F442255

General Info

Members Datasets Scaffolds Average Seq Length
430 199 860 219

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_64634_c1|nmdc:mga0n895_64634_c1_2584_3300
Length 238
Sequence MPVPARLSGPSVILPRPGPRPARPQARLIYLHGFASSAGSSKARYFSERLGALGLTLGCPDFNEPDFATLTITRMLNQLGAELKAATGPAVLMGSSLGGTLAILAAERFPERVDRLVLLAPAVMFAKPGHHLLPPERIDEWRRRGSLPFFHYASNEERWLNYAFYEDSLQHHAFDAAVHQPTLIFQGLHDASVEYRTVEAFARTRPNVTLSLLDDDHQLIASLPRIWDGVAPFLGLVE

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 24.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_64634_c1 3300050512 Bacteria 3619
2 Ga0065712_10074894 3300005290 Unclassified 3985
3 Ga0065715_10145135 3300005293 Unclassified 1788
4 Ga0070676_10250436 3300005328 Bacteria 1182
5 Ga0070683_100115617 3300005329 Bacteria 2533
6 Ga0070683_100119134 3300005329 Bacteria 2493
7 Ga0070683_100557871 3300005329 Bacteria 1095
8 Ga0070690_100098559 3300005330 Unclassified 1934
9 Ga0070670_100417315 3300005331 Unclassified 1186
10 Ga0070670_100847035 3300005331 Bacteria 827
11 Ga0068869_100341441 3300005334 Bacteria 1219
12 Ga0070666_10049577 3300005335 Bacteria 2822
13 Ga0070666_10330762 3300005335 Bacteria 1088
14 Ga0070680_100273233 3300005336 Bacteria 1431
15 Ga0070682_100272814 3300005337 Bacteria 1229
16 Ga0068868_100106560 3300005338 Bacteria 2274
17 Ga0068868_100375875 3300005338 Bacteria 1222
18 Ga0068868_100584064 3300005338 Bacteria 988
19 Ga0068868_100874496 3300005338 Unclassified 815
20 Ga0070660_100426714 3300005339 Unclassified 1098
21 Ga0070689_100163194 3300005340 Bacteria 1802
22 Ga0070689_100172726 3300005340 Unclassified 1752
23 Ga0070689_100434339 3300005340 Bacteria 1115
24 Ga0070691_10008550 3300005341 Bacteria 4688
25 Ga0070687_100021073 3300005343 Bacteria 3057
26 Ga0070668_100550940 3300005347 Bacteria 1004
27 Ga0070669_100014153 3300005353 Bacteria 5676
28 Ga0070669_100024552 3300005353 Bacteria 4322
29 Ga0070669_100036661 3300005353 Bacteria 3555
30 Ga0070669_100253664 3300005353 Bacteria 1401
31 Ga0070675_100001650 3300005354 Bacteria 16492
32 Ga0070675_100549852 3300005354 Bacteria 1044
33 Ga0070671_100161517 3300005355 Unclassified 1894
34 Ga0070674_100023385 3300005356 Unclassified 3999
35 Ga0070674_100259316 3300005356 Unclassified 1369
36 Ga0070673_100115824 3300005364 Unclassified 2229
37 Ga0070673_100326317 3300005364 Bacteria 1357
38 Ga0070673_100720820 3300005364 Bacteria 917
39 Ga0070688_100200540 3300005365 Unclassified 1396
40 Ga0070688_100242508 3300005365 Bacteria 1280
41 Ga0070667_100600920 3300005367 Bacteria 1014
42 Ga0070709_10163568 3300005434 Bacteria 1549
43 Ga0070714_100014777 3300005435 Bacteria 6273
44 Ga0070711_100189374 3300005439 Bacteria 1580
45 Ga0070705_100036463 3300005440 Unclassified 2765
46 Ga0070705_100053641 3300005440 Bacteria 2361
47 Ga0070705_100337146 3300005440 Bacteria 1094
48 Ga0070700_100044107 3300005441 Bacteria 2745
49 Ga0070694_100062117 3300005444 Bacteria 2551
50 Ga0070694_100079442 3300005444 Unclassified 2277
51 Ga0070708_100305820 3300005445 Bacteria 1497
52 Ga0070708_100548031 3300005445 Unclassified 1091
53 Ga0070678_100342734 3300005456 Bacteria 1282
54 Ga0070662_100096702 3300005457 Bacteria 2228
55 Ga0070681_10004172 3300005458 Bacteria 13677
56 Ga0070681_10612774 3300005458 Bacteria 1003
57 Ga0068867_100021130 3300005459 Bacteria 4643
58 Ga0068867_100174257 3300005459 Unclassified 1706
59 Ga0068867_100675074 3300005459 Bacteria 909
60 Ga0070706_100176989 3300005467 Bacteria 1992
61 Ga0070707_100735159 3300005468 Unclassified 950
62 Ga0070699_100040231 3300005518 Bacteria 4048
63 Ga0070699_100055038 3300005518 Bacteria 3446
64 Ga0070699_100249073 3300005518 Bacteria 1587
65 Ga0070699_100368784 3300005518 Bacteria 1295
66 Ga0070679_100073243 3300005530 Bacteria 3417
67 Ga0070684_100357865 3300005535 Unclassified 1343
68 Ga0070697_100090728 3300005536 Bacteria 2526
69 Ga0070697_100403787 3300005536 Bacteria 1186
70 Ga0070686_100010181 3300005544 Bacteria 5291
71 Ga0070686_100023530 3300005544 Bacteria 3683
72 Ga0070686_100096215 3300005544 Bacteria 1991
73 Ga0070686_100162569 3300005544 Bacteria 1573
74 Ga0070686_100358363 3300005544 Bacteria 1098
75 Ga0070695_100013891 3300005545 Bacteria 4846
76 Ga0070695_100564006 3300005545 Bacteria 889
77 Ga0070696_100071736 3300005546 Bacteria 2438
78 Ga0070696_100129307 3300005546 Bacteria 1836
79 Ga0070696_100155476 3300005546 Bacteria 1682
80 Ga0070665_100013780 3300005548 Bacteria 8134
81 Ga0070704_100287265 3300005549 Bacteria 1365
82 Ga0070704_100726298 3300005549 Bacteria 883
83 Ga0068855_100881784 3300005563 Bacteria 946
