metagRoot

F442128

General Info

Members	Datasets	Scaffolds	Average Seq Length
430	263	393	523

Family's Representative Sequence

Representative Sequence	3300009553\|Ga0105249_10045765\|Ga0105249_100457654
Length	570
Sequence	MNAYVLFEAADQLAPEIDLPTKQCAGSARRTTRYEGTIMNIFRRTCFGLLASVAAVTGFVSPLSAQQAQKPNILVIMADDVGYWNISAYNRGMMGYRTPNIDRIANEGAIFTDYYGQQSCTAGRAAFITGQSPLRTGLLKVGLPAAKEGLSAKDPTIAELLKPQGYATGQFGKNHLGDRNEFLPTVHGFDEFFGNLYHLNAEDEPEHPDYPKNPAFRAQFGPRGVMKCVAVPTDTPGDDPRFGTWGKQKCEDTGPLTKKRMETIDEEFLGATTDFIDRANRDKKPFFVWFNPSRMHIWTRLKPASQGKTGLGIYPDGMVEHDGQVGQVLKKLDDLGIANNTIVIYTTDNGAETFSWPDGGTTPFKGEKNTNWEGGYRVPAMVRWPGLVPPRTEINEIFSAEDWATTLVAAAGEPDIKNKLLLGYDAAGKKFNVHLDGYDQRDLLAGKGPDKRREFFYWTDDGNLAGLRYDQWKAVFLEQKAHGLDVWAQPMIQLRLPSLYNLRSDPFERAQHEAGDYVKWFIEHAFLLLPAQAVVGQHLQSFQQFPPRQRPGSFSIEQAMEKLRNPPSSN

Samples

	Sample ID	Description	Type	Environment
1	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
2	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
3	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
4	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
5	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
6	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
7	2643221736	Bosea sp. Root483D1	Isolate	Unclassified
8	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
9	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
10	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
11	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
12	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
13	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
14	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
15	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
16	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
17	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
18	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
19	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
20	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
21	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
22	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
23	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
24	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
25	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
26	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
27	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
28	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
29	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
30	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
31	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
32	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
33	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
34	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
35	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
38	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
39	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
40	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
41	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
42	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
43	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
44	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
45	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
46	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
47	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
51	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
54	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
59	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
62	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
63	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
64	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
65	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
66	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
67	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
68	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
69	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
76	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
77	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
80	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
88	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
91	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
95	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
96	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
97	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
98	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
132	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
133	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
139	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
140	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
141	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
142	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
143	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
144	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
145	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
146	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
147	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
148	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
