F442540

General Info

Members Datasets Scaffolds Average Seq Length
432 234 864 256

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100253175|Ga0070714_1002531752
Length 277
Sequence LDELGDLPEFLSGFEAMSIQAASKLARLSMEVNAPIAGITLSNPPLNVIDIPMMEELAAALAEVEAQARISVIVFRGSGQSFSAGVDVGAHTPDKVSSMLEKFHAVIRALVATQKVTIAVVRGNCLGGGAELAMVCDLVYTSRDAKWGFPEIQLGCFPPIAVTGLAALVGQKCASDLVLTGRTISGEHAGRIGLANEAVASDQLEVVTQDAVDRLAALSPAALAIAKKASYAWDSMHFDKGLARAEKIYLDELMRTEDAQEGIRAFLEKRNPRWTGR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.24
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 17.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100253175 3300005435 Bacteria 1629
2 MBSR1b_contig_8676116 2162886012 Unclassified 2067
3 JGI24752J21851_1000366 3300001976 Bacteria 6294
4 JGI24748J21848_1011805 3300002074 Unclassified 1029
5 Ga0065712_10080331 3300005290 Unclassified 3118
6 Ga0065712_10087565 3300005290 Bacteria 2569
7 Ga0065715_10142054 3300005293 Unclassified 1839
8 Ga0070658_10127228 3300005327 Unclassified 2121
9 Ga0070676_10004891 3300005328 Bacteria 7099
10 Ga0070676_10009104 3300005328 Bacteria 5371
11 Ga0070683_100006792 3300005329 Bacteria 9616
12 Ga0070690_100027309 3300005330 Bacteria 3528
13 Ga0070690_100117937 3300005330 Bacteria 1778
14 Ga0070670_100444564 3300005331 Bacteria 1148
15 Ga0070677_10001533 3300005333 Bacteria 7313
16 Ga0070677_10088927 3300005333 Bacteria 1339
17 Ga0068869_100060504 3300005334 Bacteria 2776
18 Ga0068869_100093697 3300005334 Bacteria 2263
19 Ga0070666_10265592 3300005335 Unclassified 1217
20 Ga0070682_100020165 3300005337 Bacteria 3920
21 Ga0070682_100411377 3300005337 Unclassified 1025
22 Ga0068868_100000843 3300005338 Bacteria 20760
23 Ga0068868_100046894 3300005338 Bacteria 3383
24 Ga0070660_100009291 3300005339 Bacteria 6910
25 Ga0070660_100053324 3300005339 Bacteria 3119
26 Ga0070689_100083827 3300005340 Bacteria 2505
27 Ga0070689_100173011 3300005340 Unclassified 1750
28 Ga0070687_100252234 3300005343 Unclassified 1097
29 Ga0070661_100062925 3300005344 Bacteria 2724
30 Ga0070661_100102700 3300005344 Unclassified 2128
31 Ga0070668_100003132 3300005347 Bacteria 12215
32 Ga0070668_100017263 3300005347 Bacteria 5403
33 Ga0070669_100169027 3300005353 Unclassified 1703
34 Ga0070675_100008019 3300005354 Bacteria 8186
35 Ga0070671_100058272 3300005355 Bacteria 3215
36 Ga0070671_100124893 3300005355 Unclassified 2166
37 Ga0070674_100027494 3300005356 Bacteria 3728
38 Ga0070673_100035085 3300005364 Bacteria 3801
39 Ga0070688_100005464 3300005365 Bacteria 6695
40 Ga0070659_100028543 3300005366 Bacteria 4310
41 Ga0070659_100101940 3300005366 Bacteria 2310
42 Ga0070667_100023601 3300005367 Bacteria 5105
43 Ga0070709_10199629 3300005434 Bacteria 1416
44 Ga0070709_10254226 3300005434 Bacteria 1267
45 Ga0070714_100000201 3300005435 Bacteria 48289
46 Ga0070714_100013045 3300005435 Bacteria 6649
47 Ga0070714_100104309 3300005435 Bacteria 2502
48 Ga0070714_100333620 3300005435 Bacteria 1421
49 Ga0070714_100355491 3300005435 Bacteria 1376
50 Ga0070713_100000629 3300005436 Bacteria 22500
51 Ga0070713_100001207 3300005436 Bacteria 16495
52 Ga0070713_100009604 3300005436 Bacteria 6941
53 Ga0070713_100038301 3300005436 Unclassified 3883
54 Ga0070713_100080252 3300005436 Bacteria 2781
55 Ga0070713_100083834 3300005436 Unclassified 2726
56 Ga0070713_100238872 3300005436 Bacteria 1654
57 Ga0070713_100240659 3300005436 Unclassified 1648
58 Ga0070713_100409813 3300005436 Bacteria 1267
59 Ga0070710_10007834 3300005437 Bacteria 5184
60 Ga0070710_10008993 3300005437 Bacteria 4880
61 Ga0070711_100000180 3300005439 Bacteria 33221
62 Ga0070711_100000643 3300005439 Bacteria 18208
63 Ga0070711_100002245 3300005439 Bacteria 10963
64 Ga0070711_100273671 3300005439 Unclassified 1333
65 Ga0070700_100082362 3300005441 Unclassified 2081
66 Ga0070700_100136750 3300005441 Bacteria 1660
67 Ga0070694_100092353 3300005444 Bacteria 2126
68 Ga0070694_100307039 3300005444 Unclassified 1217
69 Ga0070708_100009611 3300005445 Bacteria 7799
70 Ga0070708_100100563 3300005445 Bacteria 2647
71 Ga0070663_100067910 3300005455 Bacteria 2587
72 Ga0070662_100005108 3300005457 Bacteria 8365