84 Ga0068857_100131116 3300005577 Bacteria 2261
85 Ga0068857_100333618 3300005577 Bacteria 1402
86 Ga0068857_100341069 3300005577 Bacteria 1386
87 Ga0068854_100024752 3300005578 Bacteria 4114
88 Ga0068854_100274153 3300005578 Bacteria 1355
89 Ga0068856_100518512 3300005614 Unclassified 1213
90 Ga0070702_100000151 3300005615 Bacteria 21712
91 Ga0070702_100280964 3300005615 Unclassified 1143
92 Ga0068859_100079948 3300005617 Bacteria 3310
93 Ga0068859_100268530 3300005617 Bacteria 1798
94 Ga0068859_100281825 3300005617 Unclassified 1755
95 Ga0068859_100844396 3300005617 Bacteria 1002
96 Ga0068859_100995858 3300005617 Bacteria 920
97 Ga0068864_100012699 3300005618 Bacteria 6962
98 Ga0068864_100017880 3300005618 Bacteria 5914
99 Ga0068864_100252451 3300005618 Bacteria 1638
100 Ga0068866_10030498 3300005718 Unclassified 2589
101 Ga0068861_100003061 3300005719 Bacteria 11043
102 Ga0068861_100056230 3300005719 Bacteria 3003
103 Ga0068861_100429578 3300005719 Bacteria 1179
104 Ga0068851_10207099 3300005834 Bacteria 1097
105 Ga0068863_100008809 3300005841 Bacteria 9853
106 Ga0068863_100438571 3300005841 Bacteria 1281
107 Ga0068863_100601897 3300005841 Bacteria 1088
108 Ga0068858_100001257 3300005842 Bacteria 26230
109 Ga0068858_100027342 3300005842 Bacteria 5300
110 Ga0068858_100088338 3300005842 Bacteria 2884
111 Ga0068858_100273403 3300005842 Bacteria 1608
112 Ga0068858_100647543 3300005842 Bacteria 1027
113 Ga0068858_101045555 3300005842 Bacteria 801
114 Ga0068860_100595395 3300005843 Unclassified 1111
115 Ga0068862_100040866 3300005844 Bacteria 3944
116 Ga0068862_100050653 3300005844 Bacteria 3549
117 Ga0068862_100125674 3300005844 Bacteria 2264
118 Ga0068862_100294916 3300005844 Bacteria 1490
119 Ga0070715_10086922 3300006163 Bacteria 1431
120 Ga0097621_100017796 3300006237 Bacteria 5409
121 Ga0097621_100089585 3300006237 Bacteria 2572
122 Ga0068871_100076194 3300006358 Bacteria 2770
123 Ga0068871_100080376 3300006358 Unclassified 2699
124 Ga0068871_100080837 3300006358 Unclassified 2691
125 Ga0068871_100290110 3300006358 Bacteria 1433
126 Ga0068871_100404384 3300006358 Unclassified 1216
127 Ga0075428_100205338 3300006844 Bacteria 2129
128 Ga0075428_100230171 3300006844 Bacteria 2000
129 Ga0075431_100041860 3300006847 Bacteria 4724
130 Ga0075433_10039771 3300006852 Bacteria 4067
131 Ga0075433_10058410 3300006852 Bacteria 3374
132 Ga0075433_10088493 3300006852 Bacteria 2736
133 Ga0075433_10141263 3300006852 Unclassified 2140
134 Ga0075433_10557641 3300006852 Unclassified 1007
135 Ga0075434_100009707 3300006871 Bacteria 8993
136 Ga0075434_100061700 3300006871 Bacteria 3731
137 Ga0075434_100110366 3300006871 Bacteria 2761
138 Ga0075434_100115087 3300006871 Bacteria 2702
139 Ga0075434_100315784 3300006871 Unclassified 1583
140 Ga0068865_100041369 3300006881 Bacteria 3135
141 Ga0068865_100142509 3300006881 Unclassified 1808
142 Ga0068865_100184099 3300006881 Bacteria 1610
143 Ga0068865_100941106 3300006881 Unclassified 753
144 Ga0075436_100000126 3300006914 Bacteria 45406
145 Ga0075436_100011328 3300006914 Bacteria 6118
146 Ga0075436_100013071 3300006914 Bacteria 5691
147 Ga0075436_100013229 3300006914 Bacteria 5656
148 Ga0075436_100048044 3300006914 Bacteria 2945
149 Ga0075436_100171596 3300006914 Bacteria 1531
150 Ga0075436_100584397 3300006914 Unclassified 822
151 Ga0097620_100079947 3300006931 Bacteria 3310
152 Ga0097620_100268557 3300006931 Bacteria 1798
153 Ga0097620_100281835 3300006931 Unclassified 1755
154 Ga0097620_100844472 3300006931 Bacteria 1002
155 Ga0097620_100996032 3300006931 Bacteria 920
156 Ga0075435_100000002 3300007076 Bacteria 140391
157 Ga0075435_100001671 3300007076 Bacteria 14398
158 Ga0075435_100003029 3300007076 Bacteria 11320
159 Ga0075435_100005429 3300007076 Bacteria 8898
160 Ga0075435_100016445 3300007076 Bacteria 5578
161 Ga0075435_100030797 3300007076 Unclassified 4222
162 Ga0075435_100274074 3300007076 Bacteria 1439
163 Ga0075435_100301796 3300007076 Bacteria 1370
164 Ga0105240_10028783 3300009093 Bacteria 7248
165 Ga0105240_10073491 3300009093 Unclassified 4222
166 Ga0105240_10569362 3300009093 Bacteria 1251
167 Ga0111539_10084464 3300009094 Unclassified 3732
168 Ga0111539_10137781 3300009094 Unclassified 2858
169 Ga0111539_10183508 3300009094 Bacteria 2444
170 Ga0105245_10010923 3300009098 Bacteria 7901
171 Ga0105245_10047425 3300009098 Unclassified 3841
172 Ga0105245_10099030 3300009098 Bacteria 2695
173 Ga0105245_10284331 3300009098 Bacteria 1618
174 Ga0105247_10005097 3300009101 Bacteria 8326
175 Ga0105247_10009674 3300009101 Bacteria 5846
