F442159

General Info

Members Datasets Scaffolds Average Seq Length
430 195 430 139

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10153414|Ga0207695_101534143
Length 142
Sequence MSIKRTAKAHWNGTFKDGTGDLTTQSTTLNKTQYSFKTRFADGVGTNPEELIAAAHAGCFTMAVGYALSEAGFTPGDLNTEAVLELNTDNIPTISNIHLSLTGAKIDGVDEAKFKEIAEGAKANCIVSRALNVQISLDVQYA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
186 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 2.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 0.47
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1017797 3300001904 Bacteria 1127
2 JGI24739J22299_10011570 3300001989 Bacteria 3257
3 JGI24739J22299_10160228 3300001989 Bacteria 664
4 JGI24737J22298_10000796 3300001990 Bacteria 11186
5 JGI24737J22298_10011338 3300001990 Bacteria 2923
6 JGI24735J21928_10000003 3300002067 Bacteria 385983
7 JGI24735J21928_10000008 3300002067 Bacteria 319819
8 JGI24735J21928_10008450 3300002067 Bacteria 3327
9 JGI24744J21845_10012132 3300002077 Bacteria 1752
10 JGI25162J39368_1001539 3300002737 Bacteria 11872
11 JGI25164J39214_1001160 3300002772 Bacteria 7321
12 JGI25165J46597_1000157 3300003214 Bacteria 108987
13 rootH1_10032600 3300003316 Bacteria 7369
14 rootH2_10002560 3300003320 Bacteria 75599
15 rootH2_10115733 3300003320 Bacteria 9788
16 rootL2_10021763 3300003322 Bacteria 1562
17 rootL2_10021764 3300003322 Bacteria 4402
18 rootH1_10045017 3300003323 Bacteria 20986
19 rootH1_10045018 3300003323 Bacteria 4097
20 rootH1_10049623 3300003323 Bacteria 6962
21 Ga0058863_11364988 3300004799 Bacteria 3410
22 Ga0058862_10039046 3300004803 Bacteria 2790
23 Ga0065714_10150436 3300005288 Bacteria 1110
24 Ga0065714_10255104 3300005288 Bacteria 764
25 Ga0070658_10000014 3300005327 Bacteria 244978
26 Ga0070658_10307585 3300005327 Unclassified 1352
27 Ga0070658_10363638 3300005327 Bacteria 1240
28 Ga0070658_10561439 3300005327 Unclassified 988
29 Ga0070658_10854330 3300005327 Bacteria 791
30 Ga0070676_10000269 3300005328 Bacteria 22806
31 Ga0070680_100001914 3300005336 Bacteria 15284
32 Ga0070680_100011709 3300005336 Bacteria 6798
33 Ga0070682_100004229 3300005337 Bacteria 7967
34 Ga0068868_100018760 3300005338 Bacteria 5174
35 Ga0068868_100018837 3300005338 Bacteria 5166
36 Ga0070660_100005601 3300005339 Bacteria 8707
37 Ga0070660_100119434 3300005339 Bacteria 2103
38 Ga0070660_100679426 3300005339 Bacteria 863
39 Ga0070660_101274939 3300005339 Bacteria 623
40 Ga0070691_10001848 3300005341 Bacteria 9231
41 Ga0070661_101236327 3300005344 Unclassified 625
42 Ga0070669_101055901 3300005353 Unclassified 698
43 Ga0070671_100004233 3300005355 Bacteria 11357
44 Ga0070674_100283311 3300005356 Bacteria 1314
45 Ga0070674_101897088 3300005356 Bacteria 541
46 Ga0070673_100036345 3300005364 Bacteria 3743
47 Ga0070673_101942418 3300005364 Bacteria 558
48 Ga0070659_100000455 3300005366 Bacteria 30281
49 Ga0070659_100022844 3300005366 Bacteria 4778
50 Ga0070663_100046919 3300005455 Bacteria 3059
51 Ga0070678_100001143 3300005456 Bacteria 14006
52 Ga0070662_100000192 3300005457 Bacteria 35614
53 Ga0070662_100890813 3300005457 Bacteria 759
54 Ga0070681_10012636 3300005458 Bacteria 8376
55 Ga0068867_100006330 3300005459 Bacteria 8375
56 Ga0070679_100002186 3300005530 Bacteria 17647
57 Ga0070679_100122420 3300005530 Bacteria 2585
58 Ga0070679_101172181 3300005530 Unclassified 713
59 Ga0070684_100111968 3300005535 Bacteria 2448
60 Ga0068853_100001919 3300005539 Bacteria 15325
61 Ga0068853_100007060 3300005539 Bacteria 8981
62 Ga0068853_100155599 3300005539 Bacteria 2060
63 Ga0068853_100205892 3300005539 Bacteria 1792
64 Ga0070665_100000032 3300005548 Bacteria 333352
65 Ga0068855_100000043 3300005563 Bacteria 149118
66 Ga0068855_100000517 3300005563 Bacteria 47550
67 Ga0068855_100006769 3300005563 Bacteria 13901
68 Ga0068855_100016939 3300005563 Bacteria 8764
69 Ga0068855_100052365 3300005563 Bacteria 4806
70 Ga0068855_100114557 3300005563 Bacteria 3091
71 Ga0068855_100147043 3300005563 Bacteria 2682
72 Ga0068855_100226783 3300005563 Bacteria 2093
73 Ga0068855_100289990 3300005563 Bacteria 1814
74 Ga0068855_100655381 3300005563 Unclassified 1127
75 Ga0068855_100900582 3300005563 Bacteria 934
76 Ga0068857_102264067 3300005577 Bacteria 533
77 Ga0068854_100338587 3300005578 Bacteria 1228
78 Ga0068854_101431175 3300005578 Bacteria 626
79 Ga0068856_100001612 3300005614 Bacteria 23598
80 Ga0068856_100012648 3300005614 Bacteria 8171
81 Ga0068856_100023794 3300005614 Bacteria 5958
82 Ga0068856_100504970 3300005614 Unclassified 1230
83 Ga0068852_100050202 3300005616 Bacteria 3573
84 Ga0068864_101349287 3300005618 Bacteria 714
85 Ga0068866_10066391 3300005718 Bacteria 1890
86 Ga0068866_10434686 3300005718 Bacteria 854
87 Ga0068870_10299639 3300005840 Bacteria 1014
88 Ga0068863_100000296 3300005841 Bacteria 51531
89 Ga0075366_10031263 3300006195 Bacteria 3133
90 Ga0075366_10062299 3300006195 Bacteria 2217
91 Ga0075366_10064382 3300006195 Bacteria 2180
92 Ga0075366_10635725 3300006195 Bacteria 662
93 Ga0097621_100000579 3300006237 Bacteria 25795
94 Ga0097621_100014043 3300006237 Bacteria 5984
95 Ga0068871_100000212 3300006358 Bacteria 40531
96 Ga0068871_100140062 3300006358 Bacteria 2056
97 Ga0068865_100000970 3300006881 Bacteria 16376
98 Ga0068865_100717739 3300006881 Unclassified 856
99 Ga0105240_10000104 3300009093 Bacteria 172082
100 Ga0105240_10003876 3300009093 Bacteria 23102
101 Ga0105240_10007899 3300009093 Bacteria 15342
102 Ga0105240_10039081 3300009093 Bacteria 6080
103 Ga0105240_10048067 3300009093 Bacteria 5395
104 Ga0105240_10098004 3300009093 Bacteria 3571
105 Ga0105240_10170269 3300009093 Bacteria 2580
106 Ga0105240_10171708 3300009093 Bacteria 2567
107 Ga0105240_10198738 3300009093 Bacteria 2351
108 Ga0105240_10208599 3300009093 Bacteria 2285
109 Ga0105240_10219668 3300009093 Bacteria 2215
110 Ga0105240_10265909 3300009093 Bacteria 1977
111 Ga0105240_11032974 3300009093 Bacteria 877
112 Ga0105245_10062383 3300009098 Bacteria 3363
113 Ga0105241_10000609 3300009174 Bacteria 26925
114 Ga0105241_10002461 3300009174 Bacteria 13914
