300006358 Bacteria 15981
145 Ga0068871_100004051 3300006358 Bacteria 10130
146 Ga0068871_100027803 3300006358 Bacteria 4428
147 Ga0068871_100031093 3300006358 Bacteria 4207
148 Ga0068871_100044606 3300006358 Bacteria 3567
149 Ga0075433_10001798 3300006852 Bacteria 16077
150 Ga0075434_100000005 3300006871 Bacteria 104425
151 Ga0075434_100052287 3300006871 Bacteria 4059
152 Ga0075429_100116585 3300006880 Bacteria 2334
153 Ga0068865_100014196 3300006881 Bacteria 5056
154 Ga0068865_100021575 3300006881 Bacteria 4190
155 Ga0068865_100090128 3300006881 Bacteria 2223
156 Ga0075436_100000519 3300006914 Bacteria 25057
157 Ga0075436_100003852 3300006914 Bacteria 10287
158 Ga0097620_100000610 3300006931 Bacteria 35815
159 Ga0097620_100013092 3300006931 Bacteria 8335
160 Ga0097620_100074412 3300006931 Bacteria 3436
161 Ga0097620_100120296 3300006931 Bacteria 2692
162 Ga0075435_100000382 3300007076 Bacteria 27131
163 Ga0105240_10009159 3300009093 Bacteria 14045
164 Ga0105240_10018495 3300009093 Bacteria 9354
165 Ga0105240_10058784 3300009093 Bacteria 4799
166 Ga0105240_10096964 3300009093 Bacteria 3593
167 Ga0105245_10000286 3300009098 Bacteria 48236
168 Ga0105245_10016952 3300009098 Bacteria 6360
169 Ga0105245_10161543 3300009098 Bacteria 2126
170 Ga0105247_10003938 3300009101 Bacteria 9563
171 Ga0105247_10059440 3300009101 Bacteria 2367
172 Ga0114129_10092308 3300009147 Bacteria 4195
173 Ga0105241_10000466 3300009174 Bacteria 30542
174 Ga0105241_10117251 3300009174 Bacteria 2139
175 Ga0105248_10014713 3300009177 Bacteria 8612
176 Ga0105248_10091864 3300009177 Bacteria 3418
177 Ga0105237_10008702 3300009545 Bacteria 10964
178 Ga0105237_10013010 3300009545 Bacteria 8738
179 Ga0105237_10044551 3300009545 Bacteria 4468
180 Ga0105237_10205941 3300009545 Bacteria 1967
181 Ga0105238_10000330 3300009551 Bacteria 51705
182 Ga0105238_10119522 3300009551 Bacteria 2615
183 Ga0105249_10010728 3300009553 Bacteria 8049
184 Ga0105249_10025556 3300009553 Bacteria 5317
185 Ga0105239_10003317 3300010375 Bacteria 19817
186 Ga0105239_10093824 3300010375 Bacteria 3314
187 Ga0105246_10010283 3300011119 Bacteria 5781
188 Ga0157373_10001706 3300013100 Bacteria 16737
189 Ga0157373_10005582 3300013100 Bacteria 9431
190 Ga0157373_10007960 3300013100 Bacteria 7880
191 Ga0157371_10005132 3300013102 Bacteria 11165
192 Ga0157371_10035631 3300013102 Bacteria 3566
193 Ga0157369_10000860 3300013105 Bacteria 38699
194 Ga0157369_10005095 3300013105 Bacteria 15383
195 Ga0157369_10155310 3300013105 Bacteria 2417
196 Ga0157374_10000488 3300013296 Bacteria 35893
197 Ga0157374_10055287 3300013296 Bacteria 3704
198 Ga0157374_10086084 3300013296 Bacteria 2989
199 Ga0157374_10200285 3300013296 Bacteria 1955
200 Ga0157378_10000023 3300013297 Bacteria 129977
201 Ga0157378_10000668 3300013297 Bacteria 32294
202 Ga0157378_10017669 3300013297 Bacteria 6261
203 Ga0157378_10068292 3300013297 Bacteria 3187
204 Ga0163162_10007607 3300013306 Bacteria 10548
205 Ga0163162_10028062 3300013306 Bacteria 5568
206 Ga0163162_10072653 3300013306 Bacteria 3495
207 Ga0157372_10001973 3300013307 Bacteria 22299
208 Ga0157372_10005618 3300013307 Bacteria 13336
209 Ga0157372_10012803 3300013307 Bacteria 8939
210 Ga0157372_10098422 3300013307 Bacteria 3337
211 Ga0157372_10105433 3300013307 Bacteria 3224
212 Ga0157375_10007404 3300013308 Bacteria 9609
213 Ga0163163_10007397 3300014325 Bacteria 9694
214 Ga0163163_10016651 3300014325 Bacteria 6835
215 Ga0163163_10016704 3300014325 Bacteria 6826
216 Ga0157380_10140857 3300014326 Bacteria 2072
217 Ga0157379_10003428 3300014968 Bacteria 13411
218 Ga0157379_10005228 3300014968 Bacteria 11146
219 Ga0157379_10020965 3300014968 Bacteria 5783
220 Ga0157379_10144687 3300014968 Bacteria 2144
221 Ga0157376_10099302 3300014969 Bacteria 2539
222 Ga0157376_10113186 3300014969 Bacteria 2392
223 Ga0157376_10117723 3300014969 Bacteria 2350
224 Ga0182007_10002525 3300015262 Bacteria 9017
225 Ga0182007_10010108 3300015262 Bacteria 3748
226 Ga0163161_10007734 3300017792 Bacteria 7434
227 Ga0228598_1000009 3300024227 Bacteria 27166
228 Ga0228598_1000804 3300024227 Bacteria 6766
229 Ga0207697_10001694 3300025315 Bacteria 11868
230 Ga0207692_10001150 3300025898 Bacteria 9758
231 Ga0207688_10068618 3300025901 Bacteria 2008
232 Ga0207680_10022436 3300025903 Bacteria 3433
233 Ga0207680_10027493 3300025903 Bacteria 3168
234 Ga0207647_10006376 3300025904 Bacteria 8579
235 Ga0207685_10014114 3300025905 Bacteria 2492
236 Ga0207699_10000602 3300025906 Bacteria 17636
237 Ga0207699_10065020 3300025906 Bacteria 2209
238 Ga0207645_10000038 3300025907 Bacteria 88349
239 Ga0207645_10006628 3300025907 Bacteria 8273
240 Ga0207643_10000356 3300025908 Bacteria 30695
241 Ga0207684_10058447 3300025910 Bacteria 3272
242 Ga0207654_10009120 3300025911 Bacteria 5032
243 Ga0207707_10000233 3300025912 Bacteria 60050
244 Ga0207707_10032736 3300025912 Bacteria 4550
245 Ga0207707_10058610 3300025912 Bacteria 3351
246 Ga0207707_10070194 3300025912 Bacteria 3053
247 Ga0207707_10089089 3300025912 Bacteria 2696
248 Ga0207695_10028523 3300025913 Bacteria 6187
249 Ga0207695_10043846 3300025913 Bacteria 4762
250 Ga0207695_10074485 3300025913 Bacteria 3457
251 Ga0207671_10072807 3300025914 Bacteria 2565
252 Ga0207693_10000053 3300025915 Bacteria 97139
253 Ga0207693_10000071 3300025915 Bacteria 89988
254 Ga0207693_10000167 3300025915 Bacteria 59536
255 Ga0207693_10006661 3300025915 Bacteria 9542
256 Ga0207693_10006971 3300025915 Bacteria 9334
257 Ga0207663_10000880 3300025916 Bacteria 13662
258 Ga0207663_10007885 3300025916 Bacteria 5552
259 Ga0207663_10017264 3300025916 Bacteria 4017
260 Ga0207657_10000363 3300025919 Bacteria 47701
261 Ga0207657_10000960 3300025919 Bacteria 30511