149	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
150	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
153	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
154	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
155	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
156	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
157	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
158	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
159	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
160	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
161	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
162	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
163	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
164	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
165	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
166	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
167	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
168	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
169	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
170	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
171	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
172	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
173	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
174	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
175	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
176	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
177	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
178	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
179	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
180	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
181	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
182	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
183	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
184	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
185	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
186	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
187	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
188	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
189	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
190	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
191	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
192	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
193	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
194	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
195	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
196	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
197	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
198	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
199	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
200	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
201	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
202	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
203	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
204	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
205	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
206	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
207	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
208	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
209	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
210	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
211	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
212	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
213	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
214	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
215	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
216	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
217	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
218	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
219	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
220	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
221	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
222	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
223	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
224	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
225	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
226	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
227	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
228	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
229	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
230	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
231	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
232	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
233	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
234	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
235	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
236	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
237	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
238	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
239	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
240	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
241	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
242	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
243	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
244	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
245	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
246	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
247	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
248	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
249	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
250	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
251	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
252	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
253	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
254	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
255	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
256	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
257	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
258	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
259	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
260	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
261	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
262	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
263	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	91.4
Metatranscriptomes	0
Isolates	8.6

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.84
Nodule	6.98
Rhizoplane	10.93
Rhizosphere	65.35
Stem	0
Stem Tuber	0
Unclassified	7.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25160J50197_1000383	3300003354	Bacteria	28714
2	Ga0065165_1002227	3300005262	Bacteria	17288
3	Ga0068869_100043560	3300005334	Bacteria	3224
4	Ga0068869_100069343	3300005334	Bacteria	2606
5	Ga0068868_100003568	3300005338	Bacteria	10834
6	Ga0070668_100009402	3300005347	Bacteria	7250
7	Ga0070668_100018702	3300005347	Bacteria	5203
8	Ga0070668_100020931	3300005347	Bacteria	4941
9	Ga0070668_100128335	3300005347	Bacteria	2033
10	Ga0070675_100114963	3300005354	Bacteria	2280
11	Ga0070674_100013967	3300005356	Bacteria	4981
12	Ga0070709_10012293	3300005434	Bacteria	4789
13	Ga0070714_100009791	3300005435	Bacteria	7554
14	Ga0070714_100114175	3300005435	Bacteria	2396
15	Ga0070711_100029132	3300005439	Bacteria	3640
16	Ga0070700_100054581	3300005441	Bacteria	2497
17	Ga0070663_100019530	3300005455	Bacteria	4469
18	Ga0070678_100007547	3300005456	Bacteria	6459
19	Ga0070662_100085831	3300005457	Bacteria	2353
20	Ga0070699_100004476	3300005518	Bacteria	12357
21	Ga0068853_100018386	3300005539	Bacteria	5784
22	Ga0070672_100036674	3300005543	Bacteria	3736
23	Ga0070695_100001511	3300005545	Bacteria	12914
24	Ga0070696_100038892	3300005546	Bacteria	3285
25	Ga0070665_100001119	3300005548	Bacteria	32954
26	Ga0070665_100004691	3300005548	Bacteria	14269
27	Ga0070665_100004780	3300005548	Bacteria	14100
28	Ga0068855_100030189	3300005563	Bacteria	6484
29	Ga0068856_100006556	3300005614	Bacteria	11412
30	Ga0068864_100127691	3300005618	Bacteria	2280
31	Ga0068861_100053441	3300005719	Bacteria	3073
32	Ga0068861_100112551	3300005719	Bacteria	2182
33	Ga0068863_100215965	3300005841	Bacteria	1847
34	Ga0068858_100061925	3300005842	Bacteria	3459
35	Ga0068858_100082823	3300005842	Bacteria	2983
36	Ga0068860_100054703	3300005843	Bacteria	3793
37	Ga0068862_100016183	3300005844	Bacteria	6203
38	Ga0068862_100041234	3300005844	Bacteria	3927
39	Ga0068862_100065545	3300005844	Bacteria	3129
40	Ga0081455_10002025	3300005937	Bacteria	24234
41	Ga0081455_10002221	3300005937	Bacteria	23113
42	Ga0081455_10139988	3300005937	Bacteria	1880
43	Ga0081540_1002056	3300005983	Bacteria	16782
44	Ga0081540_1002563	3300005983	Bacteria	14745
45	Ga0081540_1011752	3300005983	Bacteria	5825
46	Ga0070717_10008103	3300006028	Bacteria	7838
47	Ga0075365_10031621	3300006038	Bacteria	3396
48	Ga0075365_10099855	3300006038	Bacteria	1986
49	Ga0075368_10012581	3300006042	Bacteria	3096
50	Ga0070712_100025591	3300006175	Bacteria	3925
51	Ga0075362_10003731	3300006177	Bacteria	5385
52	Ga0075362_10014422	3300006177	Bacteria	3190
53	Ga0075367_10009758	3300006178	Bacteria	5027
54	Ga0075367_10030495	3300006178	Bacteria	3092
55	Ga0075369_10004185	3300006186	Bacteria	5318
56	Ga0075369_10008195	3300006186	Bacteria	4012
57	Ga0075366_10001491	3300006195	Bacteria	11686
58	Ga0075366_10055958	3300006195	Bacteria	2343
59	Ga0075366_10070515	3300006195	Bacteria	2081
60	Ga0075370_10000079	3300006353	Bacteria	29493
61	Ga0075370_10016033	3300006353	Bacteria	4026
62	Ga0075370_10039675	3300006353	Bacteria	2654
63	Ga0075428_100074230	3300006844	Bacteria	3715
64	Ga0075428_100121391	3300006844	Bacteria	2846
65	Ga0075428_100186074	3300006844	Bacteria	2247
66	Ga0075430_100072840	3300006846	Bacteria	2881
67	Ga0075431_100005277	3300006847	Bacteria	12730
68	Ga0075431_100117983	3300006847	Bacteria	2738
69	Ga0075433_10019729	3300006852	Bacteria	5624
70	Ga0075433_10157803	3300006852	Bacteria	2019
71	Ga0075434_100027331	3300006871	Bacteria	5601
72	Ga0075434_100150898	3300006871	Bacteria	2344
73	Ga0075429_100049161	3300006880	Bacteria	3667
74	Ga0075429_100149652	3300006880	Bacteria	2043
75	Ga0097620_100150853	3300006931	Bacteria	2400
76	Ga0099823_1011666	3300006944	Bacteria	8900