115 Ga0105241_10005078 3300009174 Bacteria 9708
116 Ga0105241_10056373 3300009174 Bacteria 3013
117 Ga0105241_10094445 3300009174 Bacteria 2365
118 Ga0105241_10140843 3300009174 Bacteria 1963
119 Ga0105241_10305713 3300009174 Bacteria 1366
120 Ga0105241_11052283 3300009174 Bacteria 764
121 Ga0105242_10027947 3300009176 Bacteria 4485
122 Ga0105242_11890200 3300009176 Bacteria 637
123 Ga0105237_10001048 3300009545 Bacteria 37140
124 Ga0105237_10003047 3300009545 Bacteria 20209
125 Ga0105237_10005430 3300009545 Bacteria 14393
126 Ga0105237_10015258 3300009545 Bacteria 8003
127 Ga0105237_10035122 3300009545 Bacteria 5074
128 Ga0105237_10077683 3300009545 Bacteria 3310
129 Ga0105237_10079825 3300009545 Bacteria 3262
130 Ga0105237_10141559 3300009545 Bacteria 2399
131 Ga0105237_10385093 3300009545 Bacteria 1407
132 Ga0105237_10534390 3300009545 Bacteria 1179
133 Ga0105238_10018913 3300009551 Bacteria 7015
134 Ga0105238_10036502 3300009551 Bacteria 4996
135 Ga0105238_10541810 3300009551 Bacteria 1168
136 Ga0105238_11363447 3300009551 Bacteria 736
137 Ga0105239_10000007 3300010375 Bacteria 385297
138 Ga0105239_10000015 3300010375 Bacteria 319892
139 Ga0105239_10000816 3300010375 Bacteria 44236
140 Ga0105239_10002272 3300010375 Bacteria 24542
141 Ga0105239_10003149 3300010375 Bacteria 20474
142 Ga0105239_10003346 3300010375 Bacteria 19705
143 Ga0105239_10015185 3300010375 Bacteria 8535
144 Ga0105239_10119817 3300010375 Bacteria 2921
145 Ga0105239_10374530 3300010375 Bacteria 1609
146 Ga0105239_10417870 3300010375 Bacteria 1519
147 Ga0105239_10599074 3300010375 Bacteria 1257
148 Ga0105239_11204227 3300010375 Bacteria 873
149 Ga0105246_10550166 3300011119 Unclassified 989
150 Ga0105246_10631645 3300011119 Bacteria 930
151 Ga0157373_10000134 3300013100 Bacteria 58266
152 Ga0157373_10001240 3300013100 Bacteria 19499
153 Ga0157373_10029870 3300013100 Bacteria 3924
154 Ga0157373_10385884 3300013100 Bacteria 1002
155 Ga0157371_10002943 3300013102 Bacteria 15860
156 Ga0157371_10007186 3300013102 Bacteria 9045
157 Ga0157371_10015478 3300013102 Bacteria 5720
158 Ga0157371_10029451 3300013102 Bacteria 3971
159 Ga0157371_10178340 3300013102 Bacteria 1519
160 Ga0157370_10003893 3300013104 Bacteria 17389
161 Ga0157370_10012309 3300013104 Bacteria 8879
162 Ga0157370_10287399 3300013104 Bacteria 1519
163 Ga0157370_10435989 3300013104 Bacteria 1205
164 Ga0157370_10502139 3300013104 Bacteria 1114
165 Ga0157370_10510832 3300013104 Bacteria 1103
166 Ga0157369_10000566 3300013105 Bacteria 48674
167 Ga0157369_10048844 3300013105 Bacteria 4590
168 Ga0157369_10064319 3300013105 Bacteria 3951
169 Ga0157369_10252264 3300013105 Bacteria 1841
170 Ga0157374_10001177 3300013296 Bacteria 22312
171 Ga0157374_10002121 3300013296 Bacteria 16697
172 Ga0157374_10513513 3300013296 Bacteria 1204
173 Ga0157374_10514584 3300013296 Unclassified 1202
174 Ga0157374_10610496 3300013296 Bacteria 1101
175 Ga0157374_11839100 3300013296 Bacteria 631
176 Ga0157378_10022249 3300013297 Bacteria 5580
177 Ga0157378_10048486 3300013297 Bacteria 3777
178 Ga0157378_10050424 3300013297 Bacteria 3704
179 Ga0157378_10312182 3300013297 Bacteria 1525
180 Ga0163162_10003406 3300013306 Bacteria 15182
181 Ga0163162_10005776 3300013306 Bacteria 11971
182 Ga0163162_10298821 3300013306 Bacteria 1742
183 Ga0163162_10535784 3300013306 Bacteria 1300
184 Ga0163162_10825243 3300013306 Bacteria 1043
185 Ga0157372_10000020 3300013307 Bacteria 208056
186 Ga0157372_10000725 3300013307 Bacteria 35931
187 Ga0157372_10001414 3300013307 Bacteria 25877
188 Ga0157372_10002043 3300013307 Bacteria 21955
189 Ga0157372_10002074 3300013307 Bacteria 21765
190 Ga0157372_10013800 3300013307 Bacteria 8633
191 Ga0157372_10643774 3300013307 Bacteria 1234
192 Ga0157372_11550117 3300013307 Bacteria 763
193 Ga0157375_10073018 3300013308 Bacteria 3449
194 Ga0157375_10415015 3300013308 Bacteria 1512
195 Ga0182008_10019585 3300014497 Bacteria 3492
196 Ga0182008_10034486 3300014497 Bacteria 2537
197 Ga0182008_10065267 3300014497 Bacteria 1791
198 Ga0182008_10138510 3300014497 Bacteria 1216
199 Ga0157376_10031542 3300014969 Unclassified 4246
200 Ga0157376_10789597 3300014969 Bacteria 961
201 Ga0182007_10025347 3300015262 Unclassified 2067
202 Ga0182007_10044901 3300015262 Bacteria 1465
203 Ga0182007_10091316 3300015262 Bacteria 1003
204 Ga0163161_10409274 3300017792 Bacteria 1089
205 Ga0206351_10028307 3300020077 Bacteria 813
206 Ga0206351_10568253 3300020077 Bacteria 1621
207 Ga0206352_10173995 3300020078 Unclassified 561
208 Ga0206350_11346515 3300020080 Bacteria 575
209 Ga0206350_11396680 3300020080 Bacteria 525
210 Ga0224712_10386226 3300022467 Bacteria 666
211 Ga0207427_100025 3300025231 Bacteria 433726
212 Ga0209437_100010 3300025233 Bacteria 838447
213 Ga0209437_100089 3300025233 Bacteria 250476
214 Ga0209026_1000357 3300025250 Bacteria 43020
215 Ga0209026_1002107 3300025250 Bacteria 7804
216 Ga0209233_1000017 3300025261 Bacteria 898076
217 Ga0209233_1000655 3300025261 Bacteria 16841
218 Ga0209455_1000682 3300025272 Bacteria 20151
219 Ga0209050_1032876 3300025298 Bacteria 1585
220 Ga0207642_10047741 3300025899 Bacteria 1916
221 Ga0207642_10223447 3300025899 Bacteria 1054
222 Ga0207647_10000169 3300025904 Bacteria 52146
223 Ga0207647_10000206 3300025904 Bacteria 48374
224 Ga0207647_10049385 3300025904 Bacteria 2610
225 Ga0207647_10171497 3300025904 Bacteria 1263
226 Ga0207645_10001160 3300025907 Bacteria 21787
227 Ga0207643_10332794 3300025908 Bacteria 950
228 Ga0207705_10000043 3300025909 Bacteria 181491
229 Ga0207705_10125706 3300025909 Bacteria 1906
230 Ga0207705_10139750 3300025909 Bacteria 1808
231 Ga0207705_10251824 3300025909 Unclassified 1347
232 Ga0207654_10000940 3300025911 Bacteria 16008
233 Ga0207654_10001666 3300025911 Bacteria 11606
234 Ga0207654_10032593 3300025911 Bacteria 2881
235 Ga0207654_10171365 3300025911 Bacteria 1409
236 Ga0207654_10738748 3300025911 Bacteria 708
237 Ga0207654_10991035 3300025911 Bacteria 611
238 Ga0207707_10002144 3300025912 Bacteria 17867
239 Ga0207707_10050739 3300025912 Bacteria 3614