176 Ga0105247_10010555 3300009101 Bacteria 5580
177 Ga0114129_10000083 3300009147 Bacteria 87553
178 Ga0114129_10005305 3300009147 Bacteria 18188
179 Ga0114129_10005534 3300009147 Bacteria 17866
180 Ga0114129_10020348 3300009147 Bacteria 9440
181 Ga0114129_10038901 3300009147 Bacteria 6704
182 Ga0114129_10082334 3300009147 Bacteria 4472
183 Ga0114129_10201245 3300009147 Bacteria 2697
184 Ga0114129_10228440 3300009147 Bacteria 2507
185 Ga0114129_10365671 3300009147 Unclassified 1908
186 Ga0114129_10555849 3300009147 Bacteria 1492
187 Ga0114129_10791445 3300009147 Unclassified 1210
188 Ga0105242_10018485 3300009176 Bacteria 5450
189 Ga0105242_10067454 3300009176 Unclassified 2958
190 Ga0105242_10296222 3300009176 Bacteria 1475
191 Ga0105242_10373313 3300009176 Unclassified 1324
192 Ga0105248_10002375 3300009177 Bacteria 20906
193 Ga0105248_10011006 3300009177 Bacteria 9980
194 Ga0105248_10072153 3300009177 Unclassified 3880
195 Ga0105248_10087191 3300009177 Bacteria 3512
196 Ga0105248_10277942 3300009177 Bacteria 1885
197 Ga0105248_10395631 3300009177 Unclassified 1556
198 Ga0105248_11180508 3300009177 Bacteria 865
199 Ga0105237_10189819 3300009545 Bacteria 2055
200 Ga0105238_11131147 3300009551 Unclassified 806
201 Ga0105249_10037762 3300009553 Unclassified 4382
202 Ga0105249_10258265 3300009553 Unclassified 1730
203 Ga0105246_10151787 3300011119 Bacteria 1754
204 Ga0157374_10139950 3300013296 Bacteria 2349
205 Ga0157374_10447944 3300013296 Unclassified 1292
206 Ga0157374_11037603 3300013296 Bacteria 839
207 Ga0157378_10229327 3300013297 Unclassified 1769
208 Ga0157378_10595722 3300013297 Unclassified 1116
209 Ga0163162_10154444 3300013306 Unclassified 2414
210 Ga0163162_10162514 3300013306 Bacteria 2355
211 Ga0163162_10572748 3300013306 Bacteria 1256
212 Ga0157375_10068674 3300013308 Bacteria 3547
213 Ga0157375_10078541 3300013308 Bacteria 3334
214 Ga0157375_10092869 3300013308 Bacteria 3082
215 Ga0157375_10565781 3300013308 Bacteria 1297
216 Ga0157375_10832803 3300013308 Unclassified 1070
217 Ga0163163_10124302 3300014325 Bacteria 2616
218 Ga0157380_10198146 3300014326 Unclassified 1779
219 Ga0157380_10248791 3300014326 Unclassified 1608
220 Ga0157379_10015835 3300014968 Bacteria 6626
221 Ga0157379_10059505 3300014968 Bacteria 3415
222 Ga0157379_10237375 3300014968 Bacteria 1653
223 Ga0157379_10324603 3300014968 Unclassified 1406
224 Ga0157376_10006374 3300014969 Bacteria 8334
225 Ga0157376_10041174 3300014969 Unclassified 3781
226 Ga0157376_10060487 3300014969 Bacteria 3181
227 Ga0157376_10106134 3300014969 Bacteria 2464
228 Ga0157376_10130760 3300014969 Bacteria 2240
229 Ga0213876_10058505 3300021384 Bacteria 2035
230 Ga0207642_10028070 3300025899 Unclassified 2313
231 Ga0207710_10041797 3300025900 Bacteria 2034
232 Ga0207710_10043945 3300025900 Unclassified 1989
233 Ga0207680_10057872 3300025903 Unclassified 2347
234 Ga0207685_10050149 3300025905 Bacteria 1607
235 Ga0207643_10187894 3300025908 Bacteria 1253
236 Ga0207707_10008931 3300025912 Bacteria 8703
237 Ga0207695_10019925 3300025913 Bacteria 7704
238 Ga0207663_10204115 3300025916 Unclassified 1428
239 Ga0207662_10112696 3300025918 Bacteria 1698
240 Ga0207657_10177759 3300025919 Bacteria 1722
241 Ga0207652_10188492 3300025921 Bacteria 1855
242 Ga0207681_10003251 3300025923 Bacteria 10191
243 Ga0207681_10021085 3300025923 Bacteria 4137
244 Ga0207681_10052464 3300025923 Bacteria 2765
245 Ga0207650_10148928 3300025925 Bacteria 1846
246 Ga0207650_10538373 3300025925 Unclassified 978
247 Ga0207659_10006135 3300025926 Bacteria 7343
248 Ga0207659_10564907 3300025926 Bacteria 968
249 Ga0207687_10056955 3300025927 Unclassified 2743
250 Ga0207687_10106176 3300025927 Bacteria 2076
251 Ga0207664_10042500 3300025929 Unclassified 3548
252 Ga0207644_10382040 3300025931 Unclassified 1149
253 Ga0207706_10041249 3300025933 Bacteria 4092
254 Ga0207686_10060655 3300025934 Bacteria 2395
255 Ga0207686_10226586 3300025934 Bacteria 1353
256 Ga0207670_10272643 3300025936 Bacteria 1316
257 Ga0207670_10356826 3300025936 Bacteria 1159
258 Ga0207669_10721597 3300025937 Bacteria 821
259 Ga0207704_10028854 3300025938 Bacteria 3085
260 Ga0207704_10151216 3300025938 Unclassified 1638
261 Ga0207691_10063797 3300025940 Unclassified 3340
262 Ga0207691_10108387 3300025940 Bacteria 2472
263 Ga0207711_10002897 3300025941 Bacteria 15030
264 Ga0207711_10017514 3300025941 Bacteria 5951
265 Ga0207711_10063137 3300025941 Unclassified 3197
266 Ga0207711_10113822 3300025941 Bacteria 2409
267 Ga0207711_10231425 3300025941 Bacteria 1693