77	Ga0075435_100013628	3300007076	Bacteria	6055
78	Ga0075435_100016505	3300007076	Bacteria	5567
79	Ga0111539_10104817	3300009094	Bacteria	3318
80	Ga0111539_10111848	3300009094	Bacteria	3204
81	Ga0111539_10114669	3300009094	Bacteria	3160
82	Ga0111539_10139203	3300009094	Bacteria	2842
83	Ga0105247_10009199	3300009101	Bacteria	6009
84	Ga0105247_10020448	3300009101	Bacteria	3980
85	Ga0105247_10049378	3300009101	Bacteria	2587
86	Ga0114129_10107281	3300009147	Bacteria	3858
87	Ga0114129_10139453	3300009147	Bacteria	3325
88	Ga0105243_10006688	3300009148	Bacteria	8902
89	Ga0105243_10119584	3300009148	Bacteria	2219
90	Ga0105241_10001795	3300009174	Bacteria	16300
91	Ga0105248_10260939	3300009177	Bacteria	1950
92	Ga0105237_10035073	3300009545	Bacteria	5077
93	Ga0105238_10000676	3300009551	Bacteria	35848
94	Ga0105249_10045765	3300009553	Bacteria	3981
95	Ga0105249_10049003	3300009553	Bacteria	3852
96	Ga0105249_10054760	3300009553	Bacteria	3648
97	Ga0105249_10092031	3300009553	Bacteria	2838
98	Ga0105239_10015846	3300010375	Bacteria	8343
99	Ga0105239_10023932	3300010375	Bacteria	6727
100	Ga0157374_10023104	3300013296	Bacteria	5556
101	Ga0157378_10081393	3300013297	Bacteria	2927
102	Ga0163162_10045107	3300013306	Bacteria	4416
103	Ga0163162_10094735	3300013306	Bacteria	3072
104	Ga0163162_10168563	3300013306	Bacteria	2314
105	Ga0163162_10239827	3300013306	Bacteria	1944
106	Ga0157375_10049993	3300013308	Bacteria	4100
107	Ga0157375_10219389	3300013308	Bacteria	2060
108	Ga0157375_10327020	3300013308	Bacteria	1698
109	Ga0163163_10054075	3300014325	Bacteria	3965
110	Ga0163163_10225037	3300014325	Bacteria	1925
111	Ga0157380_10082594	3300014326	Bacteria	2630
112	Ga0157380_10116183	3300014326	Bacteria	2258
113	Ga0182008_10006166	3300014497	Bacteria	6737
114	Ga0207426_1000035	3300025302	Bacteria	448327
115	Ga0209051_1005177	3300025303	Bacteria	7725
116	Ga0207697_10028275	3300025315	Bacteria	2293
117	Ga0207710_10010904	3300025900	Bacteria	3827
118	Ga0207710_10026498	3300025900	Bacteria	2506
119	Ga0207699_10019940	3300025906	Bacteria	3585
120	Ga0207654_10001406	3300025911	Bacteria	12760
121	Ga0207671_10017253	3300025914	Bacteria	5574
122	Ga0207693_10018788	3300025915	Bacteria	5500
123	Ga0207693_10044274	3300025915	Bacteria	3498
124	Ga0207663_10010191	3300025916	Bacteria	4992
125	Ga0207694_10059051	3300025924	Bacteria	2983
126	Ga0207659_10078935	3300025926	Bacteria	2427
127	Ga0207700_10069571	3300025928	Bacteria	2702
128	Ga0207664_10009159	3300025929	Bacteria	6938
129	Ga0207706_10022675	3300025933	Bacteria	5635
130	Ga0207709_10026308	3300025935	Bacteria	3341
131	Ga0207669_10008078	3300025937	Bacteria	4922
132	Ga0207669_10043165	3300025937	Bacteria	2639
133	Ga0207691_10099137	3300025940	Bacteria	2602
134	Ga0207711_10025187	3300025941	Bacteria	4992
135	Ga0207689_10018364	3300025942	Bacteria	5900
136	Ga0207689_10072600	3300025942	Bacteria	2827
137	Ga0207667_10185535	3300025949	Bacteria	2135
138	Ga0207712_10004116	3300025961	Bacteria	9182
139	Ga0207712_10111421	3300025961	Bacteria	2054
140	Ga0207668_10010667	3300025972	Bacteria	5560
141	Ga0207668_10014277	3300025972	Bacteria	4914
142	Ga0207668_10051266	3300025972	Bacteria	2849
143	Ga0207668_10067794	3300025972	Bacteria	2534
144	Ga0207668_10097023	3300025972	Bacteria	2180
145	Ga0207668_10115770	3300025972	Bacteria	2020
146	Ga0207658_10125942	3300025986	Bacteria	2050
147	Ga0207677_10003271	3300026023	Bacteria	8557
148	Ga0207703_10015022	3300026035	Bacteria	6043
149	Ga0207703_10046940	3300026035	Bacteria	3481
150	Ga0207639_10030492	3300026041	Bacteria	3955
151	Ga0207678_10032197	3300026067	Bacteria	4570
152	Ga0207708_10019938	3300026075	Bacteria	5055
153	Ga0207708_10067531	3300026075	Bacteria	2735
154	Ga0207641_10033025	3300026088	Bacteria	4299
155	Ga0207648_10020616	3300026089	Bacteria	5934
156	Ga0207676_10013215	3300026095	Bacteria	5930
157	Ga0207676_10102509	3300026095	Bacteria	2376
158	Ga0207675_100027369	3300026118	Bacteria	5310
159	Ga0207675_100027907	3300026118	Bacteria	5258
160	Ga0207675_100035509	3300026118	Bacteria	4650
161	Ga0207675_100105567	3300026118	Bacteria	2655
162	Ga0207683_10034179	3300026121	Bacteria	4418
163	Ga0207683_10077354	3300026121	Bacteria	2947
164	Ga0209389_1000147	3300027296	Bacteria	60189
165	Ga0209489_100875	3300027361	Bacteria	60189
166	Ga0209813_10002765	3300027866	Bacteria	4049
167	Ga0207428_10020429	3300027907	Bacteria	5626
168	Ga0207428_10029570	3300027907	Bacteria	4539
169	Ga0207428_10045329	3300027907	Bacteria	3542
170	Ga0207428_10049557	3300027907	Bacteria	3364
171	Ga0268266_10001206	3300028379	Bacteria	31890
172	Ga0268266_10001365	3300028379	Bacteria	29475
173	Ga0268266_10004115	3300028379	Bacteria	14049
174	Ga0268265_10008059	3300028380	Bacteria	7116
175	Ga0268265_10017749	3300028380	Bacteria	4919
176	Ga0268265_10023995	3300028380	Bacteria	4308
177	Ga0268264_10016104	3300028381	Bacteria	6126
178	Ga0268264_10032351	3300028381	Bacteria	4291
179	Ga0268264_10054508	3300028381	Bacteria	3339
180	Ga0307509_10062948	3300031507	Bacteria	3909
181	Ga0307410_10057952	3300031852	Bacteria	2639
182	Ga0307412_10054106	3300031911	Bacteria	2663
183	Ga0307510_10044265	3300033180	Bacteria	4824
184	Ga0373940_0018390	3300035088	Bacteria	1753
185	Ga0373923_0005813	3300035111	Bacteria	4212