73 Ga0070662_100014082 3300005457 Bacteria 5334
74 Ga0070681_10008277 3300005458 Bacteria 10182
75 Ga0070681_10070090 3300005458 Bacteria 3471
76 Ga0070681_10203469 3300005458 Bacteria 1898
77 Ga0070681_10437230 3300005458 Unclassified 1220
78 Ga0068867_100006397 3300005459 Bacteria 8324
79 Ga0070685_10004785 3300005466 Bacteria 6855
80 Ga0070706_100051160 3300005467 Bacteria 3812
81 Ga0070706_100059653 3300005467 Bacteria 3522
82 Ga0070707_100066379 3300005468 Bacteria 3468
83 Ga0070698_100003504 3300005471 Bacteria 17263
84 Ga0070698_100086496 3300005471 Bacteria 3121
85 Ga0070699_100000351 3300005518 Bacteria 44692
86 Ga0070679_100384467 3300005530 Unclassified 1350
87 Ga0070684_100003701 3300005535 Bacteria 11535
88 Ga0070684_100022414 3300005535 Bacteria 5267
89 Ga0068853_100042184 3300005539 Unclassified 3899
90 Ga0070672_100008356 3300005543 Bacteria 7077
91 Ga0070686_100001176 3300005544 Bacteria 14870
92 Ga0070695_100052018 3300005545 Unclassified 2630
93 Ga0070695_100255562 3300005545 Bacteria 1277
94 Ga0070695_100560064 3300005545 Unclassified 892
95 Ga0070665_100007644 3300005548 Bacteria 10987
96 Ga0068855_100036382 3300005563 Bacteria 5860
97 Ga0068855_100154264 3300005563 Bacteria 2610
98 Ga0070664_100080641 3300005564 Bacteria 2803
99 Ga0070664_100431722 3300005564 Bacteria 1208
100 Ga0068857_100003783 3300005577 Bacteria 12724
101 Ga0068854_100000870 3300005578 Bacteria 18105
102 Ga0068856_100015439 3300005614 Bacteria 7380
103 Ga0068856_100021117 3300005614 Bacteria 6327
104 Ga0068856_100022634 3300005614 Bacteria 6110
105 Ga0068856_100114468 3300005614 Bacteria 2696
106 Ga0068856_100135375 3300005614 Bacteria 2469
107 Ga0068852_100002551 3300005616 Bacteria 12552
108 Ga0068852_100006032 3300005616 Bacteria 8730
109 Ga0068859_100008721 3300005617 Bacteria 10245
110 Ga0068859_100130308 3300005617 Bacteria 2586
111 Ga0068864_100147483 3300005618 Unclassified 2128
112 Ga0068866_10002983 3300005718 Bacteria 6981
113 Ga0068866_10055154 3300005718 Bacteria 2040
114 Ga0068861_100129697 3300005719 Unclassified 2045
115 Ga0068851_10004779 3300005834 Bacteria 6132
116 Ga0068851_10006343 3300005834 Bacteria 5397
117 Ga0068870_10000686 3300005840 Bacteria 12963
118 Ga0068863_100054423 3300005841 Bacteria 3791
119 Ga0068863_100082203 3300005841 Bacteria 3052
120 Ga0068863_100237196 3300005841 Bacteria 1760
121 Ga0068863_100509623 3300005841 Bacteria 1185
122 Ga0068858_100125133 3300005842 Bacteria 2406
123 Ga0068858_100279196 3300005842 Bacteria 1590
124 Ga0068858_100651525 3300005842 Bacteria 1023
125 Ga0068860_100010960 3300005843 Bacteria 8936
126 Ga0068862_100050908 3300005844 Bacteria 3541
127 Ga0070717_10002598 3300006028 Bacteria 12743
128 Ga0070717_10012537 3300006028 Bacteria 6465
129 Ga0070717_10018689 3300006028 Bacteria 5420
130 Ga0070717_10138301 3300006028 Bacteria 2099
131 Ga0070717_10215909 3300006028 Bacteria 1684
132 Ga0070717_10235173 3300006028 Unclassified 1614
133 Ga0070717_10413128 3300006028 Unclassified 1213
134 Ga0070715_10016378 3300006163 Bacteria 2784
135 Ga0070716_100149735 3300006173 Unclassified 1499
136 Ga0070716_100151053 3300006173 Unclassified 1494
137 Ga0070716_100255669 3300006173 Bacteria 1196
138 Ga0070716_100369055 3300006173 Unclassified 1022
139 Ga0070712_100000375 3300006175 Bacteria 25335
140 Ga0070712_100000442 3300006175 Bacteria 23688
141 Ga0070712_100001587 3300006175 Bacteria 13886
142 Ga0070712_100081445 3300006175 Bacteria 2345
143 Ga0070712_100129395 3300006175 Bacteria 1911
144 Ga0070712_100289651 3300006175 Bacteria 1322
145 Ga0097621_100185475 3300006237 Unclassified 1799
146 Ga0068871_100007015 3300006358 Bacteria 8029
147 Ga0068871_100280126 3300006358 Bacteria 1458
148 Ga0075434_100212788 3300006871 Bacteria 1953
149 Ga0068865_100004813 3300006881 Bacteria 8157
150 Ga0097620_100008721 3300006931 Bacteria 10245
151 Ga0097620_100130300 3300006931 Bacteria 2586
152 Ga0105250_10132928 3300009092 Unclassified 1028
153 Ga0105240_10010711 3300009093 Bacteria 12866
154 Ga0105240_10084681 3300009093 Bacteria 3887
155 Ga0111539_10506566 3300009094 Unclassified 1406
156 Ga0105245_10002851 3300009098 Bacteria 15542