268 Ga0207711_10451482 3300025941 Bacteria 1197
269 Ga0207711_10654490 3300025941 Unclassified 980
270 Ga0207711_10723280 3300025941 Unclassified 928
271 Ga0207689_10046693 3300025942 Bacteria 3578
272 Ga0207661_10460038 3300025944 Bacteria 1160
273 Ga0207679_10145230 3300025945 Unclassified 1923
274 Ga0207651_10064753 3300025960 Bacteria 2560
275 Ga0207651_10362894 3300025960 Bacteria 1223
276 Ga0207651_10383493 3300025960 Bacteria 1192
277 Ga0207712_10131982 3300025961 Unclassified 1905
278 Ga0207712_10395349 3300025961 Unclassified 1160
279 Ga0207712_10842090 3300025961 Unclassified 808
280 Ga0207668_10080020 3300025972 Unclassified 2366
281 Ga0207668_10332965 3300025972 Bacteria 1264
282 Ga0207640_10012592 3300025981 Bacteria 4823
283 Ga0207640_10185586 3300025981 Bacteria 1563
284 Ga0207658_10149244 3300025986 Unclassified 1902
285 Ga0207658_10752170 3300025986 Bacteria 883
286 Ga0207677_10572378 3300026023 Bacteria 987
287 Ga0207703_10252059 3300026035 Bacteria 1591
288 Ga0207708_10063278 3300026075 Bacteria 2826
289 Ga0207641_10250288 3300026088 Bacteria 1654
290 Ga0207641_10613901 3300026088 Unclassified 1066
291 Ga0207648_10002220 3300026089 Bacteria 21052
292 Ga0207648_10046605 3300026089 Unclassified 3801
293 Ga0207648_10197377 3300026089 Unclassified 1784
294 Ga0207676_10011325 3300026095 Bacteria 6376
295 Ga0207676_10019466 3300026095 Bacteria 4953
296 Ga0207676_10051030 3300026095 Bacteria 3228
297 Ga0207674_10163017 3300026116 Bacteria 2184
298 Ga0207675_100000371 3300026118 Bacteria 43068
299 Ga0207675_100000536 3300026118 Bacteria 36980
300 Ga0207675_100038715 3300026118 Bacteria 4450
301 Ga0207675_100537532 3300026118 Bacteria 1167
302 Ga0207675_100567815 3300026118 Bacteria 1135
303 Ga0207675_100996216 3300026118 Bacteria 856
304 Ga0207683_10088636 3300026121 Bacteria 2753
305 Ga0268266_10181738 3300028379 Unclassified 1915
306 Ga0268265_10001443 3300028380 Bacteria 20048
307 Ga0268265_10030374 3300028380 Bacteria 3890
308 Ga0268265_10131129 3300028380 Bacteria 2083
309 Ga0268265_10649547 3300028380 Bacteria 1014
310 Ga0268264_10443650 3300028381 Unclassified 1256
311 Ga0307416_100094150 3300032002 Bacteria 2582
312 Ga0373930_0010264 3300034816 Bacteria 1671
313 Ga0373948_0001039 3300034817 Bacteria 3735
314 Ga0373950_0030269 3300034818 Bacteria 999
315 Ga0373958_0003226 3300034819 Bacteria 2339
316 Ga0373938_0013413 3300034957 Bacteria 1554
317 Ga0373928_0003267 3300035084 Bacteria 3104
318 Ga0373929_0004028 3300035085 Bacteria 2632
319 Ga0373949_0029189 3300035090 Unclassified 1305
320 Ga0373951_0004562 3300035091 Bacteria 3280
321 Ga0373932_0001144 3300035112 Bacteria 7621
322 Ga0373939_0002622 3300035114 Bacteria 4225
323 Ga0373941_0004767 3300035115 Bacteria 3155
324 Ga0373960_0003930 3300035121 Bacteria 3389
325 Ga0373961_0002608 3300035241 Bacteria 4641
326 Ga0373962_0014795 3300035242 Bacteria 1992
327 Ga0373931_0042018 3300035691 Unclassified 2403
328 Ga0373931_0154689 3300035691 Bacteria 1339
329 Ga0373931_0349891 3300035691 Unclassified 925
330 Ga0373935_0123947 3300035692 Bacteria 1729
331 Ga0373947_0222819 3300035725 Unclassified 1240
332 Ga0373937_0028705 3300036401 Bacteria 5036
333 Ga0373937_0068426 3300036401 Bacteria 3274
334 Ga0373925_0094702 3300037068 Bacteria 2287
335 Ga0373925_0143722 3300037068 Bacteria 1869
336 Ga0373925_0310395 3300037068 Bacteria 1275
337 Ga0373925_0343609 3300037068 Unclassified 1211
338 Ga0395898_0405931 3300037466 Bacteria 1299
339 Ga0436365_0348551 3300039437 Bacteria 4497
340 Ga0439435_0014828 3300042436 Bacteria 1931
341 Ga0451576_0006978 3300045051 Bacteria 13669
342 Ga0466967_0790868 3300045976 Bacteria 942
343 Ga0495629_0086214 3300046459 Unclassified 2191
344 Ga0495629_0153580 3300046459 Unclassified 1600
345 Ga0495582_0267648 3300046473 Unclassified 980
346 Ga0495639_0035151 3300046475 Unclassified 2242
347 Ga0495594_0134701 3300046499 Bacteria 1400
348 Ga0495608_0334957 3300046511 Bacteria 933
349 Ga0495618_0200324 3300046514 Unclassified 1264
350 Ga0495628_0142756 3300046516 Bacteria 1827
351 Ga0495640_0165198 3300046533 Bacteria 1416
352 Ga0495645_0026635 3300046543 Bacteria 4198
353 Ga0495647_0066231 3300046681 Bacteria 1436
354 Ga0495647_0144380 3300046681 Unclassified 1017
355 Ga0495647_0208415 3300046681 Bacteria 859
356 Ga0495647_0259250 3300046681 Unclassified 775
357 Ga0495658_0118950 3300046683 Bacteria 1596
358 Ga0495658_0138209 3300046683 Bacteria 1488
359 Ga0495658_0164766 3300046683 Bacteria 1369
360 Ga0495658_0218009 3300046683 Unclassified 1194
361 Ga0495669_0004790 3300046684 Bacteria 5613