186	Ga0373936_0021287	3300035113	Bacteria	2521
187	Ga0373953_0004562	3300035117	Bacteria	4420
188	Ga0373954_0015753	3300035118	Bacteria	3381
189	Ga0373954_0063313	3300035118	Bacteria	1748
190	Ga0373956_0059418	3300035119	Bacteria	1730
191	Ga0373943_0000459	3300035170	Bacteria	17295
192	Ga0373943_0015278	3300035170	Bacteria	3486
193	Ga0373962_0001924	3300035242	Bacteria	4944
194	Ga0373924_0003272	3300035410	Bacteria	5547
195	Ga0373931_0002690	3300035691	Bacteria	7909
196	Ga0373931_0072282	3300035691	Bacteria	1886
197	Ga0373935_0000418	3300035692	Bacteria	22120
198	Ga0373935_0006657	3300035692	Bacteria	6903
199	Ga0373935_0034119	3300035692	Bacteria	3171
200	Ga0373927_0001108	3300035695	Bacteria	20449
201	Ga0373927_0004279	3300035695	Bacteria	10019
202	Ga0373927_0026385	3300035695	Bacteria	3796
203	Ga0373927_0041262	3300035695	Bacteria	2993
204	Ga0373933_0002288	3300035724	Bacteria	10901
205	Ga0373933_0104132	3300035724	Bacteria	1763
206	Ga0373947_0002133	3300035725	Bacteria	12043
207	Ga0373947_0005069	3300035725	Bacteria	7715
208	Ga0373937_0134069	3300036401	Bacteria	2315
209	Ga0373937_0240215	3300036401	Bacteria	1707
210	Ga0373925_0000064	3300037068	Bacteria	114743
211	Ga0373925_0002018	3300037068	Bacteria	16810
212	Ga0373925_0093443	3300037068	Bacteria	2302
213	Ga0373925_0155796	3300037068	Bacteria	1796
214	Ga0395898_0081844	3300037466	Bacteria	3113
215	Ga0451833_0080004	3300041491	Bacteria	4416
216	Ga0451835_0476648	3300041492	Bacteria	5258
217	Ga0451837_0909816	3300041494	Bacteria	3367
218	Ga0451839_1394399	3300041496	Bacteria	3049
219	Ga0451841_0027010	3300041498	Bacteria	3619
220	Ga0451845_0987328	3300041501	Bacteria	5602
221	Ga0451847_0734143	3300041503	Bacteria	4982
222	Ga0451849_0456431	3300041505	Bacteria	3947
223	Ga0451851_0881154	3300041507	Bacteria	4503
224	Ga0451843_0923533	3300041509	Bacteria	4020
225	Ga0451855_0079597	3300041511	Bacteria	3304
226	Ga0451853_1299160	3300041512	Bacteria	3925
227	Ga0495592_0000388	3300046454	Bacteria	34309
228	Ga0495629_0005910	3300046459	Bacteria	9120
229	Ga0495629_0086359	3300046459	Bacteria	2189
230	Ga0495641_0014801	3300046461	Bacteria	4204
231	Ga0495651_0000485	3300046462	Bacteria	30654
232	Ga0495653_0000086	3300046463	Bacteria	76161
233	Ga0495580_0022730	3300046472	Bacteria	4610
234	Ga0495582_0008892	3300046473	Bacteria	5541
235	Ga0495639_0016122	3300046475	Bacteria	3241
236	Ga0495639_0044088	3300046475	Bacteria	2016
237	Ga0495662_0001011	3300046476	Bacteria	13803
238	Ga0495662_0036069	3300046476	Bacteria	2387
239	Ga0495664_0000003	3300046477	Bacteria	551602
240	Ga0495584_0057601	3300046491	Bacteria	1955
241	Ga0495585_0047706	3300046492	Bacteria	2385
242	Ga0495594_0028289	3300046499	Bacteria	3024
243	Ga0495594_0091241	3300046499	Bacteria	1707
244	Ga0495608_0000011	3300046511	Bacteria	248514
245	Ga0495610_0001073	3300046512	Bacteria	25099
246	Ga0495618_0000099	3300046514	Bacteria	63065
247	Ga0495628_0000001	3300046516	Bacteria	917742
248	Ga0495648_0008822	3300046524	Bacteria	7888
249	Ga0495652_0000002	3300046529	Bacteria	946606
250	Ga0495652_0020307	3300046529	Bacteria	5905
251	Ga0495665_0004929	3300046531	Bacteria	7197
252	Ga0495665_0006600	3300046531	Bacteria	6267
253	Ga0495640_0000002	3300046533	Bacteria	646434
254	Ga0495587_0000001	3300046536	Bacteria	724132
255	Ga0495645_0000009	3300046543	Bacteria	239632
256	Ga0495667_0000004	3300046559	Bacteria	295297
257	Ga0495656_0014903	3300046615	Bacteria	2925
258	Ga0495634_0000478	3300046642	Bacteria	39481
259	Ga0495634_0043115	3300046642	Bacteria	3058
260	Ga0495634_0047388	3300046642	Bacteria	2896
261	Ga0495625_0005057	3300046660	Bacteria	12213
262	Ga0495625_0016793	3300046660	Bacteria	5748
263	Ga0495625_0054977	3300046660	Bacteria	2841
264	Ga0495635_0000001	3300046663	Bacteria	704901
265	Ga0495635_0006026	3300046663	Bacteria	8455
266	Ga0495659_0028481	3300046664	Bacteria	1934
267	Ga0495657_0001469	3300046675	Bacteria	20305
268	Ga0495599_0000036	3300046678	Bacteria	102707
269	Ga0495623_0000043	3300046679	Bacteria	77839
270	Ga0495646_0000019	3300046680	Bacteria	119527
271	Ga0495647_0040509	3300046681	Bacteria	1770
272	Ga0495658_0010120	3300046683	Bacteria	4712
273	Ga0495669_0042152	3300046684	Bacteria	2028
274	Ga0495613_0005820	3300046689	Bacteria	9227
275	Ga0495624_0019275	3300046690	Bacteria	4556
276	Ga0495600_0000017	3300046809	Bacteria	107635
277	Ga0495600_0021540	3300046809	Bacteria	4129
278	Ga0495581_0000593	3300047315	Bacteria	18943
279	Ga0495604_0000008	3300047317	Bacteria	341160
280	Ga0495604_0024835	3300047317	Bacteria	4780
281	Ga0495604_0036558	3300047317	Bacteria	3872
282	Ga0495674_0000016	3300047319	Bacteria	216763
283	Ga0495674_0063708	3300047319	Bacteria	3206
284	Ga0495674_0075696	3300047319	Bacteria	2896
285	Ga0495674_0132151	3300047319	Bacteria	2102
286	Ga0495676_0031530	3300047321	Bacteria	4480
287	Ga0495676_0079978	3300047321	Bacteria	2483
288	Ga0495680_0000974	3300047322	Bacteria	31812
289	Ga0495675_0000163	3300047444	Bacteria	47525
290	Ga0495684_0000002	3300047471	Bacteria	341216
291	Ga0495684_0009542	3300047471	Bacteria	7482
292	Ga0495686_0011012	3300047472	Bacteria	6397
293	Ga0495593_0002510	3300047673	Bacteria	11029
294	Ga0495593_0014718	3300047673	Bacteria	4446
295	Ga0495602_0000066	3300048088	Bacteria	102731