157 Ga0105245_10122678 3300009098 Bacteria 2429
158 Ga0105247_10003441 3300009101 Bacteria 10324
159 Ga0105247_10055736 3300009101 Bacteria 2439
160 Ga0105241_10007153 3300009174 Bacteria 8214
161 Ga0105241_10073010 3300009174 Bacteria 2668
162 Ga0105241_10109079 3300009174 Bacteria 2213
163 Ga0105242_10027762 3300009176 Bacteria 4499
164 Ga0105242_10038337 3300009176 Bacteria 3853
165 Ga0105248_10005323 3300009177 Bacteria 14170
166 Ga0105248_10269990 3300009177 Unclassified 1915
167 Ga0105237_10169039 3300009545 Bacteria 2186
168 Ga0105237_10195041 3300009545 Bacteria 2025
169 Ga0105237_10399461 3300009545 Unclassified 1379
170 Ga0105238_10189947 3300009551 Bacteria 2030
171 Ga0105249_10004997 3300009553 Bacteria 11446
172 Ga0105249_10012805 3300009553 Bacteria 7398
173 Ga0105249_10061388 3300009553 Bacteria 3449
174 Ga0099796_10008961 3300010159 Bacteria 2688
175 Ga0105239_10050753 3300010375 Bacteria 4549
176 Ga0105239_10188614 3300010375 Bacteria 2308
177 Ga0105246_10001012 3300011119 Bacteria 16156
178 Ga0105246_10218975 3300011119 Bacteria 1491
179 Ga0157373_10004330 3300013100 Bacteria 10687
180 Ga0157373_10111659 3300013100 Bacteria 1922
181 Ga0157371_10002655 3300013102 Bacteria 16932
182 Ga0157370_10289235 3300013104 Unclassified 1514
183 Ga0157369_10015521 3300013105 Bacteria 8583
184 Ga0157369_10025517 3300013105 Bacteria 6560
185 Ga0157369_10040116 3300013105 Bacteria 5113
186 Ga0157369_10054991 3300013105 Bacteria 4297
187 Ga0157369_10173218 3300013105 Bacteria 2273
188 Ga0157374_10044394 3300013296 Plasmid 4109
189 Ga0157374_10082817 3300013296 Bacteria 3047
190 Ga0157374_10170497 3300013296 Bacteria 2123
191 Ga0157378_10046450 3300013297 Bacteria 3860
192 Ga0163162_10002469 3300013306 Bacteria 17465
193 Ga0163162_10641754 3300013306 Bacteria 1186
194 Ga0157372_10008074 3300013307 Bacteria 11196
195 Ga0157372_10008743 3300013307 Bacteria 10752
196 Ga0157372_10017942 3300013307 Bacteria 7605
197 Ga0157372_10072655 3300013307 Bacteria 3877
198 Ga0157372_10129657 3300013307 Bacteria 2900
199 Ga0157372_10203177 3300013307 Bacteria 2295
200 Ga0157372_10668922 3300013307 Bacteria 1209
201 Ga0157375_10021421 3300013308 Bacteria 5926
202 Ga0163163_10018770 3300014325 Bacteria 6483
203 Ga0157380_10066492 3300014326 Bacteria 2899
204 Ga0157377_10000384 3300014745 Bacteria 19261
205 Ga0157379_10004959 3300014968 Bacteria 11416
206 Ga0157379_10108736 3300014968 Bacteria 2490
207 Ga0157376_10350579 3300014969 Unclassified 1412
208 Ga0182005_1028709 3300015265 Bacteria 1517
209 Ga0163161_10002465 3300017792 Bacteria 13211
210 Ga0213874_10046303 3300021377 Bacteria 1320
211 Ga0224572_1021786 3300024225 Unclassified 1231
212 Ga0228598_1000097 3300024227 Bacteria 14416
213 Ga0207697_10002017 3300025315 Bacteria 10747
214 Ga0207656_10057692 3300025321 Unclassified 1694
215 Ga0207682_10010638 3300025893 Bacteria 3600
216 Ga0207692_10012016 3300025898 Bacteria 3708
217 Ga0207692_10069684 3300025898 Unclassified 1848
218 Ga0207710_10069077 3300025900 Unclassified 1617
219 Ga0207680_10057329 3300025903 Bacteria 2356
220 Ga0207647_10011509 3300025904 Bacteria 6204
221 Ga0207699_10010448 3300025906 Bacteria 4660
222 Ga0207699_10343765 3300025906 Bacteria 1052
223 Ga0207699_10386067 3300025906 Bacteria 995
224 Ga0207645_10000376 3300025907 Bacteria 36934
225 Ga0207645_10027923 3300025907 Bacteria 3643
226 Ga0207684_10002299 3300025910 Bacteria 19434
227 Ga0207654_10009679 3300025911 Bacteria 4903
228 Ga0207654_10022794 3300025911 Bacteria 3346
229 Ga0207654_10050129 3300025911 Bacteria 2398
230 Ga0207707_10181872 3300025912 Bacteria 1835
231 Ga0207707_10211955 3300025912 Bacteria 1687
232 Ga0207707_10222112 3300025912 Bacteria 1644
233 Ga0207695_10009477 3300025913 Bacteria 12042
234 Ga0207695_10127319 3300025913 Bacteria 2507
235 Ga0207671_10098932 3300025914 Bacteria 2207
236 Ga0207671_10121835 3300025914 Unclassified 1994
237 Ga0207693_10000214 3300025915 Bacteria 53256
238 Ga0207693_10000813 3300025915 Bacteria 27850
239 Ga0207693_10001121 3300025915 Bacteria 24031
240 Ga0207693_10001578 3300025915 Bacteria 20148
241 Ga0207693_10006443 3300025915 Bacteria 9728