362 Ga0495674_0263621 3300047319 Bacteria 1415
363 Ga0495674_0662719 3300047319 Unclassified 822
364 Ga0495680_0272109 3300047322 Bacteria 1196
365 Ga0495684_0041193 3300047471 Bacteria 3540
366 Ga0495684_0156528 3300047471 Unclassified 1702
367 Ga0496100_0073575 3300048903 Bacteria 2287
368 Ga0496101_0002493 3300048904 Bacteria 11304
369 Ga0496102_0150758 3300048905 Unclassified 2185
370 Ga0496104_0033899 3300048907 Bacteria 4759
371 Ga0496104_0121043 3300048907 Unclassified 2513
372 Ga0496104_0216129 3300048907 Bacteria 1829
373 Ga0496104_0426202 3300048907 Bacteria 1238
374 Ga0496106_0029272 3300048909 Bacteria 4104
375 Ga0496108_0020737 3300048911 Bacteria 5403
376 Ga0496109_0296834 3300048912 Bacteria 1524
377 Ga0496109_0624665 3300048912 Unclassified 1014
378 Ga0496110_0020053 3300048913 Bacteria 5638
379 Ga0496110_0500115 3300048913 Bacteria 1107
380 Ga0496112_0027862 3300048915 Bacteria 5449
381 Ga0496112_0726785 3300048915 Bacteria 920
382 Ga0496113_0131031 3300048916 Unclassified 1968
383 Ga0496113_0395000 3300048916 Bacteria 1110
384 Ga0496114_0003283 3300048917 Bacteria 12414
385 Ga0496114_0163519 3300048917 Bacteria 1937
386 Ga0496115_0020754 3300048918 Bacteria 5068
387 Ga0496115_0150242 3300048918 Bacteria 1923
388 nmdc:mga05p37_12267_c1 3300050507 Bacteria 7579
389 nmdc:mga05p37_13664_c1 3300050507 Bacteria 9730
390 nmdc:mga05p37_20066_c1 3300050507 Bacteria 8087
391 nmdc:mga05p37_29851_c1 3300050507 Bacteria 6653
392 nmdc:mga05p37_340097_c1 3300050507 Bacteria 1770
393 nmdc:mga05p37_343478_c1 3300050507 Bacteria 1759
394 nmdc:mga05p37_5410_c1 3300050507 Bacteria 9239
395 nmdc:mga09592_208338_c1 3300050508 Unclassified 1693
396 nmdc:mga06r32_182397_c1 3300050510 Unclassified 2085
397 nmdc:mga06r32_242175_c1 3300050510 Bacteria 1791
398 nmdc:mga08y16_45586_c1 3300050511 Unclassified 4594
399 nmdc:mga08y16_52991_c1 3300050511 Bacteria 4243
400 nmdc:mga08y16_674858_c1 3300050511 Unclassified 1035
401 nmdc:mga0n895_112764_c1 3300050512 Bacteria 2736
402 nmdc:mga0n895_158083_c1 3300050512 Bacteria 2298
403 nmdc:mga0n895_16108_c1 3300050512 Bacteria 6851
404 nmdc:mga0n895_235847_c1 3300050512 Bacteria 1857
405 nmdc:mga0rr50_104030_c1 3300050513 Bacteria 2236
406 nmdc:mga0rr50_138445_c1 3300050513 Bacteria 1956
407 nmdc:mga0rr50_2178_c1 3300050513 Bacteria 10973
408 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
409 nmdc:mga0rr50_446436_c1 3300050513 Bacteria 1096
410 nmdc:mga0rr50_52722_c1 3300050513 Bacteria 3024
411 nmdc:mga0rr50_637398_c1 3300050513 Unclassified 909
412 nmdc:mga08x19_12561_c1 3300050514 Bacteria 5106
413 nmdc:mga08x19_136024_c1 3300050514 Bacteria 1657
414 nmdc:mga08x19_30966_c1 3300050514 Bacteria 3363
415 nmdc:mga08x19_31734_c1 3300050514 Bacteria 3326
416 nmdc:mga08x19_346562_c1 3300050514 Bacteria 1037
417 nmdc:mga08x19_383_c1 3300050514 Bacteria 31056
418 nmdc:mga0a205_149026_c1 3300050515 Bacteria 2240
419 nmdc:mga0a205_29687_c1 3300050515 Bacteria 5233
420 nmdc:mga0a205_48546_c1 3300050515 Bacteria 4096
421 nmdc:mga0a205_531712_c1 3300050515 Bacteria 1032
422 nmdc:mga0a205_82980_c1 3300050515 Bacteria 3095
423 Ga0495601_0027863 3300053077 Bacteria 3496
424 Ga0495601_0096582 3300053077 Unclassified 1906
425 Ga0495595_0085748 3300053084 Bacteria 1506
426 Ga0495595_0214781 3300053084 Bacteria 959
427 Ga0495619_0091556 3300053085 Unclassified 2059
428 Ga0495619_0425857 3300053085 Unclassified 916
429 Ga0495619_0490297 3300053085 Bacteria 845
430 Ga0501082_0092059 3300060353 Bacteria 2619
431 nmdc:mga0n895_64634_c1
432 Ga0065712_10074894
433 Ga0065715_10145135
434 Ga0070676_10250436
435 Ga0070683_100115617
436 Ga0070683_100119134
437 Ga0070683_100557871
438 Ga0070690_100098559
439 Ga0070670_100417315
440 Ga0070670_100847035
441 Ga0068869_100341441
442 Ga0070666_10049577
443 Ga0070666_10330762
444 Ga0070680_100273233
445 Ga0070682_100272814
446 Ga0068868_100106560
447 Ga0068868_100375875
448 Ga0068868_100584064
449 Ga0068868_100874496
450 Ga0070660_100426714
451 Ga0070689_100163194
452 Ga0070689_100172726
453 Ga0070689_100434339
454 Ga0070691_10008550
455 Ga0070687_100021073
456 Ga0070668_100550940
457 Ga0070669_100014153
458 Ga0070669_100024552
459 Ga0070669_100036661
460 Ga0070669_100253664
461 Ga0070675_100001650
462 Ga0070675_100549852
463 Ga0070671_100161517
464 Ga0070674_100023385
465 Ga0070674_100259316
466 Ga0070673_100115824
467 Ga0070673_100326317
468 Ga0070673_100720820
469 Ga0070688_100200540
470 Ga0070688_100242508
471 Ga0070667_100600920
472 Ga0070709_10163568
473 Ga0070714_100014777
474 Ga0070711_100189374