296	Ga0496100_0062216	3300048903	Bacteria	2462
297	Ga0496100_0157283	3300048903	Bacteria	1626
298	Ga0496101_0017384	3300048904	Bacteria	4879
299	Ga0496101_0113803	3300048904	Bacteria	2039
300	Ga0496102_0130795	3300048905	Bacteria	2349
301	Ga0496103_0086387	3300048906	Bacteria	1977
302	Ga0496104_0014024	3300048907	Bacteria	7232
303	Ga0496104_0019919	3300048907	Bacteria	6144
304	Ga0496104_0146645	3300048907	Bacteria	2266
305	Ga0496105_0011589	3300048908	Bacteria	6972
306	Ga0496105_0040395	3300048908	Bacteria	3847
307	Ga0496105_0045354	3300048908	Bacteria	3627
308	Ga0496105_0065306	3300048908	Bacteria	3004
309	Ga0496105_0075620	3300048908	Bacteria	2781
310	Ga0496105_0092964	3300048908	Bacteria	2490
311	Ga0496106_0000046	3300048909	Bacteria	101516
312	Ga0496106_0003047	3300048909	Bacteria	12486
313	Ga0496106_0035306	3300048909	Bacteria	3738
314	Ga0496106_0057826	3300048909	Bacteria	2933
315	Ga0496106_0096246	3300048909	Bacteria	2290
316	Ga0496106_0128203	3300048909	Bacteria	1988
317	Ga0496107_0009811	3300048910	Bacteria	6641
318	Ga0496107_0079742	3300048910	Bacteria	2387
319	Ga0496107_0092881	3300048910	Bacteria	2206
320	Ga0496107_0121561	3300048910	Bacteria	1924
321	Ga0496108_0075537	3300048911	Bacteria	2847
322	Ga0496108_0116371	3300048911	Bacteria	2290
323	Ga0496108_0152831	3300048911	Bacteria	1992
324	Ga0496109_0012232	3300048912	Bacteria	7405
325	Ga0496109_0020815	3300048912	Bacteria	5795
326	Ga0496109_0066577	3300048912	Bacteria	3299
327	Ga0496109_0156395	3300048912	Bacteria	2135
328	Ga0496110_0030411	3300048913	Bacteria	4655
329	Ga0496110_0066756	3300048913	Bacteria	3182
330	Ga0496110_0165062	3300048913	Bacteria	2008
331	Ga0496111_0029692	3300048914	Bacteria	3884
332	Ga0496111_0035228	3300048914	Bacteria	3576
333	Ga0496112_0027103	3300048915	Bacteria	5523
334	Ga0496112_0039700	3300048915	Bacteria	4600
335	Ga0496112_0139349	3300048915	Bacteria	2395
336	Ga0496113_0004112	3300048916	Bacteria	8867
337	Ga0496113_0007298	3300048916	Bacteria	7096
338	Ga0496113_0013807	3300048916	Bacteria	5488
339	Ga0496113_0088554	3300048916	Bacteria	2381
340	Ga0496114_0058845	3300048917	Bacteria	3209
341	Ga0496114_0105592	3300048917	Bacteria	2409
342	Ga0496115_0001579	3300048918	Bacteria	16370
343	Ga0496116_0000764	3300048919	Bacteria	40872
344	Ga0496116_0081612	3300048919	Bacteria	2004
345	Ga0496121_0004198	3300048924	Bacteria	19675
346	Ga0496121_0007879	3300048924	Bacteria	12742
347	Ga0496121_0059945	3300048924	Bacteria	3135
348	Ga0496121_0083454	3300048924	Bacteria	2522
349	Ga0496122_0013438	3300048925	Bacteria	8012
350	Ga0496124_0000758	3300048927	Bacteria	52830
351	Ga0496124_0005004	3300048927	Bacteria	15153
352	Ga0496126_0000965	3300048929	Bacteria	49314
353	Ga0496126_0018257	3300048929	Bacteria	6958
354	Ga0496126_0020343	3300048929	Bacteria	6513
355	nmdc:mga03683_39334_c1	3300050489	Bacteria	1936
356	nmdc:mga03683_8948_c1	3300050489	Bacteria	3063
357	nmdc:mga0yw44_18931_c1	3300050492	Bacteria	3784
358	nmdc:mga0k408_1581_c1	3300050493	Bacteria	12304
359	nmdc:mga0k408_21578_c1	3300050493	Bacteria	3618
360	nmdc:mga0k408_50415_c1	3300050493	Bacteria	2410
361	nmdc:mga0k408_59666_c1	3300050493	Bacteria	2217
362	nmdc:mga06z11_2392_c1	3300050494	Bacteria	7148
363	nmdc:mga06z11_450_c1	3300050494	Bacteria	15361
364	nmdc:mga06z11_6353_c1	3300050494	Bacteria	4800
365	nmdc:mga04h51_4127_c1	3300050495	Bacteria	3582
366	nmdc:mga07m45_462_c1	3300050496	Bacteria	17099
367	nmdc:mga05p37_140_c1	3300050507	Bacteria	67571
368	nmdc:mga05p37_270145_c1	3300050507	Bacteria	2032
369	nmdc:mga09592_1169_c1	3300050508	Bacteria	20970
370	nmdc:mga09592_49931_c1	3300050508	Bacteria	3528
371	nmdc:mga06r32_1552_c1	3300050510	Bacteria	20702
372	nmdc:mga06r32_40742_c1	3300050510	Bacteria	4410
373	nmdc:mga06r32_65699_c1	3300050510	Bacteria	3500
374	nmdc:mga08y16_115464_c1	3300050511	Bacteria	2795
375	nmdc:mga08y16_28463_c1	3300050511	Bacteria	5891
376	nmdc:mga08y16_33694_c1	3300050511	Bacteria	5379
377	nmdc:mga08y16_7977_c1	3300050511	Bacteria	11082
378	nmdc:mga08y16_85917_c1	3300050511	Bacteria	3279
379	nmdc:mga08y16_92816_c1	3300050511	Bacteria	3146
380	nmdc:mga0n895_19652_c1	3300050512	Bacteria	6281
381	nmdc:mga0a205_33542_c1	3300050515	Bacteria	4922
382	nmdc:mga0sz30_2899_c1	3300050516	Bacteria	6142
383	nmdc:mga0sz30_289_c1	3300050516	Bacteria	11337
384	Ga0495601_0000001	3300053077	Bacteria	549454
385	Ga0495612_0000003	3300053078	Bacteria	303629
386	Ga0495595_0000049	3300053084	Bacteria	60566
387	Ga0495595_0015832	3300053084	Bacteria	3220
388	Ga0495619_0000004	3300053085	Bacteria	500068
389	Ga0495619_0060620	3300053085	Bacteria	2515
390	Ga0500641_0003259	3300053096	Bacteria	5737
391	Ga0500554_003580	3300053102	Bacteria	3201
392	Ga0500658_0001171	3300053134	Bacteria	10680
393	Ga0500559_0007938	3300053136	Bacteria	4678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025315	Ga0207697_10028275	Ga0207697_100282752	451
2	3300035118	Ga0373954_0063313	Ga0373954_0063313_106_1539	457
3	3300009177	Ga0105248_10260939	Ga0105248_102609391	459
4	3300046499	Ga0495594_0091241	Ga0495594_0091241_13_1446	461
5	3300046809	Ga0495600_0021540	Ga0495600_0021540_153_1586	463
6	3300047319	Ga0495674_0132151	Ga0495674_0132151_25_1458	463
7	3300035691	Ga0373931_0072282	Ga0373931_0072282_26_1510	470