240 Ga0207695_10000048 3300025913 Bacteria 421800
241 Ga0207695_10007976 3300025913 Bacteria 13353
242 Ga0207695_10008731 3300025913 Bacteria 12637
243 Ga0207695_10010497 3300025913 Bacteria 11329
244 Ga0207695_10100382 3300025913 Bacteria 2890
245 Ga0207695_10110469 3300025913 Bacteria 2729
246 Ga0207695_10153414 3300025913 Bacteria 2240
247 Ga0207695_10221742 3300025913 Bacteria 1798
248 Ga0207695_10275783 3300025913 Bacteria 1576
249 Ga0207695_10288685 3300025913 Bacteria 1533
250 Ga0207695_10301342 3300025913 Bacteria 1494
251 Ga0207695_10555577 3300025913 Unclassified 1029
252 Ga0207695_10576073 3300025913 Bacteria 1007
253 Ga0207671_10002352 3300025914 Bacteria 20357
254 Ga0207671_10005530 3300025914 Bacteria 11616
255 Ga0207671_10023992 3300025914 Bacteria 4591
256 Ga0207671_10037528 3300025914 Bacteria 3593
257 Ga0207671_10319622 3300025914 Bacteria 1228
258 Ga0207671_10529053 3300025914 Bacteria 940
259 Ga0207671_10575916 3300025914 Bacteria 897
260 Ga0207660_10003392 3300025917 Bacteria 10383
261 Ga0207657_10007134 3300025919 Bacteria 11475
262 Ga0207657_10179266 3300025919 Bacteria 1713
263 Ga0207657_10274356 3300025919 Bacteria 1340
264 Ga0207657_10424321 3300025919 Unclassified 1045
265 Ga0207657_10956531 3300025919 Bacteria 658
266 Ga0207649_10928578 3300025920 Unclassified 683
267 Ga0207652_10001983 3300025921 Bacteria 17713
268 Ga0207694_10067320 3300025924 Bacteria 2795
269 Ga0207694_10133143 3300025924 Bacteria 1994
270 Ga0207687_10600634 3300025927 Bacteria 927
271 Ga0207644_10007617 3300025931 Bacteria 7060
272 Ga0207690_10000190 3300025932 Bacteria 47477
273 Ga0207690_10011790 3300025932 Bacteria 5228
274 Ga0207706_10000167 3300025933 Bacteria 72622
275 Ga0207706_10208487 3300025933 Bacteria 1713
276 Ga0207686_10010761 3300025934 Bacteria 4985
277 Ga0207686_10792245 3300025934 Unclassified 759
278 Ga0207669_10190144 3300025937 Bacteria 1480
279 Ga0207669_11685345 3300025937 Bacteria 541
280 Ga0207704_10000042 3300025938 Bacteria 89683
281 Ga0207667_10000015 3300025949 Bacteria 417534
282 Ga0207667_10000644 3300025949 Bacteria 45263
283 Ga0207667_10010553 3300025949 Bacteria 10792
284 Ga0207667_10017043 3300025949 Bacteria 8195
285 Ga0207667_10107668 3300025949 Bacteria 2876
286 Ga0207667_10286582 3300025949 Bacteria 1683
287 Ga0207667_10287615 3300025949 Bacteria 1680
288 Ga0207667_11239799 3300025949 Bacteria 724
289 Ga0207651_10024281 3300025960 Bacteria 3746
290 Ga0207640_10028760 3300025981 Bacteria 3403
291 Ga0207640_10595696 3300025981 Bacteria 935
292 Ga0207677_10015719 3300026023 Bacteria 4462
293 Ga0207639_10013277 3300026041 Bacteria 5760
294 Ga0207639_10019287 3300026041 Bacteria 4862
295 Ga0207639_10023037 3300026041 Bacteria 4492
296 Ga0207639_10400060 3300026041 Bacteria 1237
297 Ga0207639_10639102 3300026041 Bacteria 984
298 Ga0207639_10740654 3300026041 Bacteria 913
299 Ga0207639_11977186 3300026041 Bacteria 544
300 Ga0207678_10234812 3300026067 Bacteria 1570
301 Ga0207702_10000165 3300026078 Bacteria 79066
302 Ga0207702_10034738 3300026078 Bacteria 4217
303 Ga0207702_10145384 3300026078 Bacteria 2151
304 Ga0207641_10000051 3300026088 Bacteria 174706
305 Ga0207648_10003557 3300026089 Bacteria 16296
306 Ga0207676_10037053 3300026095 Bacteria 3714
307 Ga0207674_10021734 3300026116 Bacteria 6906
308 Ga0207683_10002545 3300026121 Bacteria 15908
309 Ga0207698_10001222 3300026142 Bacteria 15005
310 Ga0268266_10000030 3300028379 Bacteria 417120
311 Ga0307517_10003956 3300028786 Bacteria 22947
312 Ga0307517_10026831 3300028786 Bacteria 6952
313 Ga0307515_10001736 3300028794 Bacteria 48546
314 Ga0265338_10503999 3300028800 Unclassified 852
315 Ga0307512_10297827 3300030522 Bacteria 754
316 Ga0265327_10139241 3300031251 Bacteria 1135
317 Ga0265327_10414509 3300031251 Unclassified 584
318 Ga0307509_10050878 3300031507 Bacteria 4434
319 Ga0307509_10060402 3300031507 Bacteria 4007
320 Ga0307509_10197317 3300031507 Bacteria 1855
321 Ga0307516_10000189 3300031730 Bacteria 79794
322 Ga0307412_10161072 3300031911 Bacteria 1667
323 Ga0307412_10417578 3300031911 Bacteria 1097
324 Ga0307507_10000023 3300033179 Bacteria 212423
325 Ga0307507_10001430 3300033179 Bacteria 53551
326 Ga0307510_10000147 3300033180 Bacteria 58704
327 Ga0307510_10001320 3300033180 Bacteria 27047
328 Ga0373941_0088969 3300035115 Bacteria 1056
329 Ga0395899_0000136 3300037312 Bacteria 112112
330 Ga0395899_0000286 3300037312 Bacteria 65138
331 Ga0395900_0000115 3300037418 Bacteria 138474
332 Ga0395900_0000285 3300037418 Bacteria 75772
333 Ga0395900_0480072 3300037418 Bacteria 1196
334 Ga0395900_1174729 3300037418 Bacteria 683
335 Ga0395898_0005702 3300037466 Bacteria 13415
336 Ga0395905_0000045 3300037471 Bacteria 241370
337 Ga0395901_0001032 3300038443 Bacteria 30164
338 Ga0395901_0509010 3300038443 Bacteria 1225
339 Ga0439436_0257430 3300041404 Bacteria 507
340 Ga0451849_1091099 3300041505 Bacteria 626
341 Ga0451851_1315931 3300041507 Unclassified 619
342 Ga0439448_0018357 3300042005 Bacteria 2142
343 Ga0439455_0076204 3300042012 Bacteria 907
344 Ga0466969_0354457 3300044656 Unclassified 664
345 Ga0466966_0121420 3300044684 Unclassified 1604
346 Ga0466964_0143908 3300044706 Bacteria 1099
347 Ga0466957_0329951 3300044842 Bacteria 1031
348 Ga0466958_0038231 3300045836 Bacteria 2879
349 Ga0495592_0612691 3300046454 Bacteria 663
350 Ga0495638_0457827 3300046460 Bacteria 650
351 Ga0495651_0135993 3300046462 Bacteria 1788
352 Ga0495650_0000119 3300046471 Bacteria 185719
353 Ga0495650_0086558 3300046471 Bacteria 1199
354 Ga0495585_0000173 3300046492 Bacteria 69500
355 Ga0495585_0000456 3300046492 Bacteria 39053
356 Ga0495596_0021550 3300046500 Bacteria 2630
357 Ga0495607_0150266 3300046501 Bacteria 1193
358 Ga0495583_0220584 3300046506 Bacteria 766
359 Ga0495606_0000008 3300046507 Bacteria 321373
360 Ga0495606_0110166 3300046507 Bacteria 1662
361 Ga0495608_0222631 3300046511 Bacteria 1183
362 Ga0495610_0000089 3300046512 Bacteria 106925
363 Ga0495610_0002038 3300046512 Bacteria 17252
364 Ga0495616_0002658 3300046513 Bacteria 11737