262 Ga0207657_10005318 3300025919 Bacteria 13494
263 Ga0207649_10046579 3300025920 Bacteria 2664
264 Ga0207652_10031579 3300025921 Bacteria 4449
265 Ga0207646_10032519 3300025922 Bacteria 4721
266 Ga0207681_10077981 3300025923 Bacteria 2331
267 Ga0207694_10001856 3300025924 Bacteria 17584
268 Ga0207694_10019005 3300025924 Bacteria 5194
269 Ga0207650_10000122 3300025925 Bacteria 99309
270 Ga0207659_10000774 3300025926 Bacteria 18925
271 Ga0207659_10025598 3300025926 Bacteria 3967
272 Ga0207659_10026750 3300025926 Bacteria 3897
273 Ga0207659_10038224 3300025926 Bacteria 3337
274 Ga0207687_10018438 3300025927 Bacteria 4607
275 Ga0207700_10000089 3300025928 Bacteria 56639
276 Ga0207700_10000151 3300025928 Bacteria 41533
277 Ga0207700_10004873 3300025928 Bacteria 7972
278 Ga0207700_10058410 3300025928 Bacteria 2914
279 Ga0207700_10061603 3300025928 Bacteria 2846
280 Ga0207700_10161261 3300025928 Bacteria 1862
281 Ga0207664_10000076 3300025929 Bacteria 102019
282 Ga0207664_10108735 3300025929 Bacteria 2302
283 Ga0207644_10144070 3300025931 Bacteria 1837
284 Ga0207690_10045724 3300025932 Bacteria 2894
285 Ga0207706_10000722 3300025933 Bacteria 34504
286 Ga0207706_10001660 3300025933 Bacteria 21985
287 Ga0207706_10011140 3300025933 Bacteria 8195
288 Ga0207670_10024295 3300025936 Bacteria 3786
289 Ga0207665_10000275 3300025939 Bacteria 35662
290 Ga0207665_10022252 3300025939 Bacteria 4170
291 Ga0207665_10024226 3300025939 Bacteria 4001
292 Ga0207691_10000716 3300025940 Bacteria 32735
293 Ga0207691_10008421 3300025940 Bacteria 9905
294 Ga0207711_10004740 3300025941 Bacteria 11548
295 Ga0207711_10016062 3300025941 Bacteria 6212
296 Ga0207689_10002336 3300025942 Bacteria 17756
297 Ga0207661_10000202 3300025944 Bacteria 38539
298 Ga0207661_10029966 3300025944 Bacteria 4185
299 Ga0207661_10032410 3300025944 Bacteria 4048
300 Ga0207679_10000070 3300025945 Bacteria 91501
301 Ga0207667_10000742 3300025949 Bacteria 42462
302 Ga0207667_10019737 3300025949 Bacteria 7514
303 Ga0207651_10131079 3300025960 Bacteria 1919
304 Ga0207668_10027793 3300025972 Bacteria 3689
305 Ga0207640_10025290 3300025981 Bacteria 3591
306 Ga0207640_10036757 3300025981 Bacteria 3077
307 Ga0207658_10110097 3300025986 Bacteria 2175
308 Ga0207658_10127047 3300025986 Bacteria 2042
309 Ga0207677_10000542 3300026023 Bacteria 23849
310 Ga0207677_10010668 3300026023 Bacteria 5206
311 Ga0207703_10002657 3300026035 Bacteria 15375
312 Ga0207703_10005062 3300026035 Bacteria 10668
313 Ga0207639_10118819 3300026041 Bacteria 2168
314 Ga0207678_10000405 3300026067 Bacteria 39009
315 Ga0207678_10000551 3300026067 Bacteria 34210
316 Ga0207702_10000770 3300026078 Bacteria 33957
317 Ga0207702_10003718 3300026078 Bacteria 13792
318 Ga0207702_10024621 3300026078 Bacteria 4995
319 Ga0207702_10039878 3300026078 Bacteria 3936
320 Ga0207702_10053654 3300026078 Bacteria 3414
321 Ga0207641_10000020 3300026088 Bacteria 286415
322 Ga0207641_10049173 3300026088 Bacteria 3562
323 Ga0207641_10099599 3300026088 Bacteria 2557
324 Ga0207648_10000218 3300026089 Bacteria 61980
325 Ga0207648_10003120 3300026089 Bacteria 17501
326 Ga0207648_10012638 3300026089 Bacteria 7895
327 Ga0207648_10067967 3300026089 Bacteria 3106
328 Ga0207676_10000101 3300026095 Bacteria 77252
329 Ga0207676_10001486 3300026095 Bacteria 17346
330 Ga0207674_10001286 3300026116 Bacteria 32737
331 Ga0207674_10003389 3300026116 Bacteria 19553
332 Ga0207674_10046060 3300026116 Bacteria 4481
333 Ga0207674_10052110 3300026116 Bacteria 4174
334 Ga0207675_100006938 3300026118 Bacteria 10715
335 Ga0207683_10001067 3300026121 Bacteria 25004
336 Ga0268266_10047767 3300028379 Bacteria 3668
337 Ga0268265_10004877 3300028380 Bacteria 9245
338 Ga0268264_10005505 3300028381 Bacteria 10737
339 Ga0268264_10011856 3300028381 Bacteria 7182
340 Ga0265338_10005802 3300028800 Bacteria 15941
341 Ga0265338_10052732 3300028800 Bacteria 3646
342 Ga0265338_10089449 3300028800 Bacteria 2551
343 Ga0265762_1001888 3300030760 Bacteria 3801
344 Ga0265760_10000222 3300031090 Bacteria 15502
345 Ga0265760_10000239 3300031090 Bacteria 15017
346 Ga0265760_10027537 3300031090 Bacteria 1666
347 Ga0265325_10003428 3300031241 Bacteria 10345
348 Ga0265339_10039798 3300031249 Bacteria 2616
349 Ga0265316_10001955 3300031344 Bacteria 21656
350 Ga0265316_10014337 3300031344 Bacteria 6982
351 Ga0265316_10053060 3300031344 Bacteria 3178
352 Ga0265314_10005456 3300031711 Bacteria 11480
353 Ga0373926_0000852 3300035083 Bacteria 8703
354 Ga0373934_0005970 3300035086 Bacteria 4509
355 Ga0373923_0000556 3300035111 Bacteria 9147
356 Ga0373941_0017571 3300035115 Bacteria 1963
357 Ga0373945_0002009 3300035116 Bacteria 6326
358 Ga0373943_0000439 3300035170 Bacteria 17597
359 Ga0373943_0007936 3300035170 Bacteria 4765
360 Ga0373943_0018000 3300035170 Bacteria 3241
361 Ga0373924_0035790 3300035410 Bacteria 2014
362 Ga0373935_0001099 3300035692 Bacteria 14764
363 Ga0373935_0008300 3300035692 Bacteria 6215
364 Ga0373927_0000340 3300035695 Bacteria 36716
365 Ga0373927_0075126 3300035695 Bacteria 2188
366 Ga0373947_0005132 3300035725 Bacteria 7668
367 Ga0373947_0114985 3300035725 Bacteria 1704
368 Ga0373937_0030323 3300036401 Bacteria 4899
369 Ga0373937_0049556 3300036401 Bacteria 3846
370 Ga0373925_0002487 3300037068 Bacteria 14733
371 Ga0373925_0034059 3300037068 Bacteria 3754
372 Ga0373925_0106775 3300037068 Bacteria 2159
373 Ga0466963_0030641 3300044694 Bacteria 3473
374 Ga0453684_0105673 3300044712 Bacteria 3433
375 Ga0451576_0151953 3300045051 Bacteria 2415
376 Ga0466958_0061602 3300045836 Bacteria 2286
377 Ga0495629_0023722 3300046459 Bacteria 4369
378 Ga0495651_0102759 3300046462 Bacteria 2125
379 Ga0495580_0000108 3300046472 Bacteria 55508