8	3300048924	Ga0496121_0059945	Ga0496121_0059945_1669_3105	472
9	iso_pu_bacteria	2643221736	2644747696	474
10	3300035119	Ga0373956_0059418	Ga0373956_0059418_18_1454	477
11	3300048919	Ga0496116_0000764	Ga0496116_0000764_4254_5867	485
12	3300048924	Ga0496121_0083454	Ga0496121_0083454_897_2510	485
13	3300048925	Ga0496122_0013438	Ga0496122_0013438_5071_6684	485
14	3300048927	Ga0496124_0005004	Ga0496124_0005004_8745_10358	485
15	3300048929	Ga0496126_0020343	Ga0496126_0020343_4183_5796	485
16	3300036401	Ga0373937_0240215	Ga0373937_0240215_17_1501	486
17	3300047319	Ga0495674_0063708	Ga0495674_0063708_346_1857	487
18	3300047321	Ga0495676_0079978	Ga0495676_0079978_407_1918	487
19	3300050511	nmdc:mga08y16_115464_c1	nmdc:mga08y16_115464_c1_1226_2752	491
20	3300005842	Ga0068858_100082823	Ga0068858_1000828231	493
21	3300005844	Ga0068862_100041234	Ga0068862_1000412343	493
22	3300013308	Ga0157375_10049993	Ga0157375_100499931	493
23	3300026118	Ga0207675_100027907	Ga0207675_1000279073	493
24	3300048908	Ga0496105_0065306	Ga0496105_0065306_1507_2991	493
25	3300048910	Ga0496107_0121561	Ga0496107_0121561_384_1865	493
26	3300048927	Ga0496124_0000758	Ga0496124_0000758_26953_28566	494
27	3300047317	Ga0495604_0024835	Ga0495604_0024835_1225_2772	495
28	3300053084	Ga0495595_0015832	Ga0495595_0015832_314_1861	495
29	3300053085	Ga0495619_0060620	Ga0495619_0060620_487_2034	495
30	3300037068	Ga0373925_0155796	Ga0373925_0155796_148_1695	499
31	3300046642	Ga0495634_0047388	Ga0495634_0047388_243_1790	499
32	3300046681	Ga0495647_0040509	Ga0495647_0040509_132_1679	499
33	3300005434	Ga0070709_10012293	Ga0070709_100122934	500
34	3300005435	Ga0070714_100009791	Ga0070714_1000097915	500
35	3300005614	Ga0068856_100006556	Ga0068856_1000065564	500
36	3300006028	Ga0070717_10008103	Ga0070717_100081034	500
37	3300006175	Ga0070712_100025591	Ga0070712_1000255912	500
38	3300006844	Ga0075428_100074230	Ga0075428_1000742304	500
39	3300006847	Ga0075431_100117983	Ga0075431_1001179833	500
40	3300006852	Ga0075433_10157803	Ga0075433_101578032	500
41	3300006871	Ga0075434_100150898	Ga0075434_1001508982	500
42	3300006880	Ga0075429_100049161	Ga0075429_1000491613	500
43	3300007076	Ga0075435_100016505	Ga0075435_1000165053	500
44	3300014497	Ga0182008_10006166	Ga0182008_100061664	500
45	3300025906	Ga0207699_10019940	Ga0207699_100199401	500
46	3300025915	Ga0207693_10018788	Ga0207693_100187883	500
47	3300025916	Ga0207663_10010191	Ga0207663_100101914	500
48	3300025929	Ga0207664_10009159	Ga0207664_100091594	500
49	3300027907	Ga0207428_10029570	Ga0207428_100295701	500
50	3300035724	Ga0373933_0104132	Ga0373933_0104132_155_1687	500
51	3300048911	Ga0496108_0116371	Ga0496108_0116371_432_2081	500
52	3300048916	Ga0496113_0004112	Ga0496113_0004112_2675_4324	500
53	3300046512	Ga0495610_0001073	Ga0495610_0001073_8925_10433	501
54	3300046660	Ga0495625_0005057	Ga0495625_0005057_1666_3174	501
55	3300046660	Ga0495625_0016793	Ga0495625_0016793_3895_5403	501
56	3300048924	Ga0496121_0004198	Ga0496121_0004198_2534_4042	501
57	3300053134	Ga0500658_0001171	Ga0500658_0001171_2249_3757	501
58	3300053136	Ga0500559_0007938	Ga0500559_0007938_2921_4429	501
59	3300009101	Ga0105247_10049378	Ga0105247_100493782	502
60	3300009147	Ga0114129_10139453	Ga0114129_101394533	503
61	3300050508	nmdc:mga09592_49931_c1	nmdc:mga09592_49931_c1_1837_3384	503
62	3300050510	nmdc:mga06r32_65699_c1	nmdc:mga06r32_65699_c1_136_1683	503
63	3300050511	nmdc:mga08y16_33694_c1	nmdc:mga08y16_33694_c1_2597_4144	503
64	3300050512	nmdc:mga0n895_19652_c1	nmdc:mga0n895_19652_c1_4443_5990	503
65	3300050515	nmdc:mga0a205_33542_c1	nmdc:mga0a205_33542_c1_3094_4641	503
66	3300050511	nmdc:mga08y16_92816_c1	nmdc:mga08y16_92816_c1_373_2121	505
67	3300013306	Ga0163162_10094735	Ga0163162_100947352	506
68	3300048903	Ga0496100_0157283	Ga0496100_0157283_68_1591	506
69	3300048906	Ga0496103_0086387	Ga0496103_0086387_351_1874	506
70	3300048919	Ga0496116_0081612	Ga0496116_0081612_183_1799	506
71	3300048929	Ga0496126_0000965	Ga0496126_0000965_46426_48042	506
72	iso_pu_bacteria	2889033259	2889040747	506
73	3300009553	Ga0105249_10092031	Ga0105249_100920313	507
74	3300046664	Ga0495659_0028481	Ga0495659_0028481_63_1679	507
75	3300048909	Ga0496106_0128203	Ga0496106_0128203_107_1642	507
76	3300048910	Ga0496107_0009811	Ga0496107_0009811_1698_3233	507
77	3300048917	Ga0496114_0058845	Ga0496114_0058845_124_1659	507
78	3300053102	Ga0500554_003580	Ga0500554_003580_1131_2666	508
79	3300005334	Ga0068869_100043560	Ga0068869_1000435603	509
80	3300005546	Ga0070696_100038892	Ga0070696_1000388922	509
81	3300005719	Ga0068861_100053441	Ga0068861_1000534412	509
82	3300025933	Ga0207706_10022675	Ga0207706_100226753	509
83	3300025942	Ga0207689_10018364	Ga0207689_100183645	509
84	3300025961	Ga0207712_10111421	Ga0207712_101114211	509
85	3300025972	Ga0207668_10051266	Ga0207668_100512662	509
86	3300025986	Ga0207658_10125942	Ga0207658_101259421	509
87	3300026075	Ga0207708_10019938	Ga0207708_100199383	509
88	3300026118	Ga0207675_100027369	Ga0207675_1000273692	509
89	3300028380	Ga0268265_10008059	Ga0268265_100080595	509
90	3300028381	Ga0268264_10032351	Ga0268264_100323512	509
91	3300048904	Ga0496101_0113803	Ga0496101_0113803_305_1903	509
92	3300048908	Ga0496105_0092964	Ga0496105_0092964_824_2422	509