365 Ga0495616_0013249 3300046513 Bacteria 4659
366 Ga0495628_0145946 3300046516 Bacteria 1804
367 Ga0495631_0002766 3300046518 Bacteria 9734
368 Ga0495631_0166413 3300046518 Bacteria 946
369 Ga0495632_0052287 3300046519 Bacteria 2009
370 Ga0495632_0217090 3300046519 Bacteria 866
371 Ga0495637_0025708 3300046520 Bacteria 2651
372 Ga0495644_0061205 3300046523 Bacteria 1415
373 Ga0495648_0008886 3300046524 Bacteria 7853
374 Ga0495648_0237365 3300046524 Bacteria 888
375 Ga0495652_0062168 3300046529 Bacteria 3149
376 Ga0495652_0237533 3300046529 Bacteria 1359
377 Ga0495654_0299882 3300046530 Bacteria 656
378 Ga0495633_0000273 3300046558 Bacteria 60402
379 Ga0495633_0004402 3300046558 Bacteria 8976
380 Ga0495668_0000134 3300046616 Bacteria 112135
381 Ga0495611_0092410 3300046648 Bacteria 1399
382 Ga0495611_0423862 3300046648 Bacteria 607
383 Ga0495625_0000017 3300046660 Bacteria 299728
384 Ga0495625_0002361 3300046660 Bacteria 20556
385 Ga0495625_0004708 3300046660 Bacteria 12776
386 Ga0495625_0024525 3300046660 Bacteria 4590
387 Ga0495625_0032543 3300046660 Bacteria 3864
388 Ga0495625_0037005 3300046660 Bacteria 3583
389 Ga0495625_0070929 3300046660 Bacteria 2446
390 Ga0495625_0268795 3300046660 Bacteria 1101
391 Ga0495625_0546280 3300046660 Bacteria 702
392 Ga0495661_0027547 3300046665 Bacteria 3646
393 Ga0495669_0557921 3300046684 Bacteria 557
394 Ga0495670_0763573 3300046691 Unclassified 527
395 Ga0495670_0827160 3300046691 Bacteria 506
396 Ga0495649_0000121 3300046694 Bacteria 68443
397 Ga0495649_0352630 3300046694 Bacteria 743
398 Ga0495600_0462502 3300046809 Bacteria 783
399 Ga0495683_0032543 3300047323 Bacteria 2656
400 Ga0495683_0051944 3300047323 Bacteria 2047
401 Ga0495687_001739 3300047443 Bacteria 19268
402 Ga0495687_001856 3300047443 Bacteria 18416
403 Ga0495687_034031 3300047443 Bacteria 2306
404 Ga0495677_0214088 3300047445 Bacteria 750
405 Ga0495673_0119838 3300047469 Bacteria 1043
406 Ga0495686_0000974 3300047472 Bacteria 35181
407 Ga0495686_0001124 3300047472 Bacteria 31635
408 Ga0495686_0086810 3300047472 Bacteria 1904
409 Ga0495686_0126388 3300047472 Bacteria 1520
410 Ga0496100_1282821 3300048903 Unclassified 578
411 Ga0496115_0198846 3300048918 Bacteria 1656
412 Ga0495678_005167 3300049459 Bacteria 7314
413 nmdc:mga0k408_2155_c1 3300050493 Bacteria 7660
414 nmdc:mga0k408_41272_c1 3300050493 Bacteria 2656
415 nmdc:mga0k408_93674_c1 3300050493 Bacteria 1766
416 Ga0500635_0000997 3300053080 Bacteria 6785
417 Ga0500647_0376906 3300053091 Bacteria 582
418 Ga0500583_0491300 3300053092 Bacteria 578
419 Ga0500569_151755 3300053109 Bacteria 782
420 Ga0500608_002183 3300053122 Bacteria 7042
421 Ga0500614_104666 3300053123 Bacteria 819
422 Ga0500618_000266 3300053125 Bacteria 40517
423 Ga0500561_0164938 3300053137 Bacteria 693
424 Ga0500588_0003826 3300053146 Bacteria 3215
425 Ga0500616_0178343 3300053153 Bacteria 959
426 Ga0500622_0022740 3300053156 Bacteria 3320
427 Ga0500624_000153 3300053157 Bacteria 28320
428 Ga0500634_0209698 3300053161 Bacteria 847
429 Ga0500645_023694 3300053730 Bacteria 1881
430 Ga0587073_0175359 3300059492 Bacteria 625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0143908 Ga0466964_0143908_53_490 138
2 3300001904 JGI24736J21556_1017797 JGI24736J21556_10177972 139
3 3300001989 JGI24739J22299_10011570 JGI24739J22299_100115704 139
4 3300001989 JGI24739J22299_10160228 JGI24739J22299_101602281 139
5 3300001990 JGI24737J22298_10000796 JGI24737J22298_1000079611 139
6 3300001990 JGI24737J22298_10011338 JGI24737J22298_100113382 139
7 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003329 139
8 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008144 139
9 3300002067 JGI24735J21928_10008450 JGI24735J21928_100084505 139
10 3300002077 JGI24744J21845_10012132 JGI24744J21845_100121322 139
11 3300002737 JGI25162J39368_1001539 JGI25162J39368_10015393 139
12 3300002772 JGI25164J39214_1001160 JGI25164J39214_10011604 139
13 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015761 139
14 3300003316 rootH1_10032600 rootH1_100326004 139
15 3300003320 rootH2_10002560 rootH2_1000256034 139
16 3300003320 rootH2_10115733 rootH2_101157335 139
17 3300003322 rootL2_10021763 rootL2_100217632 139
18 3300003322 rootL2_10021764 rootL2_100217645 139
19 3300003323 rootH1_10045017 rootH1_1004501717 139
20 3300003323 rootH1_10045018 rootH1_100450185 139
21 3300003323 rootH1_10049623 rootH1_100496237 139
22 3300004799 Ga0058863_11364988 Ga0058863_113649882 139
23 3300004803 Ga0058862_10039046 Ga0058862_100390462 139
24 3300005288 Ga0065714_10150436 Ga0065714_101504361 139
25 3300005288 Ga0065714_10255104 Ga0065714_102551041 139
26 3300005327 Ga0070658_10000014 Ga0070658_1000001444 139
27 3300005327 Ga0070658_10307585 Ga0070658_103075852 139
28 3300005327 Ga0070658_10363638 Ga0070658_103636382 139
29 3300005327 Ga0070658_10561439 Ga0070658_105614391 139
30 3300005327 Ga0070658_10854330 Ga0070658_108543301 139
31 3300005328 Ga0070676_10000269 Ga0070676_1000026918 139
32 3300005336 Ga0070680_100001914 Ga0070680_10000191414 139
33 3300005336 Ga0070680_100011709 Ga0070680_1000117097 139
34 3300005337 Ga0070682_100004229 Ga0070682_1000042295 139
35 3300005338 Ga0068868_100018760 Ga0068868_1000187604 139
36 3300005338 Ga0068868_100018837 Ga0068868_1000188374 139
37 3300005339 Ga0070660_100005601 Ga0070660_10000560110 139
38 3300005339 Ga0070660_100119434 Ga0070660_1001194342 139
39 3300005339 Ga0070660_100679426 Ga0070660_1006794262 139
40 3300005339 Ga0070660_101274939 Ga0070660_1012749392 139
41 3300005341 Ga0070691_10001848 Ga0070691_1000184812 139
42 3300005344 Ga0070661_101236327 Ga0070661_1012363271 139
43 3300005353 Ga0070669_101055901 Ga0070669_1010559011 139
44 3300005355 Ga0070671_100004233 Ga0070671_1000042334 139
45 3300005356 Ga0070674_100283311 Ga0070674_1002833111 139
46 3300005356 Ga0070674_101897088 Ga0070674_1018970881 139
47 3300005364 Ga0070673_100036345 Ga0070673_1000363452 139
48 3300005364 Ga0070673_101942418 Ga0070673_1019424181 139
49 3300005366 Ga0070659_100000455 Ga0070659_10000045512 139