242 Ga0207693_10103236 3300025915 Bacteria 2236
243 Ga0207663_10000130 3300025916 Bacteria 36007
244 Ga0207663_10001065 3300025916 Bacteria 12581
245 Ga0207663_10001797 3300025916 Bacteria 10119
246 Ga0207663_10048186 3300025916 Bacteria 2636
247 Ga0207660_10097664 3300025917 Unclassified 2189
248 Ga0207657_10005352 3300025919 Bacteria 13445
249 Ga0207657_10016884 3300025919 Bacteria 7024
250 Ga0207649_10041395 3300025920 Bacteria 2804
251 Ga0207649_10349059 3300025920 Bacteria 1094
252 Ga0207646_10007337 3300025922 Bacteria 11230
253 Ga0207646_10057106 3300025922 Bacteria 3487
254 Ga0207646_10594731 3300025922 Unclassified 993
255 Ga0207650_10000216 3300025925 Bacteria 65683
256 Ga0207650_10384117 3300025925 Bacteria 1160
257 Ga0207659_10081941 3300025926 Bacteria 2387
258 Ga0207687_10001637 3300025927 Bacteria 15450
259 Ga0207687_10027598 3300025927 Bacteria 3811
260 Ga0207700_10000131 3300025928 Bacteria 44718
261 Ga0207700_10002361 3300025928 Bacteria 10844
262 Ga0207700_10021468 3300025928 Unclassified 4409
263 Ga0207700_10041243 3300025928 Unclassified 3376
264 Ga0207700_10160713 3300025928 Bacteria 1866
265 Ga0207700_10397359 3300025928 Unclassified 1207
266 Ga0207664_10047161 3300025929 Bacteria 3384
267 Ga0207664_10161828 3300025929 Bacteria 1909
268 Ga0207664_10354851 3300025929 Bacteria 1298
269 Ga0207664_10679064 3300025929 Bacteria 926
270 Ga0207644_10001191 3300025931 Bacteria 16745
271 Ga0207690_10015618 3300025932 Bacteria 4605
272 Ga0207690_10242974 3300025932 Bacteria 1387
273 Ga0207706_10000772 3300025933 Bacteria 33223
274 Ga0207706_10000868 3300025933 Bacteria 31136
275 Ga0207686_10054165 3300025934 Bacteria 2512
276 Ga0207670_10066644 3300025936 Unclassified 2474
277 Ga0207670_10072015 3300025936 Bacteria 2392
278 Ga0207669_10011608 3300025937 Bacteria 4294
279 Ga0207704_10053625 3300025938 Bacteria 2452
280 Ga0207704_10126873 3300025938 Bacteria 1758
281 Ga0207665_10003948 3300025939 Bacteria 9928
282 Ga0207665_10005131 3300025939 Bacteria 8746
283 Ga0207665_10008234 3300025939 Bacteria 6883
284 Ga0207665_10018994 3300025939 Bacteria 4515
285 Ga0207665_10101522 3300025939 Bacteria 2009
286 Ga0207665_10237715 3300025939 Unclassified 1341
287 Ga0207691_10004277 3300025940 Bacteria 13868
288 Ga0207711_10002757 3300025941 Bacteria 15476
289 Ga0207711_10003570 3300025941 Bacteria 13456
290 Ga0207689_10002429 3300025942 Bacteria 17344
291 Ga0207661_10008484 3300025944 Bacteria 7348
292 Ga0207661_10424190 3300025944 Bacteria 1208
293 Ga0207679_10000496 3300025945 Bacteria 27124
294 Ga0207679_10072023 3300025945 Bacteria 2609
295 Ga0207679_10156841 3300025945 Bacteria 1859
296 Ga0207667_10005324 3300025949 Bacteria 15683
297 Ga0207667_10028821 3300025949 Bacteria 6028
298 Ga0207651_10023397 3300025960 Bacteria 3799
299 Ga0207712_10024365 3300025961 Bacteria 4006
300 Ga0207712_10189121 3300025961 Bacteria 1624
301 Ga0207640_10010397 3300025981 Bacteria 5243
302 Ga0207658_10031123 3300025986 Bacteria 3786
303 Ga0207677_10002341 3300026023 Bacteria 9948
304 Ga0207677_10045488 3300026023 Bacteria 2932
305 Ga0207703_10574215 3300026035 Bacteria 1065
306 Ga0207639_10049721 3300026041 Bacteria 3180
307 Ga0207678_10000328 3300026067 Bacteria 42509
308 Ga0207708_10165070 3300026075 Bacteria 1750
309 Ga0207702_10009341 3300026078 Bacteria 8239
310 Ga0207702_10025690 3300026078 Unclassified 4889
311 Ga0207702_10036637 3300026078 Bacteria 4104
312 Ga0207702_10044826 3300026078 Bacteria 3718
313 Ga0207702_10637644 3300026078 Unclassified 1047
314 Ga0207641_10001283 3300026088 Bacteria 25008
315 Ga0207641_10133066 3300026088 Bacteria 2235
316 Ga0207641_10578809 3300026088 Unclassified 1097
317 Ga0207648_10003121 3300026089 Bacteria 17496
318 Ga0207648_10005631 3300026089 Bacteria 12587
319 Ga0207676_10000058 3300026095 Bacteria 120315
320 Ga0207676_10294741 3300026095 Bacteria 1479
321 Ga0207674_10000148 3300026116 Bacteria 82478
322 Ga0207683_10000583 3300026121 Bacteria 33700
323 Ga0207698_10009427 3300026142 Bacteria 6226
324 Ga0207698_10232537 3300026142 Bacteria 1674
325 Ga0207698_10657507 3300026142 Unclassified 1039
326 Ga0268266_10016369 3300028379 Bacteria 6340