380 Ga0495580_0000487 3300046472 Bacteria 33184
381 Ga0495580_0001591 3300046472 Bacteria 19923
382 Ga0495580_0001925 3300046472 Bacteria 18258
383 Ga0495580_0010473 3300046472 Bacteria 7226
384 Ga0495580_0011518 3300046472 Bacteria 6842
385 Ga0495580_0011562 3300046472 Bacteria 6827
386 Ga0495580_0016556 3300046472 Bacteria 5531
387 Ga0495580_0019053 3300046472 Bacteria 5102
388 Ga0495580_0042046 3300046472 Bacteria 3257
389 Ga0495580_0068608 3300046472 Bacteria 2479
390 Ga0495580_0103463 3300046472 Bacteria 1979
391 Ga0495582_0003008 3300046473 Bacteria 9447
392 Ga0495582_0011945 3300046473 Bacteria 4783
393 Ga0495664_0019246 3300046477 Bacteria 3924
394 Ga0495594_0056200 3300046499 Bacteria 2171
395 Ga0495665_0011277 3300046531 Bacteria 4839
396 Ga0495587_0079833 3300046536 Bacteria 1897
397 Ga0495645_0098986 3300046543 Bacteria 2075
398 Ga0495613_0055830 3300046689 Bacteria 2901
399 Ga0495624_0067815 3300046690 Bacteria 2225
400 Ga0495604_0104173 3300047317 Bacteria 2079
401 Ga0495674_0041215 3300047319 Bacteria 4126
402 Ga0495674_0044397 3300047319 Bacteria 3952
403 Ga0495676_0063391 3300047321 Bacteria 2881
404 Ga0495602_0077537 3300048088 Bacteria 2811
405 Ga0496100_0035212 3300048903 Bacteria 3148
406 Ga0496101_0041123 3300048904 Bacteria 3295
407 Ga0496102_0000542 3300048905 Bacteria 40767
408 Ga0496102_0150778 3300048905 Bacteria 2184
409 Ga0496102_0169042 3300048905 Bacteria 2058
410 Ga0496103_0005309 3300048906 Bacteria 7729
411 Ga0496104_0011286 3300048907 Bacteria 7997
412 Ga0496104_0153079 3300048907 Bacteria 2213
413 Ga0496106_0019701 3300048909 Bacteria 5004
414 Ga0496107_0019754 3300048910 Bacteria 4756
415 Ga0496108_0000559 3300048911 Bacteria 29177
416 Ga0496109_0000018 3300048912 Bacteria 191977
417 Ga0496110_0000049 3300048913 Bacteria 59257
418 Ga0496110_0031011 3300048913 Bacteria 4611
419 Ga0496111_0017770 3300048914 Bacteria 4918
420 Ga0496111_0095341 3300048914 Bacteria 2183
421 Ga0496112_0000058 3300048915 Bacteria 76327
422 Ga0496112_0002030 3300048915 Bacteria 16037
423 Ga0496112_0055252 3300048915 Bacteria 3904
424 Ga0496113_0000103 3300048916 Bacteria 36181
425 Ga0496113_0075819 3300048916 Bacteria 2568
426 Ga0496115_0003303 3300048918 Bacteria 11580
427 nmdc:mga05p37_47568_c1 3300050507 Bacteria 5275
428 nmdc:mga05p37_82270_c1 3300050507 Bacteria 3967
429 nmdc:mga0rr50_452_c1 3300050513 Bacteria 21819
430 nmdc:mga08x19_2808_c1 3300050514 Bacteria 10504
431 nmdc:mga0a205_4432_c1 3300050515 Bacteria 12606
432 Ga0530510_0060386 3300061734 Bacteria 2743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0034059 Ga0373925_0034059_10_1347 413
2 3300006028 Ga0070717_10020896 Ga0070717_100208965 418
3 3300005434 Ga0070709_10021882 Ga0070709_100218822 428
4 3300006173 Ga0070716_100032935 Ga0070716_1000329353 428
5 3300024227 Ga0228598_1000009 Ga0228598_10000094 428
6 3300025915 Ga0207693_10000167 Ga0207693_1000016711 428
7 3300025916 Ga0207663_10007885 Ga0207663_100078855 428
8 3300005471 Ga0070698_100006374 Ga0070698_1000063746 430
9 3300009093 Ga0105240_10058784 Ga0105240_100587844 437
10 3300036401 Ga0373937_0030323 Ga0373937_0030323_479_1984 437
11 3300046536 Ga0495587_0079833 Ga0495587_0079833_296_1801 437
12 3300047317 Ga0495604_0104173 Ga0495604_0104173_507_2012 437
13 3300009177 Ga0105248_10091864 Ga0105248_100918642 439
14 3300024227 Ga0228598_1000804 Ga0228598_10008043 439
15 3300006173 Ga0070716_100031095 Ga0070716_1000310952 440
16 3300006914 Ga0075436_100003852 Ga0075436_1000038528 441
17 3300046472 Ga0495580_0016556 Ga0495580_0016556_2888_4417 441
18 3300050514 nmdc:mga08x19_2808_c1 nmdc:mga08x19_2808_c1_5518_7038 441
19 3300031090 Ga0265760_10027537 Ga0265760_100275371 447
20 3300005536 Ga0070697_100079332 Ga0070697_1000793322 448
21 3300025929 Ga0207664_10108735 Ga0207664_101087352 452
22 3300005331 Ga0070670_100003458 Ga0070670_10000345812 453
23 3300005364 Ga0070673_100165976 Ga0070673_1001659761 453
24 3300005445 Ga0070708_100082695 Ga0070708_1000826952 453
25 3300005459 Ga0068867_100002681 Ga0068867_1000026816 453
26 3300005563 Ga0068855_100000397 Ga0068855_1000003979 453
27 3300005564 Ga0070664_100000468 Ga0070664_10000046814 453
28 3300005577 Ga0068857_100000474 Ga0068857_10000047423 453
29 3300005577 Ga0068857_100006761 Ga0068857_1000067619 453
30 3300005614 Ga0068856_100000475 Ga0068856_10000047514 453
31 3300005614 Ga0068856_100001356 Ga0068856_10000135614 453
32 3300005617 Ga0068859_100000610 Ga0068859_1000006108 453
33 3300005618 Ga0068864_100000254 Ga0068864_10000025432 453
34 3300005842 Ga0068858_100001715 Ga0068858_1000017156 453
35 3300006237 Ga0097621_100004628 Ga0097621_1000046286 453
36 3300006358 Ga0068871_100004051 Ga0068871_1000040515 453
37 3300006931 Ga0097620_100000610 Ga0097620_1000006108 453
38 3300025913 Ga0207695_10043846 Ga0207695_100438463 453
39 3300025924 Ga0207694_10001856 Ga0207694_1000185611 453
40 3300025944 Ga0207661_10029966 Ga0207661_100299663 453
41 3300025949 Ga0207667_10019737 Ga0207667_100197373 453
42 3300026023 Ga0207677_10010668 Ga0207677_100106682 453
43 3300026035 Ga0207703_10002657 Ga0207703_1000265713 453
44 3300026041 Ga0207639_10118819 Ga0207639_101188192 453
45 3300026078 Ga0207702_10000770 Ga0207702_100007706 453
46 3300026089 Ga0207648_10003120 Ga0207648_1000312013 453
47 3300026095 Ga0207676_10001486 Ga0207676_100014863 453
48 3300026116 Ga0207674_10003389 Ga0207674_1000338914 453
49 3300005353 Ga0070669_100056155 Ga0070669_1000561552 457
50 3300025923 Ga0207681_10077981 Ga0207681_100779812 457
51 3300025906 Ga0207699_10065020 Ga0207699_100650202 459
52 3300050507 nmdc:mga05p37_82270_c1 nmdc:mga05p37_82270_c1_1529_3043 459
53 3300005340 Ga0070689_100016196 Ga0070689_1000161965 460