50 3300005366 Ga0070659_100022844 Ga0070659_1000228442 139
51 3300005455 Ga0070663_100046919 Ga0070663_1000469192 139
52 3300005456 Ga0070678_100001143 Ga0070678_1000011434 139
53 3300005457 Ga0070662_100000192 Ga0070662_10000019224 139
54 3300005457 Ga0070662_100890813 Ga0070662_1008908131 139
55 3300005458 Ga0070681_10012636 Ga0070681_100126364 139
56 3300005459 Ga0068867_100006330 Ga0068867_1000063309 139
57 3300005530 Ga0070679_100002186 Ga0070679_10000218616 139
58 3300005530 Ga0070679_100122420 Ga0070679_1001224203 139
59 3300005530 Ga0070679_101172181 Ga0070679_1011721812 139
60 3300005535 Ga0070684_100111968 Ga0070684_1001119682 139
61 3300005539 Ga0068853_100001919 Ga0068853_10000191916 139
62 3300005539 Ga0068853_100007060 Ga0068853_1000070604 139
63 3300005539 Ga0068853_100155599 Ga0068853_1001555991 139
64 3300005539 Ga0068853_100205892 Ga0068853_1002058921 139
65 3300005548 Ga0070665_100000032 Ga0070665_10000003263 139
66 3300005563 Ga0068855_100000043 Ga0068855_100000043137 139
67 3300005563 Ga0068855_100000517 Ga0068855_1000005179 139
68 3300005563 Ga0068855_100006769 Ga0068855_1000067697 139
69 3300005563 Ga0068855_100016939 Ga0068855_1000169392 139
70 3300005563 Ga0068855_100052365 Ga0068855_1000523655 139
71 3300005563 Ga0068855_100114557 Ga0068855_1001145571 139
72 3300005563 Ga0068855_100147043 Ga0068855_1001470433 139
73 3300005563 Ga0068855_100226783 Ga0068855_1002267832 139
74 3300005563 Ga0068855_100289990 Ga0068855_1002899902 139
75 3300005563 Ga0068855_100655381 Ga0068855_1006553811 139
76 3300005563 Ga0068855_100900582 Ga0068855_1009005822 139
77 3300005577 Ga0068857_102264067 Ga0068857_1022640671 139
78 3300005578 Ga0068854_100338587 Ga0068854_1003385872 139
79 3300005578 Ga0068854_101431175 Ga0068854_1014311751 139
80 3300005614 Ga0068856_100001612 Ga0068856_10000161218 139
81 3300005614 Ga0068856_100012648 Ga0068856_1000126487 139
82 3300005614 Ga0068856_100023794 Ga0068856_1000237943 139
83 3300005614 Ga0068856_100504970 Ga0068856_1005049702 139
84 3300005616 Ga0068852_100050202 Ga0068852_1000502024 139
85 3300005618 Ga0068864_101349287 Ga0068864_1013492871 139
86 3300005718 Ga0068866_10066391 Ga0068866_100663912 139
87 3300005718 Ga0068866_10434686 Ga0068866_104346862 139
88 3300005840 Ga0068870_10299639 Ga0068870_102996391 139
89 3300005841 Ga0068863_100000296 Ga0068863_10000029652 139
90 3300006195 Ga0075366_10031263 Ga0075366_100312632 139
91 3300006195 Ga0075366_10062299 Ga0075366_100622992 139
92 3300006195 Ga0075366_10064382 Ga0075366_100643823 139
93 3300006195 Ga0075366_10635725 Ga0075366_106357251 139
94 3300006237 Ga0097621_100000579 Ga0097621_10000057917 139
95 3300006237 Ga0097621_100014043 Ga0097621_10001404311 139
96 3300006358 Ga0068871_100000212 Ga0068871_10000021240 139
97 3300006358 Ga0068871_100140062 Ga0068871_1001400621 139
98 3300006881 Ga0068865_100000970 Ga0068865_10000097011 139
99 3300006881 Ga0068865_100717739 Ga0068865_1007177391 139
100 3300009093 Ga0105240_10000104 Ga0105240_1000010483 139
101 3300009093 Ga0105240_10003876 Ga0105240_1000387610 139
102 3300009093 Ga0105240_10007899 Ga0105240_100078994 139
103 3300009093 Ga0105240_10039081 Ga0105240_100390813 139
104 3300009093 Ga0105240_10048067 Ga0105240_100480676 139
105 3300009093 Ga0105240_10098004 Ga0105240_100980046 139
106 3300009093 Ga0105240_10170269 Ga0105240_101702694 139
107 3300009093 Ga0105240_10171708 Ga0105240_101717082 139
108 3300009093 Ga0105240_10198738 Ga0105240_101987382 139
109 3300009093 Ga0105240_10208599 Ga0105240_102085992 139
110 3300009093 Ga0105240_10219668 Ga0105240_102196681 139
111 3300009093 Ga0105240_10265909 Ga0105240_102659093 139
112 3300009093 Ga0105240_11032974 Ga0105240_110329741 139
113 3300009098 Ga0105245_10062383 Ga0105245_100623833 139
114 3300009174 Ga0105241_10000609 Ga0105241_1000060915 139
115 3300009174 Ga0105241_10002461 Ga0105241_1000246116 139
116 3300009174 Ga0105241_10005078 Ga0105241_100050785 139
117 3300009174 Ga0105241_10056373 Ga0105241_100563733 139
118 3300009174 Ga0105241_10094445 Ga0105241_100944453 139
119 3300009174 Ga0105241_10140843 Ga0105241_101408432 139
120 3300009174 Ga0105241_10305713 Ga0105241_103057132 139
121 3300009174 Ga0105241_11052283 Ga0105241_110522832 139
122 3300009176 Ga0105242_10027947 Ga0105242_100279473 139
123 3300009176 Ga0105242_11890200 Ga0105242_118902002 139
124 3300009545 Ga0105237_10001048 Ga0105237_100010483 139
125 3300009545 Ga0105237_10003047 Ga0105237_100030475 139
126 3300009545 Ga0105237_10005430 Ga0105237_1000543010 139
127 3300009545 Ga0105237_10015258 Ga0105237_100152584 139
128 3300009545 Ga0105237_10035122 Ga0105237_100351222 139
129 3300009545 Ga0105237_10077683 Ga0105237_100776835 139
130 3300009545 Ga0105237_10079825 Ga0105237_100798253 139
131 3300009545 Ga0105237_10141559 Ga0105237_101415592 139
132 3300009545 Ga0105237_10385093 Ga0105237_103850932 139
133 3300009545 Ga0105237_10534390 Ga0105237_105343901 139
134 3300009551 Ga0105238_10018913 Ga0105238_100189133 139
135 3300009551 Ga0105238_10036502 Ga0105238_100365024 139
136 3300009551 Ga0105238_10541810 Ga0105238_105418102 139
137 3300009551 Ga0105238_11363447 Ga0105238_113634471 139
138 3300010375 Ga0105239_10000007 Ga0105239_10000007205 139
139 3300010375 Ga0105239_10000015 Ga0105239_10000015227 139
140 3300010375 Ga0105239_10000816 Ga0105239_1000081612 139
141 3300010375 Ga0105239_10002272 Ga0105239_1000227219 139
142 3300010375 Ga0105239_10003149 Ga0105239_1000314918 139
143 3300010375 Ga0105239_10003346 Ga0105239_100033468 139
144 3300010375 Ga0105239_10015185 Ga0105239_100151857 139
145 3300010375 Ga0105239_10119817 Ga0105239_101198175 139
146 3300010375 Ga0105239_10374530 Ga0105239_103745302 139
147 3300010375 Ga0105239_10417870 Ga0105239_104178701 139
148 3300010375 Ga0105239_10599074 Ga0105239_105990741 139
149 3300010375 Ga0105239_11204227 Ga0105239_112042271 139
150 3300011119 Ga0105246_10550166 Ga0105246_105501662 139
151 3300011119 Ga0105246_10631645 Ga0105246_106316451 139
152 3300013100 Ga0157373_10000134 Ga0157373_1000013442 139