327 Ga0268266_10042678 3300028379 Bacteria 3874
328 Ga0268265_10009475 3300028380 Bacteria 6576
329 Ga0268264_10041075 3300028381 Bacteria 3824
330 Ga0265338_10023050 3300028800 Bacteria 6415
331 Ga0265338_10029229 3300028800 Bacteria 5469
332 Ga0265338_10033138 3300028800 Bacteria 5021
333 Ga0265338_10161755 3300028800 Bacteria 1728
334 Ga0265324_10104507 3300029957 Bacteria 962
335 Ga0265762_1000078 3300030760 Bacteria 13220
336 Ga0265762_1002375 3300030760 Bacteria 3406
337 Ga0265762_1005586 3300030760 Bacteria 2256
338 Ga0265760_10001071 3300031090 Bacteria 7946
339 Ga0265760_10011467 3300031090 Unclassified 2532
340 Ga0265760_10023077 3300031090 Bacteria 1806
341 Ga0265760_10041136 3300031090 Unclassified 1377
342 Ga0265325_10014358 3300031241 Unclassified 4479
343 Ga0265316_10006387 3300031344 Bacteria 11268
344 Ga0265316_10294571 3300031344 Bacteria 1183
345 Ga0373926_0063771 3300035083 Bacteria 1346
346 Ga0373934_0011013 3300035086 Bacteria 3402
347 Ga0373934_0032417 3300035086 Unclassified 2049
348 Ga0373944_0013449 3300035089 Unclassified 2270
349 Ga0373923_0050497 3300035111 Bacteria 1742
350 Ga0373936_0008156 3300035113 Bacteria 3938
351 Ga0373945_0000847 3300035116 Bacteria 8996
352 Ga0373953_0011154 3300035117 Bacteria 3146
353 Ga0373956_0057176 3300035119 Bacteria 1762
354 Ga0373943_0000816 3300035170 Bacteria 13684
355 Ga0373946_0008719 3300035171 Unclassified 3723
356 Ga0373955_0015612 3300035172 Bacteria 3722
357 Ga0373955_0107017 3300035172 Bacteria 1613
358 Ga0373955_0138944 3300035172 Unclassified 1423
359 Ga0373924_0008839 3300035410 Bacteria 3674
360 Ga0373924_0083428 3300035410 Bacteria 1361
361 Ga0373931_0128377 3300035691 Bacteria 1456
362 Ga0373935_0153689 3300035692 Unclassified 1564
363 Ga0373935_0163327 3300035692 Bacteria 1519
364 Ga0373935_0281334 3300035692 Unclassified 1171
365 Ga0373927_0000097 3300035695 Bacteria 66228
366 Ga0373927_0185216 3300035695 Bacteria 1366
367 Ga0373933_0062163 3300035724 Bacteria 2255
368 Ga0373947_0000273 3300035725 Bacteria 29358
369 Ga0373947_0413592 3300035725 Unclassified 911
370 Ga0373937_0021766 3300036401 Bacteria 5755
371 Ga0373937_0099502 3300036401 Unclassified 2697
372 Ga0373937_0099999 3300036401 Bacteria 2690
373 Ga0373937_0816740 3300036401 Unclassified 880
374 Ga0265778_000781 3300036457 Bacteria 2644
375 Ga0373925_0002154 3300037068 Bacteria 16083
376 Ga0373925_0021758 3300037068 Bacteria 4674
377 Ga0373925_0112396 3300037068 Bacteria 2106
378 Ga0373925_0130345 3300037068 Bacteria 1960
379 Ga0436363_1220787 3300039450 Unclassified 3244
380 Ga0436362_1182026 3300039453 Bacteria 16352
381 Ga0451577_0000215 3300042876 Bacteria 120190
382 Ga0453683_0018883 3300044673 Bacteria 4423
383 Ga0453684_0000698 3300044712 Bacteria 119496
384 Ga0466959_0124324 3300045049 Bacteria 1832
385 Ga0451576_0015980 3300045051 Bacteria 8297
386 Ga0451576_0246412 3300045051 Bacteria 1867
387 Ga0466967_0054355 3300045976 Unclassified 3523
388 Ga0495653_0084063 3300046463 Bacteria 2345
389 Ga0495580_0000390 3300046472 Bacteria 35923
390 Ga0495580_0002235 3300046472 Bacteria 16914
391 Ga0495580_0004124 3300046472 Bacteria 12250
392 Ga0495580_0007758 3300046472 Bacteria 8602
393 Ga0495580_0014505 3300046472 Bacteria 5975
394 Ga0495580_0026747 3300046472 Bacteria 4202
395 Ga0495580_0065318 3300046472 Bacteria 2549
396 Ga0495580_0189541 3300046472 Bacteria 1418
397 Ga0495582_0025282 3300046473 Bacteria 3253
398 Ga0495639_0220362 3300046475 Bacteria 933
399 Ga0495664_0288450 3300046477 Bacteria 991
400 Ga0495594_0267223 3300046499 Unclassified 974
401 Ga0495628_0054384 3300046516 Bacteria 3157
402 Ga0495630_0113270 3300046517 Bacteria 2055
403 Ga0495666_0276478 3300046526 Unclassified 762
404 Ga0495665_0026261 3300046531 Bacteria 3128
405 Ga0495659_0090320 3300046664 Unclassified 1175
406 Ga0495646_0211323 3300046680 Bacteria 1053
407 Ga0495658_0161144 3300046683 Unclassified 1383
408 Ga0495669_0030978 3300046684 Bacteria 2348
409 Ga0495669_0118472 3300046684 Bacteria 1240
410 Ga0495613_0030521 3300046689 Unclassified 4004
411 Ga0495624_0233136 3300046690 Unclassified 1115
412 Ga0495674_0053619 3300047319 Unclassified 3544