475 Ga0070705_100036463
476 Ga0070705_100053641
477 Ga0070705_100337146
478 Ga0070700_100044107
479 Ga0070694_100062117
480 Ga0070694_100079442
481 Ga0070708_100305820
482 Ga0070708_100548031
483 Ga0070678_100342734
484 Ga0070662_100096702
485 Ga0070681_10004172
486 Ga0070681_10612774
487 Ga0068867_100021130
488 Ga0068867_100174257
489 Ga0068867_100675074
490 Ga0070706_100176989
491 Ga0070707_100735159
492 Ga0070699_100040231
493 Ga0070699_100055038
494 Ga0070699_100249073
495 Ga0070699_100368784
496 Ga0070679_100073243
497 Ga0070684_100357865
498 Ga0070697_100090728
499 Ga0070697_100403787
500 Ga0070686_100010181
501 Ga0070686_100023530
502 Ga0070686_100096215
503 Ga0070686_100162569
504 Ga0070686_100358363
505 Ga0070695_100013891
506 Ga0070695_100564006
507 Ga0070696_100071736
508 Ga0070696_100129307
509 Ga0070696_100155476
510 Ga0070665_100013780
511 Ga0070704_100287265
512 Ga0070704_100726298
513 Ga0068855_100881784
514 Ga0068857_100131116
515 Ga0068857_100333618
516 Ga0068857_100341069
517 Ga0068854_100024752
518 Ga0068854_100274153
519 Ga0068856_100518512
520 Ga0070702_100000151
521 Ga0070702_100280964
522 Ga0068859_100079948
523 Ga0068859_100268530
524 Ga0068859_100281825
525 Ga0068859_100844396
526 Ga0068859_100995858
527 Ga0068864_100012699
528 Ga0068864_100017880
529 Ga0068864_100252451
530 Ga0068866_10030498
531 Ga0068861_100003061
532 Ga0068861_100056230
533 Ga0068861_100429578
534 Ga0068851_10207099
535 Ga0068863_100008809
536 Ga0068863_100438571
537 Ga0068863_100601897
538 Ga0068858_100001257
539 Ga0068858_100027342
540 Ga0068858_100088338
541 Ga0068858_100273403
542 Ga0068858_100647543
543 Ga0068858_101045555
544 Ga0068860_100595395
545 Ga0068862_100040866
546 Ga0068862_100050653
547 Ga0068862_100125674
548 Ga0068862_100294916
549 Ga0070715_10086922
550 Ga0097621_100017796
551 Ga0097621_100089585
552 Ga0068871_100076194
553 Ga0068871_100080376
554 Ga0068871_100080837
555 Ga0068871_100290110
556 Ga0068871_100404384
557 Ga0075428_100205338
558 Ga0075428_100230171
559 Ga0075431_100041860
560 Ga0075433_10039771
561 Ga0075433_10058410
562 Ga0075433_10088493
563 Ga0075433_10141263
564 Ga0075433_10557641
565 Ga0075434_100009707
566 Ga0075434_100061700
567 Ga0075434_100110366
568 Ga0075434_100115087
569 Ga0075434_100315784
570 Ga0068865_100041369
571 Ga0068865_100142509
572 Ga0068865_100184099
573 Ga0068865_100941106
574 Ga0075436_100000126
575 Ga0075436_100011328
576 Ga0075436_100013071
577 Ga0075436_100013229
578 Ga0075436_100048044
579 Ga0075436_100171596
580 Ga0075436_100584397
581 Ga0097620_100079947
582 Ga0097620_100268557
583 Ga0097620_100281835
584 Ga0097620_100844472
585 Ga0097620_100996032
586 Ga0075435_100000002
587 Ga0075435_100001671
588 Ga0075435_100003029
589 Ga0075435_100005429
590 Ga0075435_100016445
591 Ga0075435_100030797
592 Ga0075435_100274074
593 Ga0075435_100301796
594 Ga0105240_10028783
595 Ga0105240_10073491
596 Ga0105240_10569362
597 Ga0111539_10084464
598 Ga0111539_10137781
599 Ga0111539_10183508
600 Ga0105245_10010923
601 Ga0105245_10047425
602 Ga0105245_10099030
603 Ga0105245_10284331
604 Ga0105247_10005097
605 Ga0105247_10009674
606 Ga0105247_10010555
607 Ga0114129_10000083
608 Ga0114129_10005305
609 Ga0114129_10005534
610 Ga0114129_10020348
611 Ga0114129_10038901
612 Ga0114129_10082334
613 Ga0114129_10201245
614 Ga0114129_10228440
615 Ga0114129_10365671
616 Ga0114129_10555849
617 Ga0114129_10791445
618 Ga0105242_10018485
619 Ga0105242_10067454
620 Ga0105242_10296222
621 Ga0105242_10373313
622 Ga0105248_10002375
623 Ga0105248_10011006
624 Ga0105248_10072153
625 Ga0105248_10087191
626 Ga0105248_10277942
627 Ga0105248_10395631
628 Ga0105248_11180508
629 Ga0105237_10189819
630 Ga0105238_11131147
631 Ga0105249_10037762
632 Ga0105249_10258265
633 Ga0105246_10151787
634 Ga0157374_10139950
635 Ga0157374_10447944
636 Ga0157374_11037603
637 Ga0157378_10229327
638 Ga0157378_10595722
639 Ga0163162_10154444
640 Ga0163162_10162514
641 Ga0163162_10572748
642 Ga0157375_10068674
643 Ga0157375_10078541
644 Ga0157375_10092869
645 Ga0157375_10565781
646 Ga0157375_10832803
647 Ga0163163_10124302
648 Ga0157380_10198146
649 Ga0157380_10248791
650 Ga0157379_10015835
651 Ga0157379_10059505
652 Ga0157379_10237375
653 Ga0157379_10324603
654 Ga0157376_10006374
655 Ga0157376_10041174
656 Ga0157376_10060487
657 Ga0157376_10106134
658 Ga0157376_10130760
659 Ga0213876_10058505
660 Ga0207642_10028070
661 Ga0207710_10041797
662 Ga0207710_10043945
663 Ga0207680_10057872
664 Ga0207685_10050149
665 Ga0207643_10187894
666 Ga0207707_10008931
667 Ga0207695_10019925
668 Ga0207663_10204115