54 3300005354 Ga0070675_100001363 Ga0070675_1000013633 460
55 3300005367 Ga0070667_100054874 Ga0070667_1000548742 460
56 3300005434 Ga0070709_10009622 Ga0070709_100096223 460
57 3300005436 Ga0070713_100000123 Ga0070713_10000012316 460
58 3300005437 Ga0070710_10022560 Ga0070710_100225603 460
59 3300005466 Ga0070685_10008454 Ga0070685_100084542 460
60 3300005617 Ga0068859_100074414 Ga0068859_1000744143 460
61 3300005618 Ga0068864_100155958 Ga0068864_1001559582 460
62 3300006173 Ga0070716_100017437 Ga0070716_1000174372 460
63 3300006175 Ga0070712_100000088 Ga0070712_1000000888 460
64 3300006237 Ga0097621_100002464 Ga0097621_1000024647 460
65 3300006358 Ga0068871_100001432 Ga0068871_1000014329 460
66 3300006931 Ga0097620_100074412 Ga0097620_1000744123 460
67 3300009098 Ga0105245_10000286 Ga0105245_1000028620 460
68 3300013297 Ga0157378_10000023 Ga0157378_1000002397 460
69 3300014326 Ga0157380_10140857 Ga0157380_101408572 460
70 3300025906 Ga0207699_10000602 Ga0207699_100006022 460
71 3300025915 Ga0207693_10000071 Ga0207693_1000007137 460
72 3300025926 Ga0207659_10026750 Ga0207659_100267504 460
73 3300025928 Ga0207700_10000089 Ga0207700_1000008932 460
74 3300025939 Ga0207665_10024226 Ga0207665_100242262 460
75 3300026089 Ga0207648_10067967 Ga0207648_100679673 460
76 3300005331 Ga0070670_100010320 Ga0070670_1000103203 461
77 3300005335 Ga0070666_10029655 Ga0070666_100296552 461
78 3300005354 Ga0070675_100000090 Ga0070675_1000000902 461
79 3300005367 Ga0070667_100023665 Ga0070667_1000236656 461
80 3300005466 Ga0070685_10045634 Ga0070685_100456342 461
81 3300005543 Ga0070672_100001108 Ga0070672_1000011088 461
82 3300005617 Ga0068859_100120306 Ga0068859_1001203062 461
83 3300005841 Ga0068863_100001455 Ga0068863_10000145515 461
84 3300005842 Ga0068858_100021338 Ga0068858_1000213387 461
85 3300005843 Ga0068860_100018606 Ga0068860_1000186062 461
86 3300006237 Ga0097621_100033980 Ga0097621_1000339801 461
87 3300006931 Ga0097620_100120296 Ga0097620_1001202962 461
88 3300009093 Ga0105240_10018495 Ga0105240_100184953 461
89 3300009098 Ga0105245_10161543 Ga0105245_101615432 461
90 3300013308 Ga0157375_10007404 Ga0157375_100074046 461
91 3300014325 Ga0163163_10016704 Ga0163163_100167046 461
92 3300014968 Ga0157379_10005228 Ga0157379_100052282 461
93 3300025940 Ga0207691_10008421 Ga0207691_100084213 461
94 3300025986 Ga0207658_10110097 Ga0207658_101100972 461
95 3300026035 Ga0207703_10005062 Ga0207703_100050624 461
96 3300026088 Ga0207641_10099599 Ga0207641_100995992 461
97 3300028381 Ga0268264_10005505 Ga0268264_1000550511 461
98 3300028381 Ga0268264_10011856 Ga0268264_100118566 461
99 3300028800 Ga0265338_10005802 Ga0265338_100058023 461
100 3300046472 Ga0495580_0010473 Ga0495580_0010473_1353_2873 461
101 3300048903 Ga0496100_0035212 Ga0496100_0035212_1651_3126 461
102 3300013307 Ga0157372_10098422 Ga0157372_100984223 462
103 3300005468 Ga0070707_100145776 Ga0070707_1001457762 463
104 3300005436 Ga0070713_100002212 Ga0070713_1000022128 464
105 3300006880 Ga0075429_100116585 Ga0075429_1001165852 464
106 3300009147 Ga0114129_10092308 Ga0114129_100923082 464
107 3300025928 Ga0207700_10004873 Ga0207700_100048734 464
108 3300046472 Ga0495580_0001925 Ga0495580_0001925_668_2158 464
109 3300050507 nmdc:mga05p37_47568_c1 nmdc:mga05p37_47568_c1_3231_4745 464
110 3300006175 Ga0070712_100045453 Ga0070712_1000454533 465
111 3300025924 Ga0207694_10019005 Ga0207694_100190051 465
112 3300044694 Ga0466963_0030641 Ga0466963_0030641_1652_3160 465
113 3300046472 Ga0495580_0000487 Ga0495580_0000487_9205_10725 465
114 3300046499 Ga0495594_0056200 Ga0495594_0056200_464_1984 465
115 3300005354 Ga0070675_100000873 Ga0070675_1000008737 466
116 3300005435 Ga0070714_100184638 Ga0070714_1001846382 466
117 3300005436 Ga0070713_100005042 Ga0070713_1000050427 466
118 3300005436 Ga0070713_100021243 Ga0070713_1000212434 466
119 3300006028 Ga0070717_10024378 Ga0070717_100243783 466
120 3300006881 Ga0068865_100090128 Ga0068865_1000901282 466
121 3300013306 Ga0163162_10007607 Ga0163162_100076075 466
122 3300014325 Ga0163163_10007397 Ga0163163_100073972 466
123 3300025926 Ga0207659_10000774 Ga0207659_1000077413 466
124 3300046472 Ga0495580_0042046 Ga0495580_0042046_1650_3146 466
125 3300005329 Ga0070683_100049382 Ga0070683_1000493823 467
126 3300005335 Ga0070666_10023589 Ga0070666_100235894 467
127 3300005336 Ga0070680_100186159 Ga0070680_1001861591 467
128 3300005338 Ga0068868_100008261 Ga0068868_1000082615 467
129 3300005338 Ga0068868_100072941 Ga0068868_1000729412 467
130 3300005339 Ga0070660_100038642 Ga0070660_1000386421 467
131 3300005366 Ga0070659_100023246 Ga0070659_1000232462 467
132 3300005367 Ga0070667_100036737 Ga0070667_1000367371 467
133 3300005436 Ga0070713_100078290 Ga0070713_1000782903 467
134 3300005445 Ga0070708_100071812 Ga0070708_1000718122 467
135 3300005457 Ga0070662_100000606 Ga0070662_1000006069 467
136 3300005458 Ga0070681_10000049 Ga0070681_1000004956 467
137 3300005458 Ga0070681_10016253 Ga0070681_100162533 467
138 3300005458 Ga0070681_10028948 Ga0070681_100289482 467
139 3300005530 Ga0070679_100023601 Ga0070679_1000236015 467
140 3300005535 Ga0070684_100036603 Ga0070684_1000366032 467
141 3300005535 Ga0070684_100097418 Ga0070684_1000974181 467
142 3300005548 Ga0070665_100050106 Ga0070665_1000501065 467
143 3300005563 Ga0068855_100253973 Ga0068855_1002539731 467
144 3300005578 Ga0068854_100006743 Ga0068854_1000067433 467
145 3300005578 Ga0068854_100090199 Ga0068854_1000901991 467
146 3300005614 Ga0068856_100022439 Ga0068856_1000224393 467
147 3300005718 Ga0068866_10055300 Ga0068866_100553002 467
148 3300005841 Ga0068863_100035905 Ga0068863_1000359052 467
149 3300005842 Ga0068858_100128045 Ga0068858_1001280451 467