413 Ga0495674_0062016 3300047319 Unclassified 3256
414 Ga0495680_0184747 3300047322 Bacteria 1503
415 Ga0495602_0106675 3300048088 Bacteria 2286
416 Ga0495602_0107092 3300048088 Bacteria 2280
417 Ga0496102_0099148 3300048905 Bacteria 2704
418 Ga0496103_0229156 3300048906 Unclassified 1195
419 Ga0496104_0141281 3300048907 Bacteria 2313
420 Ga0496104_0536083 3300048907 Unclassified 1081
421 Ga0496105_0156147 3300048908 Bacteria 1874
422 Ga0496108_0000170 3300048911 Bacteria 61234
423 Ga0496109_0000621 3300048912 Bacteria 29592
424 Ga0496110_0001158 3300048913 Bacteria 18697
425 Ga0496110_0161584 3300048913 Bacteria 2031
426 Ga0496111_0027639 3300048914 Bacteria 4016
427 Ga0496112_0000152 3300048915 Bacteria 43283
428 Ga0496112_0083061 3300048915 Bacteria 3168
429 Ga0496113_0004982 3300048916 Bacteria 8230
430 Ga0496115_0005135 3300048918 Bacteria 9525
431 nmdc:mga0n895_259936_c1 3300050512 Bacteria 1762
432 Ga0495601_0012140 3300053077 Bacteria 5165
433 Ga0070714_100253175
434 MBSR1b_contig_8676116
435 JGI24752J21851_1000366
436 JGI24748J21848_1011805
437 Ga0065712_10080331
438 Ga0065712_10087565
439 Ga0065715_10142054
440 Ga0070658_10127228
441 Ga0070676_10004891
442 Ga0070676_10009104
443 Ga0070683_100006792
444 Ga0070690_100027309
445 Ga0070690_100117937
446 Ga0070670_100444564
447 Ga0070677_10001533
448 Ga0070677_10088927
449 Ga0068869_100060504
450 Ga0068869_100093697
451 Ga0070666_10265592
452 Ga0070682_100020165
453 Ga0070682_100411377
454 Ga0068868_100000843
455 Ga0068868_100046894
456 Ga0070660_100009291
457 Ga0070660_100053324
458 Ga0070689_100083827
459 Ga0070689_100173011
460 Ga0070687_100252234
461 Ga0070661_100062925
462 Ga0070661_100102700
463 Ga0070668_100003132
464 Ga0070668_100017263
465 Ga0070669_100169027
466 Ga0070675_100008019
467 Ga0070671_100058272
468 Ga0070671_100124893
469 Ga0070674_100027494
470 Ga0070673_100035085
471 Ga0070688_100005464
472 Ga0070659_100028543
473 Ga0070659_100101940
474 Ga0070667_100023601
475 Ga0070709_10199629
476 Ga0070709_10254226
477 Ga0070714_100000201
478 Ga0070714_100013045
479 Ga0070714_100104309
480 Ga0070714_100333620
481 Ga0070714_100355491
482 Ga0070713_100000629
483 Ga0070713_100001207
484 Ga0070713_100009604
485 Ga0070713_100038301
486 Ga0070713_100080252
487 Ga0070713_100083834
488 Ga0070713_100238872
489 Ga0070713_100240659
490 Ga0070713_100409813
491 Ga0070710_10007834
492 Ga0070710_10008993
493 Ga0070711_100000180
494 Ga0070711_100000643
495 Ga0070711_100002245
496 Ga0070711_100273671
497 Ga0070700_100082362
498 Ga0070700_100136750
499 Ga0070694_100092353
500 Ga0070694_100307039
501 Ga0070708_100009611
502 Ga0070708_100100563
503 Ga0070663_100067910
504 Ga0070662_100005108
505 Ga0070662_100014082
506 Ga0070681_10008277
507 Ga0070681_10070090
508 Ga0070681_10203469
509 Ga0070681_10437230
510 Ga0068867_100006397
511 Ga0070685_10004785
512 Ga0070706_100051160
513 Ga0070706_100059653
514 Ga0070707_100066379
515 Ga0070698_100003504
516 Ga0070698_100086496
517 Ga0070699_100000351
518 Ga0070679_100384467
519 Ga0070684_100003701
520 Ga0070684_100022414
521 Ga0068853_100042184
522 Ga0070672_100008356
523 Ga0070686_100001176
524 Ga0070695_100052018
525 Ga0070695_100255562
526 Ga0070695_100560064
527 Ga0070665_100007644
528 Ga0068855_100036382
529 Ga0068855_100154264
530 Ga0070664_100080641
531 Ga0070664_100431722
532 Ga0068857_100003783
533 Ga0068854_100000870
534 Ga0068856_100015439
535 Ga0068856_100021117
536 Ga0068856_100022634
537 Ga0068856_100114468
538 Ga0068856_100135375
539 Ga0068852_100002551
540 Ga0068852_100006032
541 Ga0068859_100008721
542 Ga0068859_100130308
543 Ga0068864_100147483
544 Ga0068866_10002983
545 Ga0068866_10055154
546 Ga0068861_100129697
547 Ga0068851_10004779
548 Ga0068851_10006343
549 Ga0068870_10000686
550 Ga0068863_100054423
551 Ga0068863_100082203
552 Ga0068863_100237196
553 Ga0068863_100509623
554 Ga0068858_100125133
555 Ga0068858_100279196
556 Ga0068858_100651525
557 Ga0068860_100010960
558 Ga0068862_100050908
559 Ga0070717_10002598
560 Ga0070717_10012537
561 Ga0070717_10018689
562 Ga0070717_10138301
563 Ga0070717_10215909
564 Ga0070717_10235173