153 3300013100 Ga0157373_10001240 Ga0157373_100012402 139
154 3300013100 Ga0157373_10029870 Ga0157373_100298706 139
155 3300013100 Ga0157373_10385884 Ga0157373_103858842 139
156 3300013102 Ga0157371_10002943 Ga0157371_1000294316 139
157 3300013102 Ga0157371_10007186 Ga0157371_100071862 139
158 3300013102 Ga0157371_10015478 Ga0157371_100154784 139
159 3300013102 Ga0157371_10029451 Ga0157371_100294513 139
160 3300013102 Ga0157371_10178340 Ga0157371_101783402 139
161 3300013104 Ga0157370_10003893 Ga0157370_100038938 139
162 3300013104 Ga0157370_10012309 Ga0157370_100123093 139
163 3300013104 Ga0157370_10287399 Ga0157370_102873991 139
164 3300013104 Ga0157370_10435989 Ga0157370_104359892 139
165 3300013104 Ga0157370_10502139 Ga0157370_105021392 139
166 3300013104 Ga0157370_10510832 Ga0157370_105108321 139
167 3300013105 Ga0157369_10000566 Ga0157369_1000056643 139
168 3300013105 Ga0157369_10048844 Ga0157369_100488444 139
169 3300013105 Ga0157369_10064319 Ga0157369_100643193 139
170 3300013105 Ga0157369_10252264 Ga0157369_102522642 139
171 3300013296 Ga0157374_10001177 Ga0157374_1000117713 139
172 3300013296 Ga0157374_10002121 Ga0157374_100021217 139
173 3300013296 Ga0157374_10513513 Ga0157374_105135132 139
174 3300013296 Ga0157374_10514584 Ga0157374_105145841 139
175 3300013296 Ga0157374_10610496 Ga0157374_106104962 139
176 3300013296 Ga0157374_11839100 Ga0157374_118391001 139
177 3300013297 Ga0157378_10022249 Ga0157378_100222493 139
178 3300013297 Ga0157378_10048486 Ga0157378_100484862 139
179 3300013297 Ga0157378_10050424 Ga0157378_100504247 139
180 3300013297 Ga0157378_10312182 Ga0157378_103121822 139
181 3300013306 Ga0163162_10003406 Ga0163162_100034064 139
182 3300013306 Ga0163162_10005776 Ga0163162_100057765 139
183 3300013306 Ga0163162_10298821 Ga0163162_102988213 139
184 3300013306 Ga0163162_10535784 Ga0163162_105357842 139
185 3300013306 Ga0163162_10825243 Ga0163162_108252432 139
186 3300013307 Ga0157372_10000020 Ga0157372_1000002065 139
187 3300013307 Ga0157372_10000725 Ga0157372_1000072529 139
188 3300013307 Ga0157372_10001414 Ga0157372_1000141411 139
189 3300013307 Ga0157372_10002043 Ga0157372_1000204321 139
190 3300013307 Ga0157372_10002074 Ga0157372_1000207420 139
191 3300013307 Ga0157372_10013800 Ga0157372_100138004 139
192 3300013307 Ga0157372_10643774 Ga0157372_106437742 139
193 3300013307 Ga0157372_11550117 Ga0157372_115501171 139
194 3300013308 Ga0157375_10073018 Ga0157375_100730182 139
195 3300013308 Ga0157375_10415015 Ga0157375_104150151 139
196 3300014497 Ga0182008_10019585 Ga0182008_100195853 139
197 3300014497 Ga0182008_10034486 Ga0182008_100344862 139
198 3300014497 Ga0182008_10065267 Ga0182008_100652672 139
199 3300014497 Ga0182008_10138510 Ga0182008_101385102 139
200 3300014969 Ga0157376_10031542 Ga0157376_100315426 139
201 3300014969 Ga0157376_10789597 Ga0157376_107895971 139
202 3300015262 Ga0182007_10025347 Ga0182007_100253472 139
203 3300015262 Ga0182007_10044901 Ga0182007_100449012 139
204 3300015262 Ga0182007_10091316 Ga0182007_100913162 139
205 3300017792 Ga0163161_10409274 Ga0163161_104092742 139
206 3300020077 Ga0206351_10028307 Ga0206351_100283071 139
207 3300020077 Ga0206351_10568253 Ga0206351_105682531 139
208 3300020078 Ga0206352_10173995 Ga0206352_101739951 139
209 3300020080 Ga0206350_11346515 Ga0206350_113465151 139
210 3300020080 Ga0206350_11396680 Ga0206350_113966801 139
211 3300022467 Ga0224712_10386226 Ga0224712_103862261 139
212 3300025231 Ga0207427_100025 Ga0207427_10002581 139
213 3300025233 Ga0209437_100010 Ga0209437_100010343 139
214 3300025233 Ga0209437_100089 Ga0209437_100089145 139
215 3300025250 Ga0209026_1000357 Ga0209026_100035729 139
216 3300025250 Ga0209026_1002107 Ga0209026_10021074 139
217 3300025261 Ga0209233_1000017 Ga0209233_1000017356 139
218 3300025261 Ga0209233_1000655 Ga0209233_10006555 139
219 3300025272 Ga0209455_1000682 Ga0209455_10006829 139
220 3300025298 Ga0209050_1032876 Ga0209050_10328762 139
221 3300025899 Ga0207642_10047741 Ga0207642_100477413 139
222 3300025899 Ga0207642_10223447 Ga0207642_102234471 139
223 3300025904 Ga0207647_10000169 Ga0207647_1000016938 139
224 3300025904 Ga0207647_10000206 Ga0207647_1000020620 139
225 3300025904 Ga0207647_10049385 Ga0207647_100493852 139
226 3300025904 Ga0207647_10171497 Ga0207647_101714971 139
227 3300025907 Ga0207645_10001160 Ga0207645_100011606 139
228 3300025908 Ga0207643_10332794 Ga0207643_103327941 139
229 3300025909 Ga0207705_10000043 Ga0207705_1000004387 139
230 3300025909 Ga0207705_10125706 Ga0207705_101257062 139
231 3300025909 Ga0207705_10139750 Ga0207705_101397502 139
232 3300025909 Ga0207705_10251824 Ga0207705_102518242 139
233 3300025911 Ga0207654_10000940 Ga0207654_100009403 139
234 3300025911 Ga0207654_10001666 Ga0207654_100016664 139
235 3300025911 Ga0207654_10032593 Ga0207654_100325931 139
236 3300025911 Ga0207654_10171365 Ga0207654_101713652 139
237 3300025911 Ga0207654_10738748 Ga0207654_107387481 139
238 3300025911 Ga0207654_10991035 Ga0207654_109910351 139
239 3300025912 Ga0207707_10002144 Ga0207707_100021448 139
240 3300025912 Ga0207707_10050739 Ga0207707_100507393 139
241 3300025913 Ga0207695_10000048 Ga0207695_1000004878 139
242 3300025913 Ga0207695_10007976 Ga0207695_1000797614 139
243 3300025913 Ga0207695_10008731 Ga0207695_100087312 139
244 3300025913 Ga0207695_10010497 Ga0207695_100104974 139
245 3300025913 Ga0207695_10100382 Ga0207695_101003822 139
246 3300025913 Ga0207695_10110469 Ga0207695_101104693 139
247 3300025913 Ga0207695_10153414 Ga0207695_101534143 139
248 3300025913 Ga0207695_10221742 Ga0207695_102217423 139
249 3300025913 Ga0207695_10275783 Ga0207695_102757832 139
250 3300025913 Ga0207695_10288685 Ga0207695_102886851 139
251 3300025913 Ga0207695_10301342 Ga0207695_103013422 139
252 3300025913 Ga0207695_10555577 Ga0207695_105555772 139
253 3300025913 Ga0207695_10576073 Ga0207695_105760731 139
254 3300025914 Ga0207671_10002352 Ga0207671_100023521 139
255 3300025914 Ga0207671_10005530 Ga0207671_100055305 139
256 3300025914 Ga0207671_10023992 Ga0207671_100239929 139