150 3300005842 Ga0068858_100187304 Ga0068858_1001873041 467
151 3300005844 Ga0068862_100041028 Ga0068862_1000410282 467
152 3300006028 Ga0070717_10001318 Ga0070717_1000131811 467
153 3300006358 Ga0068871_100027803 Ga0068871_1000278034 467
154 3300006358 Ga0068871_100044606 Ga0068871_1000446063 467
155 3300006871 Ga0075434_100052287 Ga0075434_1000522874 467
156 3300006881 Ga0068865_100021575 Ga0068865_1000215752 467
157 3300009093 Ga0105240_10009159 Ga0105240_1000915910 467
158 3300009101 Ga0105247_10059440 Ga0105247_100594401 467
159 3300009177 Ga0105248_10014713 Ga0105248_100147136 467
160 3300009545 Ga0105237_10205941 Ga0105237_102059411 467
161 3300009551 Ga0105238_10000330 Ga0105238_1000033016 467
162 3300009551 Ga0105238_10119522 Ga0105238_101195222 467
163 3300009553 Ga0105249_10025556 Ga0105249_100255563 467
164 3300010375 Ga0105239_10093824 Ga0105239_100938242 467
165 3300013100 Ga0157373_10007960 Ga0157373_100079606 467
166 3300013102 Ga0157371_10035631 Ga0157371_100356312 467
167 3300013105 Ga0157369_10000860 Ga0157369_1000086012 467
168 3300013105 Ga0157369_10155310 Ga0157369_101553102 467
169 3300013296 Ga0157374_10000488 Ga0157374_1000048822 467
170 3300013297 Ga0157378_10000668 Ga0157378_1000066822 467
171 3300013297 Ga0157378_10017669 Ga0157378_100176696 467
172 3300013306 Ga0163162_10072653 Ga0163162_100726533 467
173 3300013307 Ga0157372_10001973 Ga0157372_1000197319 467
174 3300013307 Ga0157372_10005618 Ga0157372_100056186 467
175 3300013307 Ga0157372_10105433 Ga0157372_101054333 467
176 3300014969 Ga0157376_10099302 Ga0157376_100993022 467
177 3300014969 Ga0157376_10113186 Ga0157376_101131862 467
178 3300025903 Ga0207680_10027493 Ga0207680_100274932 467
179 3300025907 Ga0207645_10006628 Ga0207645_100066285 467
180 3300025912 Ga0207707_10000233 Ga0207707_1000023337 467
181 3300025912 Ga0207707_10058610 Ga0207707_100586102 467
182 3300025912 Ga0207707_10089089 Ga0207707_100890892 467
183 3300025913 Ga0207695_10028523 Ga0207695_100285233 467
184 3300025914 Ga0207671_10072807 Ga0207671_100728072 467
185 3300025919 Ga0207657_10000960 Ga0207657_1000096022 467
186 3300025921 Ga0207652_10031579 Ga0207652_100315794 467
187 3300025926 Ga0207659_10038224 Ga0207659_100382244 467
188 3300025928 Ga0207700_10061603 Ga0207700_100616032 467
189 3300025932 Ga0207690_10045724 Ga0207690_100457243 467
190 3300025933 Ga0207706_10000722 Ga0207706_1000072223 467
191 3300025941 Ga0207711_10004740 Ga0207711_100047408 467
192 3300025944 Ga0207661_10032410 Ga0207661_100324104 467
193 3300025949 Ga0207667_10000742 Ga0207667_1000074235 467
194 3300025960 Ga0207651_10131079 Ga0207651_101310791 467
195 3300025972 Ga0207668_10027793 Ga0207668_100277933 467
196 3300025981 Ga0207640_10025290 Ga0207640_100252902 467
197 3300025981 Ga0207640_10036757 Ga0207640_100367572 467
198 3300025986 Ga0207658_10127047 Ga0207658_101270472 467
199 3300026023 Ga0207677_10000542 Ga0207677_1000054214 467
200 3300026067 Ga0207678_10000405 Ga0207678_1000040531 467
201 3300026078 Ga0207702_10024621 Ga0207702_100246214 467
202 3300026089 Ga0207648_10012638 Ga0207648_100126383 467
203 3300026116 Ga0207674_10046060 Ga0207674_100460602 467
204 3300026116 Ga0207674_10052110 Ga0207674_100521103 467
205 3300028379 Ga0268266_10047767 Ga0268266_100477673 467
206 3300035115 Ga0373941_0017571 Ga0373941_0017571_218_1726 467
207 3300045051 Ga0451576_0151953 Ga0451576_0151953_18_1526 467
208 3300048905 Ga0496102_0150778 Ga0496102_0150778_33_1535 467
209 3300048913 Ga0496110_0031011 Ga0496110_0031011_2092_3600 467
210 3300048915 Ga0496112_0002030 Ga0496112_0002030_12205_13707 467
211 3300048915 Ga0496112_0055252 Ga0496112_0055252_622_2124 467
212 3300048916 Ga0496113_0075819 Ga0496113_0075819_222_1730 467
213 3300005536 Ga0070697_100011023 Ga0070697_1000110237 468
214 3300009174 Ga0105241_10000466 Ga0105241_1000046623 468
215 3300009545 Ga0105237_10013010 Ga0105237_100130102 468
216 3300013100 Ga0157373_10001706 Ga0157373_1000170613 468
217 3300013105 Ga0157369_10005095 Ga0157369_100050956 468
218 3300013296 Ga0157374_10055287 Ga0157374_100552873 468
219 3300025911 Ga0207654_10009120 Ga0207654_100091203 468
220 3300025912 Ga0207707_10070194 Ga0207707_100701942 468
221 3300026078 Ga0207702_10003718 Ga0207702_1000371812 468
222 3300030760 Ga0265762_1001888 Ga0265762_10018883 468
223 3300031344 Ga0265316_10053060 Ga0265316_100530602 468
224 3300046690 Ga0495624_0067815 Ga0495624_0067815_769_2184 468
225 3300005340 Ga0070689_100064990 Ga0070689_1000649901 469
226 3300006028 Ga0070717_10003158 Ga0070717_100031588 469
227 3300006173 Ga0070716_100021054 Ga0070716_1000210543 469
228 3300006914 Ga0075436_100000519 Ga0075436_10000051912 469
229 3300025928 Ga0207700_10058410 Ga0207700_100584101 469
230 3300028800 Ga0265338_10089449 Ga0265338_100894492 469
231 3300035083 Ga0373926_0000852 Ga0373926_0000852_4049_5554 469
232 3300035170 Ga0373943_0007936 Ga0373943_0007936_1437_2942 469
233 3300035692 Ga0373935_0008300 Ga0373935_0008300_307_1812 469
234 3300037068 Ga0373925_0002487 Ga0373925_0002487_1265_2770 469
235 3300044712 Ga0453684_0105673 Ga0453684_0105673_1681_3207 469
236 3300046472 Ga0495580_0019053 Ga0495580_0019053_1692_3197 469
237 3300046473 Ga0495582_0003008 Ga0495582_0003008_3984_5489 469
238 3300046531 Ga0495665_0011277 Ga0495665_0011277_2330_3835 469
239 3300005336 Ga0070680_100063689 Ga0070680_1000636893 470
240 3300005435 Ga0070714_100003667 Ga0070714_1000036676 471
241 3300006028 Ga0070717_10061795 Ga0070717_100617952 471
242 3300061734 Ga0530510_0060386 Ga0530510_0060386_41_1570 471
243 3300006028 Ga0070717_10001531 Ga0070717_1000153111 473
244 3300013307 Ga0157372_10012803 Ga0157372_100128031 473