565 Ga0070717_10413128
566 Ga0070715_10016378
567 Ga0070716_100149735
568 Ga0070716_100151053
569 Ga0070716_100255669
570 Ga0070716_100369055
571 Ga0070712_100000375
572 Ga0070712_100000442
573 Ga0070712_100001587
574 Ga0070712_100081445
575 Ga0070712_100129395
576 Ga0070712_100289651
577 Ga0097621_100185475
578 Ga0068871_100007015
579 Ga0068871_100280126
580 Ga0075434_100212788
581 Ga0068865_100004813
582 Ga0097620_100008721
583 Ga0097620_100130300
584 Ga0105250_10132928
585 Ga0105240_10010711
586 Ga0105240_10084681
587 Ga0111539_10506566
588 Ga0105245_10002851
589 Ga0105245_10122678
590 Ga0105247_10003441
591 Ga0105247_10055736
592 Ga0105241_10007153
593 Ga0105241_10073010
594 Ga0105241_10109079
595 Ga0105242_10027762
596 Ga0105242_10038337
597 Ga0105248_10005323
598 Ga0105248_10269990
599 Ga0105237_10169039
600 Ga0105237_10195041
601 Ga0105237_10399461
602 Ga0105238_10189947
603 Ga0105249_10004997
604 Ga0105249_10012805
605 Ga0105249_10061388
606 Ga0099796_10008961
607 Ga0105239_10050753
608 Ga0105239_10188614
609 Ga0105246_10001012
610 Ga0105246_10218975
611 Ga0157373_10004330
612 Ga0157373_10111659
613 Ga0157371_10002655
614 Ga0157370_10289235
615 Ga0157369_10015521
616 Ga0157369_10025517
617 Ga0157369_10040116
618 Ga0157369_10054991
619 Ga0157369_10173218
620 Ga0157374_10044394
621 Ga0157374_10082817
622 Ga0157374_10170497
623 Ga0157378_10046450
624 Ga0163162_10002469
625 Ga0163162_10641754
626 Ga0157372_10008074
627 Ga0157372_10008743
628 Ga0157372_10017942
629 Ga0157372_10072655
630 Ga0157372_10129657
631 Ga0157372_10203177
632 Ga0157372_10668922
633 Ga0157375_10021421
634 Ga0163163_10018770
635 Ga0157380_10066492
636 Ga0157377_10000384
637 Ga0157379_10004959
638 Ga0157379_10108736
639 Ga0157376_10350579
640 Ga0182005_1028709
641 Ga0163161_10002465
642 Ga0213874_10046303
643 Ga0224572_1021786
644 Ga0228598_1000097
645 Ga0207697_10002017
646 Ga0207656_10057692
647 Ga0207682_10010638
648 Ga0207692_10012016
649 Ga0207692_10069684
650 Ga0207710_10069077
651 Ga0207680_10057329
652 Ga0207647_10011509
653 Ga0207699_10010448
654 Ga0207699_10343765
655 Ga0207699_10386067
656 Ga0207645_10000376
657 Ga0207645_10027923
658 Ga0207684_10002299
659 Ga0207654_10009679
660 Ga0207654_10022794
661 Ga0207654_10050129
662 Ga0207707_10181872
663 Ga0207707_10211955
664 Ga0207707_10222112
665 Ga0207695_10009477
666 Ga0207695_10127319
667 Ga0207671_10098932
668 Ga0207671_10121835
669 Ga0207693_10000214
670 Ga0207693_10000813
671 Ga0207693_10001121
672 Ga0207693_10001578
673 Ga0207693_10006443
674 Ga0207693_10103236
675 Ga0207663_10000130
676 Ga0207663_10001065
677 Ga0207663_10001797
678 Ga0207663_10048186
679 Ga0207660_10097664
680 Ga0207657_10005352
681 Ga0207657_10016884
682 Ga0207649_10041395
683 Ga0207649_10349059
684 Ga0207646_10007337
685 Ga0207646_10057106
686 Ga0207646_10594731
687 Ga0207650_10000216
688 Ga0207650_10384117
689 Ga0207659_10081941
690 Ga0207687_10001637
691 Ga0207687_10027598
692 Ga0207700_10000131
693 Ga0207700_10002361
694 Ga0207700_10021468
695 Ga0207700_10041243
696 Ga0207700_10160713
697 Ga0207700_10397359
698 Ga0207664_10047161
699 Ga0207664_10161828
700 Ga0207664_10354851
701 Ga0207664_10679064
702 Ga0207644_10001191
703 Ga0207690_10015618
704 Ga0207690_10242974
705 Ga0207706_10000772
706 Ga0207706_10000868
707 Ga0207686_10054165
708 Ga0207670_10066644
709 Ga0207670_10072015
710 Ga0207669_10011608
711 Ga0207704_10053625
712 Ga0207704_10126873
713 Ga0207665_10003948
714 Ga0207665_10005131
715 Ga0207665_10008234
716 Ga0207665_10018994
717 Ga0207665_10101522
718 Ga0207665_10237715
719 Ga0207691_10004277
720 Ga0207711_10002757
721 Ga0207711_10003570
722 Ga0207689_10002429
723 Ga0207661_10008484
724 Ga0207661_10424190
725 Ga0207679_10000496
726 Ga0207679_10072023
727 Ga0207679_10156841
728 Ga0207667_10005324
729 Ga0207667_10028821
730 Ga0207651_10023397
731 Ga0207712_10024365
732 Ga0207712_10189121
733 Ga0207640_10010397
734 Ga0207658_10031123
735 Ga0207677_10002341
736 Ga0207677_10045488
737 Ga0207703_10574215
738 Ga0207639_10049721
739 Ga0207678_10000328
740 Ga0207708_10165070
741 Ga0207702_10009341
742 Ga0207702_10025690
743 Ga0207702_10036637
744 Ga0207702_10044826