669 Ga0207662_10112696
670 Ga0207657_10177759
671 Ga0207652_10188492
672 Ga0207681_10003251
673 Ga0207681_10021085
674 Ga0207681_10052464
675 Ga0207650_10148928
676 Ga0207650_10538373
677 Ga0207659_10006135
678 Ga0207659_10564907
679 Ga0207687_10056955
680 Ga0207687_10106176
681 Ga0207664_10042500
682 Ga0207644_10382040
683 Ga0207706_10041249
684 Ga0207686_10060655
685 Ga0207686_10226586
686 Ga0207670_10272643
687 Ga0207670_10356826
688 Ga0207669_10721597
689 Ga0207704_10028854
690 Ga0207704_10151216
691 Ga0207691_10063797
692 Ga0207691_10108387
693 Ga0207711_10002897
694 Ga0207711_10017514
695 Ga0207711_10063137
696 Ga0207711_10113822
697 Ga0207711_10231425
698 Ga0207711_10451482
699 Ga0207711_10654490
700 Ga0207711_10723280
701 Ga0207689_10046693
702 Ga0207661_10460038
703 Ga0207679_10145230
704 Ga0207651_10064753
705 Ga0207651_10362894
706 Ga0207651_10383493
707 Ga0207712_10131982
708 Ga0207712_10395349
709 Ga0207712_10842090
710 Ga0207668_10080020
711 Ga0207668_10332965
712 Ga0207640_10012592
713 Ga0207640_10185586
714 Ga0207658_10149244
715 Ga0207658_10752170
716 Ga0207677_10572378
717 Ga0207703_10252059
718 Ga0207708_10063278
719 Ga0207641_10250288
720 Ga0207641_10613901
721 Ga0207648_10002220
722 Ga0207648_10046605
723 Ga0207648_10197377
724 Ga0207676_10011325
725 Ga0207676_10019466
726 Ga0207676_10051030
727 Ga0207674_10163017
728 Ga0207675_100000371
729 Ga0207675_100000536
730 Ga0207675_100038715
731 Ga0207675_100537532
732 Ga0207675_100567815
733 Ga0207675_100996216
734 Ga0207683_10088636
735 Ga0268266_10181738
736 Ga0268265_10001443
737 Ga0268265_10030374
738 Ga0268265_10131129
739 Ga0268265_10649547
740 Ga0268264_10443650
741 Ga0307416_100094150
742 Ga0373930_0010264
743 Ga0373948_0001039
744 Ga0373950_0030269
745 Ga0373958_0003226
746 Ga0373938_0013413
747 Ga0373928_0003267
748 Ga0373929_0004028
749 Ga0373949_0029189
750 Ga0373951_0004562
751 Ga0373932_0001144
752 Ga0373939_0002622
753 Ga0373941_0004767
754 Ga0373960_0003930
755 Ga0373961_0002608
756 Ga0373962_0014795
757 Ga0373931_0042018
758 Ga0373931_0154689
759 Ga0373931_0349891
760 Ga0373935_0123947
761 Ga0373947_0222819
762 Ga0373937_0028705
763 Ga0373937_0068426
764 Ga0373925_0094702
765 Ga0373925_0143722
766 Ga0373925_0310395
767 Ga0373925_0343609
768 Ga0395898_0405931
769 Ga0436365_0348551
770 Ga0439435_0014828
771 Ga0451576_0006978
772 Ga0466967_0790868
773 Ga0495629_0086214
774 Ga0495629_0153580
775 Ga0495582_0267648
776 Ga0495639_0035151
777 Ga0495594_0134701
778 Ga0495608_0334957
779 Ga0495618_0200324
780 Ga0495628_0142756
781 Ga0495640_0165198
782 Ga0495645_0026635
783 Ga0495647_0066231
784 Ga0495647_0144380
785 Ga0495647_0208415
786 Ga0495647_0259250
787 Ga0495658_0118950
788 Ga0495658_0138209
789 Ga0495658_0164766
790 Ga0495658_0218009
791 Ga0495669_0004790
792 Ga0495674_0263621
793 Ga0495674_0662719
794 Ga0495680_0272109
795 Ga0495684_0041193
796 Ga0495684_0156528
797 Ga0496100_0073575
798 Ga0496101_0002493
799 Ga0496102_0150758
800 Ga0496104_0033899
801 Ga0496104_0121043
802 Ga0496104_0216129
803 Ga0496104_0426202
804 Ga0496106_0029272
805 Ga0496108_0020737
806 Ga0496109_0296834
807 Ga0496109_0624665
808 Ga0496110_0020053
809 Ga0496110_0500115
810 Ga0496112_0027862
811 Ga0496112_0726785
812 Ga0496113_0131031
813 Ga0496113_0395000
814 Ga0496114_0003283
815 Ga0496114_0163519
816 Ga0496115_0020754
817 Ga0496115_0150242
818 nmdc:mga05p37_12267_c1
819 nmdc:mga05p37_13664_c1
820 nmdc:mga05p37_20066_c1
821 nmdc:mga05p37_29851_c1
822 nmdc:mga05p37_340097_c1
823 nmdc:mga05p37_343478_c1
824 nmdc:mga05p37_5410_c1
825 nmdc:mga09592_208338_c1
826 nmdc:mga06r32_182397_c1
827 nmdc:mga06r32_242175_c1
828 nmdc:mga08y16_45586_c1
829 nmdc:mga08y16_52991_c1
830 nmdc:mga08y16_674858_c1
831 nmdc:mga0n895_112764_c1
832 nmdc:mga0n895_158083_c1
833 nmdc:mga0n895_16108_c1
834 nmdc:mga0n895_235847_c1
835 nmdc:mga0rr50_104030_c1
836 nmdc:mga0rr50_138445_c1
837 nmdc:mga0rr50_2178_c1
838 nmdc:mga0rr50_27_c1
839 nmdc:mga0rr50_446436_c1
840 nmdc:mga0rr50_52722_c1
841 nmdc:mga0rr50_637398_c1
842 nmdc:mga08x19_12561_c1
843 nmdc:mga08x19_136024_c1
844 nmdc:mga08x19_30966_c1
845 nmdc:mga08x19_31734_c1
846 nmdc:mga08x19_346562_c1
847 nmdc:mga08x19_383_c1
848 nmdc:mga0a205_149026_c1
849 nmdc:mga0a205_29687_c1
850 nmdc:mga0a205_48546_c1
851 nmdc:mga0a205_531712_c1
852 nmdc:mga0a205_82980_c1
853 Ga0495601_0027863
854 Ga0495601_0096582
855 Ga0495595_0085748
856 Ga0495595_0214781
857 Ga0495619_0091556
858 Ga0495619_0425857
859 Ga0495619_0490297
860 Ga0501082_0092059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05728