245 3300014968 Ga0157379_10003428 Ga0157379_100034282 473
246 3300031344 Ga0265316_10001955 Ga0265316_100019557 473
247 3300031711 Ga0265314_10005456 Ga0265314_100054562 473
248 3300045836 Ga0466958_0061602 Ga0466958_0061602_258_1790 473
249 3300046462 Ga0495651_0102759 Ga0495651_0102759_581_2092 473
250 3300048904 Ga0496101_0041123 Ga0496101_0041123_302_1804 473
251 3300048905 Ga0496102_0000542 Ga0496102_0000542_34376_35878 473
252 3300048906 Ga0496103_0005309 Ga0496103_0005309_3153_4655 473
253 3300048907 Ga0496104_0011286 Ga0496104_0011286_1647_3149 473
254 3300005439 Ga0070711_100041861 Ga0070711_1000418613 474
255 3300006163 Ga0070715_10022939 Ga0070715_100229393 474
256 3300006173 Ga0070716_100000267 Ga0070716_10000026715 474
257 3300006175 Ga0070712_100023595 Ga0070712_1000235953 474
258 3300025905 Ga0207685_10014114 Ga0207685_100141143 474
259 3300025915 Ga0207693_10006971 Ga0207693_100069716 474
260 3300025939 Ga0207665_10000275 Ga0207665_100002757 474
261 3300046472 Ga0495580_0068608 Ga0495580_0068608_361_1866 474
262 3300005536 Ga0070697_100004760 Ga0070697_1000047608 475
263 3300025898 Ga0207692_10001150 Ga0207692_100011504 475
264 3300035170 Ga0373943_0018000 Ga0373943_0018000_863_2410 475
265 3300035725 Ga0373947_0114985 Ga0373947_0114985_75_1622 475
266 3300037068 Ga0373925_0106775 Ga0373925_0106775_133_1680 475
267 3300005468 Ga0070707_100060734 Ga0070707_1000607341 476
268 3300006028 Ga0070717_10000592 Ga0070717_100005925 476
269 3300006852 Ga0075433_10001798 Ga0075433_1000179817 476
270 3300006871 Ga0075434_100000005 Ga0075434_10000000582 476
271 3300007076 Ga0075435_100000382 Ga0075435_1000003828 476
272 3300025922 Ga0207646_10032519 Ga0207646_100325192 476
273 3300046472 Ga0495580_0011562 Ga0495580_0011562_4531_6042 476
274 3300050513 nmdc:mga0rr50_452_c1 nmdc:mga0rr50_452_c1_19894_21426 476
275 3300050515 nmdc:mga0a205_4432_c1 nmdc:mga0a205_4432_c1_292_1824 476
276 3300005467 Ga0070706_100014904 Ga0070706_1000149046 477
277 3300025910 Ga0207684_10058447 Ga0207684_100584473 477
278 3300031090 Ga0265760_10000239 Ga0265760_100002398 477
279 3300046459 Ga0495629_0023722 Ga0495629_0023722_1428_2957 477
280 3300046472 Ga0495580_0000108 Ga0495580_0000108_42875_44404 477
281 3300046473 Ga0495582_0011945 Ga0495582_0011945_2216_3745 477
282 3300046689 Ga0495613_0055830 Ga0495613_0055830_48_1577 477
283 3300005327 Ga0070658_10128734 Ga0070658_101287342 478
284 3300005445 Ga0070708_100023165 Ga0070708_1000231655 478
285 3300005457 Ga0070662_100012879 Ga0070662_1000128791 478
286 3300005539 Ga0068853_100042496 Ga0068853_1000424963 478
287 3300005563 Ga0068855_100241475 Ga0068855_1002414752 478
288 3300005564 Ga0070664_100016591 Ga0070664_1000165916 478
289 3300005578 Ga0068854_100017349 Ga0068854_1000173494 478
290 3300009545 Ga0105237_10044551 Ga0105237_100445515 478
291 3300013296 Ga0157374_10200285 Ga0157374_102002851 478
292 3300013297 Ga0157378_10068292 Ga0157378_100682922 478
293 3300025919 Ga0207657_10005318 Ga0207657_100053188 478
294 3300025920 Ga0207649_10046579 Ga0207649_100465792 478
295 3300025933 Ga0207706_10011140 Ga0207706_100111402 478
296 3300026078 Ga0207702_10053654 Ga0207702_100536542 478
297 3300031090 Ga0265760_10000222 Ga0265760_1000022216 478
298 3300048909 Ga0496106_0019701 Ga0496106_0019701_2290_3816 478
299 3300048910 Ga0496107_0019754 Ga0496107_0019754_3192_4718 478
300 3300048914 Ga0496111_0095341 Ga0496111_0095341_283_1809 478
301 3300006028 Ga0070717_10017256 Ga0070717_100172565 479
302 3300006175 Ga0070712_100003349 Ga0070712_1000033493 479
303 3300009093 Ga0105240_10096964 Ga0105240_100969642 479
304 3300014969 Ga0157376_10117723 Ga0157376_101177232 479
305 3300025913 Ga0207695_10074485 Ga0207695_100744853 479
306 3300025915 Ga0207693_10006661 Ga0207693_100066613 479
307 3300026088 Ga0207641_10049173 Ga0207641_100491733 479
308 3300036401 Ga0373937_0049556 Ga0373937_0049556_1755_3278 479
309 3300046472 Ga0495580_0011518 Ga0495580_0011518_3557_5077 479
310 3300048907 Ga0496104_0153079 Ga0496104_0153079_514_2037 479
311 3300005434 Ga0070709_10031118 Ga0070709_100311183 480
312 3300046472 Ga0495580_0001591 Ga0495580_0001591_7473_9008 480
313 3300048905 Ga0496102_0169042 Ga0496102_0169042_275_1804 480
314 3300005434 Ga0070709_10007091 Ga0070709_100070911 481
315 3300005436 Ga0070713_100187726 Ga0070713_1001877262 481
316 3300006028 Ga0070717_10102003 Ga0070717_101020032 481
317 3300013296 Ga0157374_10086084 Ga0157374_100860842 481
318 3300013306 Ga0163162_10028062 Ga0163162_100280623 481
319 3300014968 Ga0157379_10144687 Ga0157379_101446872 481
320 3300015262 Ga0182007_10010108 Ga0182007_100101084 481
321 3300025912 Ga0207707_10032736 Ga0207707_100327364 481
322 3300025916 Ga0207663_10017264 Ga0207663_100172644 481
323 3300025928 Ga0207700_10161261 Ga0207700_101612611 481
324 3300025929 Ga0207664_10000076 Ga0207664_1000007636 481
325 3300028800 Ga0265338_10052732 Ga0265338_100527322 481
326 3300035111 Ga0373923_0000556 Ga0373923_0000556_988_2523 481
327 3300035116 Ga0373945_0002009 Ga0373945_0002009_2411_3946 481
328 3300035170 Ga0373943_0000439 Ga0373943_0000439_7225_8760 481
329 3300035692 Ga0373935_0001099 Ga0373935_0001099_10159_11694 481
330 3300035695 Ga0373927_0000340 Ga0373927_0000340_4681_6216 481
331 3300035725 Ga0373947_0005132 Ga0373947_0005132_2944_4479 481
332 3300046472 Ga0495580_0103463 Ga0495580_0103463_394_1923 481
333 3300046477 Ga0495664_0019246 Ga0495664_0019246_98_1633 481
334 3300047319 Ga0495674_0041215 Ga0495674_0041215_1487_3022 481
335 3300047321 Ga0495676_0063391 Ga0495676_0063391_226_1761 481
336 3300048088 Ga0495602_0077537 Ga0495602_0077537_731_2266 481
337 3300005434 Ga0070709_10027582 Ga0070709_100275822 482