745 Ga0207702_10637644
746 Ga0207641_10001283
747 Ga0207641_10133066
748 Ga0207641_10578809
749 Ga0207648_10003121
750 Ga0207648_10005631
751 Ga0207676_10000058
752 Ga0207676_10294741
753 Ga0207674_10000148
754 Ga0207683_10000583
755 Ga0207698_10009427
756 Ga0207698_10232537
757 Ga0207698_10657507
758 Ga0268266_10016369
759 Ga0268266_10042678
760 Ga0268265_10009475
761 Ga0268264_10041075
762 Ga0265338_10023050
763 Ga0265338_10029229
764 Ga0265338_10033138
765 Ga0265338_10161755
766 Ga0265324_10104507
767 Ga0265762_1000078
768 Ga0265762_1002375
769 Ga0265762_1005586
770 Ga0265760_10001071
771 Ga0265760_10011467
772 Ga0265760_10023077
773 Ga0265760_10041136
774 Ga0265325_10014358
775 Ga0265316_10006387
776 Ga0265316_10294571
777 Ga0373926_0063771
778 Ga0373934_0011013
779 Ga0373934_0032417
780 Ga0373944_0013449
781 Ga0373923_0050497
782 Ga0373936_0008156
783 Ga0373945_0000847
784 Ga0373953_0011154
785 Ga0373956_0057176
786 Ga0373943_0000816
787 Ga0373946_0008719
788 Ga0373955_0015612
789 Ga0373955_0107017
790 Ga0373955_0138944
791 Ga0373924_0008839
792 Ga0373924_0083428
793 Ga0373931_0128377
794 Ga0373935_0153689
795 Ga0373935_0163327
796 Ga0373935_0281334
797 Ga0373927_0000097
798 Ga0373927_0185216
799 Ga0373933_0062163
800 Ga0373947_0000273
801 Ga0373947_0413592
802 Ga0373937_0021766
803 Ga0373937_0099502
804 Ga0373937_0099999
805 Ga0373937_0816740
806 Ga0265778_000781
807 Ga0373925_0002154
808 Ga0373925_0021758
809 Ga0373925_0112396
810 Ga0373925_0130345
811 Ga0436363_1220787
812 Ga0436362_1182026
813 Ga0451577_0000215
814 Ga0453683_0018883
815 Ga0453684_0000698
816 Ga0466959_0124324
817 Ga0451576_0015980
818 Ga0451576_0246412
819 Ga0466967_0054355
820 Ga0495653_0084063
821 Ga0495580_0000390
822 Ga0495580_0002235
823 Ga0495580_0004124
824 Ga0495580_0007758
825 Ga0495580_0014505
826 Ga0495580_0026747
827 Ga0495580_0065318
828 Ga0495580_0189541
829 Ga0495582_0025282
830 Ga0495639_0220362
831 Ga0495664_0288450
832 Ga0495594_0267223
833 Ga0495628_0054384
834 Ga0495630_0113270
835 Ga0495666_0276478
836 Ga0495665_0026261
837 Ga0495659_0090320
838 Ga0495646_0211323
839 Ga0495658_0161144
840 Ga0495669_0030978
841 Ga0495669_0118472
842 Ga0495613_0030521
843 Ga0495624_0233136
844 Ga0495674_0053619
845 Ga0495674_0062016
846 Ga0495680_0184747
847 Ga0495602_0106675
848 Ga0495602_0107092
849 Ga0496102_0099148
850 Ga0496103_0229156
851 Ga0496104_0141281
852 Ga0496104_0536083
853 Ga0496105_0156147
854 Ga0496108_0000170
855 Ga0496109_0000621
856 Ga0496110_0001158
857 Ga0496110_0161584
858 Ga0496111_0027639
859 Ga0496112_0000152
860 Ga0496112_0083061
861 Ga0496113_0004982
862 Ga0496115_0005135
863 nmdc:mga0n895_259936_c1
864 Ga0495601_0012140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

277

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

213

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pea-assembly2.cif.gz_D crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9455 9 257
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9444 9 257
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.932 4 255
4lk5-assembly1.cif.gz_C crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9287 9 255
4kd6-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase/isomerase from burkholderia graminis c4d1m 0.925 9 228
ID Description Score Start End Superfamily
5wydE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.956 6 195 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9504 9 195 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9496 4 181 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9454 4 199 3.90.226.10
3i47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9397 8 199 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2V9NH35-F1-model_v4 Enoyl-CoA hydratase 0.9883 5 195 GO:0003824
GO:0006635
AF-A0A661T432-F1-model_v4 Enoyl-CoA hydratase 0.9867 8 178 GO:0006635
AF-A0A351SWZ3-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9858 8 211 GO:0006635
GO:0016853
AF-A0A2V9MUG6-F1-model_v4 Enoyl-CoA hydratase 0.9842 7 225 GO:0006635
GO:0016836
AF-A0A2V9QRL5-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9837 11 258 GO:0016853

Map