257 3300025914 Ga0207671_10037528 Ga0207671_100375281 139
258 3300025914 Ga0207671_10319622 Ga0207671_103196222 139
259 3300025914 Ga0207671_10529053 Ga0207671_105290532 139
260 3300025914 Ga0207671_10575916 Ga0207671_105759162 139
261 3300025917 Ga0207660_10003392 Ga0207660_100033928 139
262 3300025919 Ga0207657_10007134 Ga0207657_100071348 139
263 3300025919 Ga0207657_10179266 Ga0207657_101792662 139
264 3300025919 Ga0207657_10274356 Ga0207657_102743562 139
265 3300025919 Ga0207657_10424321 Ga0207657_104243211 139
266 3300025919 Ga0207657_10956531 Ga0207657_109565311 139
267 3300025920 Ga0207649_10928578 Ga0207649_109285781 139
268 3300025921 Ga0207652_10001983 Ga0207652_100019833 139
269 3300025924 Ga0207694_10067320 Ga0207694_100673201 139
270 3300025924 Ga0207694_10133143 Ga0207694_101331434 139
271 3300025927 Ga0207687_10600634 Ga0207687_106006342 139
272 3300025931 Ga0207644_10007617 Ga0207644_100076174 139
273 3300025932 Ga0207690_10000190 Ga0207690_1000019014 139
274 3300025932 Ga0207690_10011790 Ga0207690_100117904 139
275 3300025933 Ga0207706_10000167 Ga0207706_1000016733 139
276 3300025933 Ga0207706_10208487 Ga0207706_102084872 139
277 3300025934 Ga0207686_10010761 Ga0207686_100107614 139
278 3300025934 Ga0207686_10792245 Ga0207686_107922452 139
279 3300025937 Ga0207669_10190144 Ga0207669_101901441 139
280 3300025937 Ga0207669_11685345 Ga0207669_116853451 139
281 3300025938 Ga0207704_10000042 Ga0207704_1000004252 139
282 3300025949 Ga0207667_10000015 Ga0207667_10000015132 139
283 3300025949 Ga0207667_10000644 Ga0207667_100006442 139
284 3300025949 Ga0207667_10010553 Ga0207667_100105531 139
285 3300025949 Ga0207667_10017043 Ga0207667_100170432 139
286 3300025949 Ga0207667_10107668 Ga0207667_101076682 139
287 3300025949 Ga0207667_10286582 Ga0207667_102865821 139
288 3300025949 Ga0207667_10287615 Ga0207667_102876152 139
289 3300025949 Ga0207667_11239799 Ga0207667_112397992 139
290 3300025960 Ga0207651_10024281 Ga0207651_100242812 139
291 3300025981 Ga0207640_10028760 Ga0207640_100287602 139
292 3300025981 Ga0207640_10595696 Ga0207640_105956961 139
293 3300026023 Ga0207677_10015719 Ga0207677_100157194 139
294 3300026041 Ga0207639_10013277 Ga0207639_100132774 139
295 3300026041 Ga0207639_10019287 Ga0207639_100192874 139
296 3300026041 Ga0207639_10023037 Ga0207639_100230373 139
297 3300026041 Ga0207639_10400060 Ga0207639_104000602 139
298 3300026041 Ga0207639_10639102 Ga0207639_106391022 139
299 3300026041 Ga0207639_10740654 Ga0207639_107406541 139
300 3300026041 Ga0207639_11977186 Ga0207639_119771861 139
301 3300026067 Ga0207678_10234812 Ga0207678_102348122 139
302 3300026078 Ga0207702_10000165 Ga0207702_1000016575 139
303 3300026078 Ga0207702_10034738 Ga0207702_100347381 139
304 3300026078 Ga0207702_10145384 Ga0207702_101453842 139
305 3300026088 Ga0207641_10000051 Ga0207641_1000005110 139
306 3300026089 Ga0207648_10003557 Ga0207648_1000355717 139
307 3300026095 Ga0207676_10037053 Ga0207676_100370532 139
308 3300026116 Ga0207674_10021734 Ga0207674_100217348 139
309 3300026121 Ga0207683_10002545 Ga0207683_100025457 139
310 3300026142 Ga0207698_10001222 Ga0207698_1000122211 139
311 3300028379 Ga0268266_10000030 Ga0268266_10000030266 139
312 3300028786 Ga0307517_10003956 Ga0307517_100039569 139
313 3300028786 Ga0307517_10026831 Ga0307517_100268318 139
314 3300028794 Ga0307515_10001736 Ga0307515_1000173644 139
315 3300028800 Ga0265338_10503999 Ga0265338_105039991 139
316 3300030522 Ga0307512_10297827 Ga0307512_102978271 139
317 3300031251 Ga0265327_10139241 Ga0265327_101392413 139
318 3300031251 Ga0265327_10414509 Ga0265327_104145091 139
319 3300031507 Ga0307509_10050878 Ga0307509_100508782 139
320 3300031507 Ga0307509_10060402 Ga0307509_100604024 139
321 3300031507 Ga0307509_10197317 Ga0307509_101973172 139
322 3300031730 Ga0307516_10000189 Ga0307516_1000018928 139
323 3300031911 Ga0307412_10161072 Ga0307412_101610722 139
324 3300031911 Ga0307412_10417578 Ga0307412_104175782 139
325 3300033179 Ga0307507_10000023 Ga0307507_1000002333 139
326 3300033179 Ga0307507_10001430 Ga0307507_1000143025 139
327 3300033180 Ga0307510_10000147 Ga0307510_1000014732 139
328 3300033180 Ga0307510_10001320 Ga0307510_1000132031 139
329 3300035115 Ga0373941_0088969 Ga0373941_0088969_603_1022 139
330 3300037312 Ga0395899_0000136 Ga0395899_0000136_95459_95881 139
331 3300037312 Ga0395899_0000286 Ga0395899_0000286_42767_43186 139
332 3300037418 Ga0395900_0000115 Ga0395900_0000115_121054_121473 139
333 3300037418 Ga0395900_0000285 Ga0395900_0000285_29377_29802 139
334 3300037418 Ga0395900_0480072 Ga0395900_0480072_416_838 139
335 3300037418 Ga0395900_1174729 Ga0395900_1174729_160_585 139
336 3300037466 Ga0395898_0005702 Ga0395898_0005702_5957_6376 139
337 3300037471 Ga0395905_0000045 Ga0395905_0000045_120860_121279 139
338 3300038443 Ga0395901_0001032 Ga0395901_0001032_4115_4534 139
339 3300038443 Ga0395901_0509010 Ga0395901_0509010_556_975 139
340 3300041404 Ga0439436_0257430 Ga0439436_0257430_74_493 139
341 3300041505 Ga0451849_1091099 Ga0451849_1091099_144_563 139
342 3300041507 Ga0451851_1315931 Ga0451851_1315931_170_589 139
343 3300042005 Ga0439448_0018357 Ga0439448_0018357_107_526 139
344 3300042012 Ga0439455_0076204 Ga0439455_0076204_382_801 139
345 3300044656 Ga0466969_0354457 Ga0466969_0354457_115_537 139
346 3300044684 Ga0466966_0121420 Ga0466966_0121420_1094_1516 139
347 3300044842 Ga0466957_0329951 Ga0466957_0329951_567_992 139
348 3300045836 Ga0466958_0038231 Ga0466958_0038231_1291_1713 139
349 3300046454 Ga0495592_0612691 Ga0495592_0612691_107_526 139
350 3300046460 Ga0495638_0457827 Ga0495638_0457827_152_571 139
351 3300046462 Ga0495651_0135993 Ga0495651_0135993_468_887 139
352 3300046471 Ga0495650_0000119 Ga0495650_0000119_157803_158222 139
353 3300046471 Ga0495650_0086558 Ga0495650_0086558_46_465 139
354 3300046492 Ga0495585_0000173 Ga0495585_0000173_44321_44740 139
355 3300046492 Ga0495585_0000456 Ga0495585_0000456_19921_20364 139
356 3300046500 Ga0495596_0021550 Ga0495596_0021550_1309_1728 139