338 3300005436 Ga0070713_100000178 Ga0070713_10000017810 482
339 3300005439 Ga0070711_100001975 Ga0070711_1000019756 482
340 3300006028 Ga0070717_10001886 Ga0070717_100018868 482
341 3300006173 Ga0070716_100007322 Ga0070716_1000073225 482
342 3300006175 Ga0070712_100000132 Ga0070712_10000013211 482
343 3300025915 Ga0207693_10000053 Ga0207693_1000005312 482
344 3300025916 Ga0207663_10000880 Ga0207663_100008807 482
345 3300025928 Ga0207700_10000151 Ga0207700_1000015135 482
346 3300025939 Ga0207665_10022252 Ga0207665_100222522 482
347 3300031241 Ga0265325_10003428 Ga0265325_100034287 482
348 3300031249 Ga0265339_10039798 Ga0265339_100397983 482
349 3300031344 Ga0265316_10014337 Ga0265316_100143373 482
350 3300035086 Ga0373934_0005970 Ga0373934_0005970_1900_3429 482
351 3300035410 Ga0373924_0035790 Ga0373924_0035790_413_1942 482
352 3300035695 Ga0373927_0075126 Ga0373927_0075126_243_1772 482
353 3300046543 Ga0495645_0098986 Ga0495645_0098986_66_1595 482
354 3300047319 Ga0495674_0044397 Ga0495674_0044397_2315_3844 482
355 3300048918 Ga0496115_0003303 Ga0496115_0003303_7185_8714 482
356 3300005445 Ga0070708_100063181 Ga0070708_1000631813 483
357 3300009174 Ga0105241_10117251 Ga0105241_101172511 483
358 3300002459 JGI24751J29686_10000800 JGI24751J29686_100008002 484
359 3300005327 Ga0070658_10013389 Ga0070658_100133894 484
360 3300005329 Ga0070683_100042185 Ga0070683_1000421851 484
361 3300005331 Ga0070670_100022721 Ga0070670_1000227215 484
362 3300005334 Ga0068869_100015521 Ga0068869_1000155214 484
363 3300005337 Ga0070682_100010222 Ga0070682_1000102224 484
364 3300005338 Ga0068868_100006232 Ga0068868_1000062325 484
365 3300005340 Ga0070689_100004268 Ga0070689_1000042682 484
366 3300005344 Ga0070661_100007361 Ga0070661_1000073616 484
367 3300005347 Ga0070668_100010766 Ga0070668_1000107663 484
368 3300005353 Ga0070669_100003235 Ga0070669_1000032354 484
369 3300005366 Ga0070659_100004349 Ga0070659_1000043492 484
370 3300005456 Ga0070678_100025006 Ga0070678_1000250061 484
371 3300005457 Ga0070662_100044727 Ga0070662_1000447273 484
372 3300005459 Ga0068867_100050511 Ga0068867_1000505112 484
373 3300005466 Ga0070685_10002075 Ga0070685_100020752 484
374 3300005535 Ga0070684_100003253 Ga0070684_1000032535 484
375 3300005539 Ga0068853_100012940 Ga0068853_1000129402 484
376 3300005577 Ga0068857_100002144 Ga0068857_1000021447 484
377 3300005578 Ga0068854_100017784 Ga0068854_1000177842 484
378 3300005614 Ga0068856_100042985 Ga0068856_1000429852 484
379 3300005617 Ga0068859_100013091 Ga0068859_1000130917 484
380 3300005718 Ga0068866_10004350 Ga0068866_100043506 484
381 3300005719 Ga0068861_100018819 Ga0068861_1000188195 484
382 3300005840 Ga0068870_10002067 Ga0068870_100020677 484
383 3300005843 Ga0068860_100058031 Ga0068860_1000580314 484
384 3300005844 Ga0068862_100004516 Ga0068862_1000045166 484
385 3300006358 Ga0068871_100031093 Ga0068871_1000310934 484
386 3300006881 Ga0068865_100014196 Ga0068865_1000141962 484
387 3300006931 Ga0097620_100013092 Ga0097620_1000130921 484
388 3300009098 Ga0105245_10016952 Ga0105245_100169525 484
389 3300009101 Ga0105247_10003938 Ga0105247_100039387 484
390 3300009545 Ga0105237_10008702 Ga0105237_100087028 484
391 3300009553 Ga0105249_10010728 Ga0105249_100107286 484
392 3300010375 Ga0105239_10003317 Ga0105239_100033178 484
393 3300011119 Ga0105246_10010283 Ga0105246_100102832 484
394 3300013100 Ga0157373_10005582 Ga0157373_100055824 484
395 3300013102 Ga0157371_10005132 Ga0157371_100051322 484
396 3300014325 Ga0163163_10016651 Ga0163163_100166516 484
397 3300014968 Ga0157379_10020965 Ga0157379_100209653 484
398 3300015262 Ga0182007_10002525 Ga0182007_100025255 484
399 3300017792 Ga0163161_10007734 Ga0163161_100077344 484
400 3300025315 Ga0207697_10001694 Ga0207697_100016945 484
401 3300025901 Ga0207688_10068618 Ga0207688_100686182 484
402 3300025903 Ga0207680_10022436 Ga0207680_100224363 484
403 3300025904 Ga0207647_10006376 Ga0207647_100063768 484
404 3300025907 Ga0207645_10000038 Ga0207645_1000003881 484
405 3300025908 Ga0207643_10000356 Ga0207643_100003567 484
406 3300025919 Ga0207657_10000363 Ga0207657_1000036333 484
407 3300025925 Ga0207650_10000122 Ga0207650_1000012263 484
408 3300025926 Ga0207659_10025598 Ga0207659_100255984 484
409 3300025927 Ga0207687_10018438 Ga0207687_100184383 484
410 3300025931 Ga0207644_10144070 Ga0207644_101440701 484
411 3300025933 Ga0207706_10001660 Ga0207706_1000166015 484
412 3300025936 Ga0207670_10024295 Ga0207670_100242954 484
413 3300025940 Ga0207691_10000716 Ga0207691_1000071621 484
414 3300025941 Ga0207711_10016062 Ga0207711_100160626 484
415 3300025942 Ga0207689_10002336 Ga0207689_1000233611 484
416 3300025944 Ga0207661_10000202 Ga0207661_1000020220 484
417 3300025945 Ga0207679_10000070 Ga0207679_1000007048 484
418 3300026067 Ga0207678_10000551 Ga0207678_1000055111 484
419 3300026078 Ga0207702_10039878 Ga0207702_100398782 484
420 3300026088 Ga0207641_10000020 Ga0207641_10000020141 484
421 3300026089 Ga0207648_10000218 Ga0207648_1000021852 484
422 3300026095 Ga0207676_10000101 Ga0207676_1000010145 484
423 3300026116 Ga0207674_10001286 Ga0207674_1000128621 484
424 3300026118 Ga0207675_100006938 Ga0207675_1000069386 484
425 3300026121 Ga0207683_10001067 Ga0207683_1000106711 484
426 3300028380 Ga0268265_10004877 Ga0268265_100048774 484
427 3300048911 Ga0496108_0000559 Ga0496108_0000559_4488_6023 484
428 3300048912 Ga0496109_0000018 Ga0496109_0000018_136655_138190 484
429 3300048913 Ga0496110_0000049 Ga0496110_0000049_19097_20632 484
430 3300048914 Ga0496111_0017770 Ga0496111_0017770_2810_4345 484
431 3300048915 Ga0496112_0000058 Ga0496112_0000058_26302_27837 484
432 3300048916 Ga0496113_0000103 Ga0496113_0000103_33031_34566 484