UPF0227

Uncharacterised protein family (UPF0227)

27

231

0.86

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

27

155

0.75

PF00756

Esterase

Putative esterase

63

215

0.63

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

28

234

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8625 15 222
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.856 15 221
7z2x-assembly1.cif.gz_B wild-type ferulic acid esterase from lactobacillus buchneri 0.8424 14 222
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8412 10 223
7z2v-assembly1.cif.gz_B ferulic acid esterase variant s114a from lactobacillus buchneri 0.8371 13 222
ID Description Score Start End Superfamily
2qjwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8513 15 226 3.40.50.1820
2qjwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8381 15 226 3.40.50.1820
af_I1LY02_58_317_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8261 13 224 3.40.50.1820
af_E7F9Y7_35_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8245 16 218 3.40.50.1820
af_O17690_5_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8235 15 216 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F2RB66-F1-model_v4 Esterase 0.9916 16 227 GO:0004553
GO:0008474
AF-A0A6N2DGH9-F1-model_v4 deleted 0.969 16 208
AF-A0A7C2GY07-F1-model_v4 Alpha/beta fold hydrolase 0.9686 15 223 GO:0016787
AF-A0A7R8GFM6-F1-model_v4 deleted 0.9685 16 224
AF-A0A2V7ZF13-F1-model_v4 Esterase 0.9655 7 154

Map