357 3300046501 Ga0495607_0150266 Ga0495607_0150266_295_714 139
358 3300046506 Ga0495583_0220584 Ga0495583_0220584_297_716 139
359 3300046507 Ga0495606_0000008 Ga0495606_0000008_85547_85966 139
360 3300046507 Ga0495606_0110166 Ga0495606_0110166_56_475 139
361 3300046511 Ga0495608_0222631 Ga0495608_0222631_603_1022 139
362 3300046512 Ga0495610_0000089 Ga0495610_0000089_34479_34898 139
363 3300046512 Ga0495610_0002038 Ga0495610_0002038_16437_16856 139
364 3300046513 Ga0495616_0002658 Ga0495616_0002658_2600_3019 139
365 3300046513 Ga0495616_0013249 Ga0495616_0013249_3340_3759 139
366 3300046516 Ga0495628_0145946 Ga0495628_0145946_669_1112 139
367 3300046518 Ga0495631_0002766 Ga0495631_0002766_8465_8884 139
368 3300046518 Ga0495631_0166413 Ga0495631_0166413_487_906 139
369 3300046519 Ga0495632_0052287 Ga0495632_0052287_697_1116 139
370 3300046519 Ga0495632_0217090 Ga0495632_0217090_337_756 139
371 3300046520 Ga0495637_0025708 Ga0495637_0025708_110_529 139
372 3300046523 Ga0495644_0061205 Ga0495644_0061205_299_718 139
373 3300046524 Ga0495648_0008886 Ga0495648_0008886_1164_1607 139
374 3300046524 Ga0495648_0237365 Ga0495648_0237365_181_600 139
375 3300046529 Ga0495652_0062168 Ga0495652_0062168_1252_1671 139
376 3300046529 Ga0495652_0237533 Ga0495652_0237533_554_973 139
377 3300046530 Ga0495654_0299882 Ga0495654_0299882_177_620 139
378 3300046558 Ga0495633_0000273 Ga0495633_0000273_23230_23649 139
379 3300046558 Ga0495633_0004402 Ga0495633_0004402_7354_7773 139
380 3300046616 Ga0495668_0000134 Ga0495668_0000134_11415_11912 139
381 3300046648 Ga0495611_0092410 Ga0495611_0092410_135_554 139
382 3300046648 Ga0495611_0423862 Ga0495611_0423862_135_554 139
383 3300046660 Ga0495625_0000017 Ga0495625_0000017_252436_252855 139
384 3300046660 Ga0495625_0002361 Ga0495625_0002361_19803_20222 139
385 3300046660 Ga0495625_0004708 Ga0495625_0004708_169_612 139
386 3300046660 Ga0495625_0024525 Ga0495625_0024525_798_1217 139
387 3300046660 Ga0495625_0032543 Ga0495625_0032543_2668_3087 139
388 3300046660 Ga0495625_0037005 Ga0495625_0037005_3144_3563 139
389 3300046660 Ga0495625_0070929 Ga0495625_0070929_331_750 139
390 3300046660 Ga0495625_0268795 Ga0495625_0268795_124_543 139
391 3300046660 Ga0495625_0546280 Ga0495625_0546280_46_465 139
392 3300046665 Ga0495661_0027547 Ga0495661_0027547_2935_3354 139
393 3300046684 Ga0495669_0557921 Ga0495669_0557921_87_506 139
394 3300046691 Ga0495670_0763573 Ga0495670_0763573_63_482 139
395 3300046691 Ga0495670_0827160 Ga0495670_0827160_28_447 139
396 3300046694 Ga0495649_0000121 Ga0495649_0000121_21161_21580 139
397 3300046694 Ga0495649_0352630 Ga0495649_0352630_308_727 139
398 3300046809 Ga0495600_0462502 Ga0495600_0462502_95_592 139
399 3300047323 Ga0495683_0032543 Ga0495683_0032543_140_559 139
400 3300047323 Ga0495683_0051944 Ga0495683_0051944_130_549 139
401 3300047443 Ga0495687_001739 Ga0495687_001739_10768_11187 139
402 3300047443 Ga0495687_001856 Ga0495687_001856_1196_1615 139
403 3300047443 Ga0495687_034031 Ga0495687_034031_220_639 139
404 3300047445 Ga0495677_0214088 Ga0495677_0214088_204_623 139
405 3300047469 Ga0495673_0119838 Ga0495673_0119838_178_597 139
406 3300047472 Ga0495686_0000974 Ga0495686_0000974_24690_25109 139
407 3300047472 Ga0495686_0001124 Ga0495686_0001124_30728_31147 139
408 3300047472 Ga0495686_0086810 Ga0495686_0086810_1224_1643 139
409 3300047472 Ga0495686_0126388 Ga0495686_0126388_565_984 139
410 3300048903 Ga0496100_1282821 Ga0496100_1282821_109_528 139
411 3300048918 Ga0496115_0198846 Ga0496115_0198846_826_1245 139
412 3300049459 Ga0495678_005167 Ga0495678_005167_5114_5533 139
413 3300050493 nmdc:mga0k408_2155_c1 nmdc:mga0k408_2155_c1_2278_2697 139
414 3300050493 nmdc:mga0k408_41272_c1 nmdc:mga0k408_41272_c1_1380_1799 139
415 3300050493 nmdc:mga0k408_93674_c1 nmdc:mga0k408_93674_c1_73_495 139
416 3300053080 Ga0500635_0000997 Ga0500635_0000997_2522_2944 139
417 3300053091 Ga0500647_0376906 Ga0500647_0376906_105_524 139
418 3300053092 Ga0500583_0491300 Ga0500583_0491300_17_436 139
419 3300053109 Ga0500569_151755 Ga0500569_151755_246_665 139
420 3300053122 Ga0500608_002183 Ga0500608_002183_4222_4641 139
421 3300053123 Ga0500614_104666 Ga0500614_104666_280_723 139
422 3300053125 Ga0500618_000266 Ga0500618_000266_28189_28608 139
423 3300053137 Ga0500561_0164938 Ga0500561_0164938_132_575 139
424 3300053146 Ga0500588_0003826 Ga0500588_0003826_1308_1727 139
425 3300053153 Ga0500616_0178343 Ga0500616_0178343_425_844 139
426 3300053156 Ga0500622_0022740 Ga0500622_0022740_2317_2736 139
427 3300053157 Ga0500624_000153 Ga0500624_000153_3329_3748 139
428 3300053161 Ga0500634_0209698 Ga0500634_0209698_166_585 139
429 3300053730 Ga0500645_023694 Ga0500645_023694_649_1068 139
430 3300059492 Ga0587073_0175359 Ga0587073_0175359_182_601 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

41

140

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9467 1 139
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9444 1 139
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.944 1 139
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9401 1 139
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9379 1 139
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9427 1 139 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9362 1 139 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8963 4 139 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8895 39 137 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8764 1 137 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A1H5WVH9-F1-model_v4 Osmotically inducible protein OsmC 0.9835 1 139 GO:0004601
GO:0006979
AF-A0A7Y4QFA4-F1-model_v4 OsmC family protein 0.9835 1 139 GO:0004601
GO:0006979
AF-A0A0Q5T6M1-F1-model_v4 Peroxiredoxin 0.9806 1 138 GO:0004601
GO:0006979
AF-A0A1N6JDU6-F1-model_v4 Osmotically inducible protein OsmC 0.9802 1 139 GO:0004601
GO:0006979
AF-A0A7G6YP33-F1-model_v4 OsmC family peroxiredoxin 0.9776 1 139 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
94.31 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map