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

10

119

0.99

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

345

452

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

124

333

0.99

PF02222

ATP-grasp

ATP-grasp domain

133

303

0.87

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

132

302

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8d-assembly2.cif.gz_B crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli 0.9623 1 412
5mlk-assembly1.cif.gz_A biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9607 2 411
2vr1-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p. 0.959 1 416
1dv2-assembly2.cif.gz_B the structure of biotin carboxylase, mutant e288k, complexed with atp 0.9587 1 417
2j9g-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with amppnp and adp 0.9581 1 416
ID Description Score Start End Superfamily
af_P96890_142_212_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9824 132 198 3.30.1490.20
af_A0A2R8PV58_38_157_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.97 13 131 3.40.50.20
af_P9WPQ3_1_451_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9683 1 417 3.30.470.20
af_Q54KE6_162_230_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9665 138 198 3.30.1490.20
af_A0A1D8PDC6_745_814_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9665 132 198 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A800J9M9-F1-model_v4 3-methylcrotonyl-CoA carboxylase 0.988 1 114 GO:0005524
GO:0016874
AF-A0A2M8PKW1-F1-model_v4 3-methylcrotonyl-CoA carboxylase 0.9859 1 105 GO:0005524
GO:0016874
AF-A0A0A9Z556-F1-model_v4 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial 0.9858 2 110 GO:0004485
GO:0005524
GO:0005739
AF-A0A3M1P1Z5-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 0.9848 3 74 GO:0003989
GO:0005524
AF-A0A0V0H4E4-F1-model_v4 Putative ovule protein 0.9847 2 116 GO:0004485
GO:0005524
GO:0005739

Feature Viewer

pLDDT pTM Quality
82.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map