93	3300041491	Ga0451833_0080004	Ga0451833_0080004_2486_4102	510
94	3300041492	Ga0451835_0476648	Ga0451835_0476648_3103_4719	510
95	3300041494	Ga0451837_0909816	Ga0451837_0909816_449_2065	510
96	3300041496	Ga0451839_1394399	Ga0451839_1394399_449_2065	510
97	3300041498	Ga0451841_0027010	Ga0451841_0027010_489_2105	510
98	3300041501	Ga0451845_0987328	Ga0451845_0987328_3151_4767	510
99	3300041503	Ga0451847_0734143	Ga0451847_0734143_1525_3141	510
100	3300041505	Ga0451849_0456431	Ga0451849_0456431_449_2065	510
101	3300041507	Ga0451851_0881154	Ga0451851_0881154_994_2610	510
102	3300041509	Ga0451843_0923533	Ga0451843_0923533_1258_2874	510
103	3300041511	Ga0451855_0079597	Ga0451855_0079597_500_2116	510
104	3300041512	Ga0451853_1299160	Ga0451853_1299160_1141_2757	510
105	3300046660	Ga0495625_0054977	Ga0495625_0054977_712_2328	510
106	3300006852	Ga0075433_10019729	Ga0075433_100197292	511
107	3300006871	Ga0075434_100027331	Ga0075434_1000273312	511
108	3300007076	Ga0075435_100013628	Ga0075435_1000136285	511
109	3300048915	Ga0496112_0139349	Ga0496112_0139349_449_1987	511
110	3300005983	Ga0081540_1002056	Ga0081540_100205612	512
111	3300009553	Ga0105249_10054760	Ga0105249_100547602	512
112	3300013308	Ga0157375_10327020	Ga0157375_103270201	512
113	3300048909	Ga0496106_0035306	Ga0496106_0035306_1421_3019	512
114	3300048912	Ga0496109_0012232	Ga0496109_0012232_3277_4875	512
115	3300048916	Ga0496113_0013807	Ga0496113_0013807_1177_2775	512
116	3300050489	nmdc:mga03683_39334_c1	nmdc:mga03683_39334_c1_100_1647	512
117	3300005563	Ga0068855_100030189	Ga0068855_1000301894	513
118	3300006844	Ga0075428_100121391	Ga0075428_1001213912	513
119	3300006846	Ga0075430_100072840	Ga0075430_1000728402	513
120	3300006847	Ga0075431_100005277	Ga0075431_1000052778	513
121	3300006880	Ga0075429_100149652	Ga0075429_1001496522	513
122	3300009147	Ga0114129_10107281	Ga0114129_101072813	513
123	3300009551	Ga0105238_10000676	Ga0105238_1000067632	513
124	3300010375	Ga0105239_10015846	Ga0105239_100158464	513
125	3300013306	Ga0163162_10239827	Ga0163162_102398272	513
126	3300025924	Ga0207694_10059051	Ga0207694_100590512	513
127	3300025949	Ga0207667_10185535	Ga0207667_101855351	513
128	3300027907	Ga0207428_10045329	Ga0207428_100453292	513
129	3300035088	Ga0373940_0018390	Ga0373940_0018390_49_1644	513
130	3300050507	nmdc:mga05p37_140_c1	nmdc:mga05p37_140_c1_65098_66696	513
131	3300050508	nmdc:mga09592_1169_c1	nmdc:mga09592_1169_c1_239_1837	513
132	3300050510	nmdc:mga06r32_1552_c1	nmdc:mga06r32_1552_c1_827_2425	513
133	3300005518	Ga0070699_100004476	Ga0070699_10000447611	514
134	3300005548	Ga0070665_100004780	Ga0070665_1000047807	514
135	3300009094	Ga0111539_10111848	Ga0111539_101118482	514
136	3300028379	Ga0268266_10001206	Ga0268266_100012068	514
137	3300031852	Ga0307410_10057952	Ga0307410_100579523	514
138	3300031911	Ga0307412_10054106	Ga0307412_100541063	514
139	3300035170	Ga0373943_0015278	Ga0373943_0015278_63_1652	514
140	3300037466	Ga0395898_0081844	Ga0395898_0081844_519_2117	514
141	3300048909	Ga0496106_0000046	Ga0496106_0000046_48300_49916	514
142	3300050493	nmdc:mga0k408_50415_c1	nmdc:mga0k408_50415_c1_455_2005	514
143	3300050511	nmdc:mga08y16_7977_c1	nmdc:mga08y16_7977_c1_279_1829	514
144	3300005983	Ga0081540_1011752	Ga0081540_10117523	515
145	3300013306	Ga0163162_10168563	Ga0163162_101685633	515
146	3300046491	Ga0495584_0057601	Ga0495584_0057601_65_1657	516
147	3300046492	Ga0495585_0047706	Ga0495585_0047706_168_1760	516
148	3300046524	Ga0495648_0008822	Ga0495648_0008822_1390_2991	516
149	3300046615	Ga0495656_0014903	Ga0495656_0014903_380_1972	516
150	3300047321	Ga0495676_0031530	Ga0495676_0031530_1119_2729	516
151	3300048909	Ga0496106_0057826	Ga0496106_0057826_1286_2896	516
152	3300048910	Ga0496107_0079742	Ga0496107_0079742_477_2087	516
153	3300035170	Ga0373943_0000459	Ga0373943_0000459_12923_14524	517
154	3300035692	Ga0373935_0006657	Ga0373935_0006657_3133_4734	517
155	3300035695	Ga0373927_0001108	Ga0373927_0001108_11851_13452	517
156	3300035725	Ga0373947_0005069	Ga0373947_0005069_3190_4791	517
157	3300037068	Ga0373925_0002018	Ga0373925_0002018_14654_16255	517
158	3300046531	Ga0495665_0006600	Ga0495665_0006600_231_1838	517
159	3300046690	Ga0495624_0019275	Ga0495624_0019275_779_2380	517
160	3300047471	Ga0495684_0009542	Ga0495684_0009542_3606_5207	517
161	3300025303	Ga0209051_1005177	Ga0209051_10051773	518
162	3300046475	Ga0495639_0044088	Ga0495639_0044088_376_1995	518
163	3300048909	Ga0496106_0003047	Ga0496106_0003047_4672_6246	518
164	3300048924	Ga0496121_0007879	Ga0496121_0007879_5814_7388	518
165	3300048913	Ga0496110_0066756	Ga0496110_0066756_792_2402	519
166	3300009094	Ga0111539_10114669	Ga0111539_101146692	520
167	3300006844	Ga0075428_100186074	Ga0075428_1001860741	521
168	3300009101	Ga0105247_10020448	Ga0105247_100204483	521
169	3300009148	Ga0105243_10119584	Ga0105243_101195841	521
170	3300013297	Ga0157378_10081393	Ga0157378_100813932	521
171	3300014325	Ga0163163_10054075	Ga0163163_100540751	521
172	3300014326	Ga0157380_10082594	Ga0157380_100825941	521
173	3300035242	Ga0373962_0001924	Ga0373962_0001924_1273_2868	521
174	3300035691	Ga0373931_0002690	Ga0373931_0002690_1359_2954	521
175	3300048903	Ga0496100_0062216	Ga0496100_0062216_648_2219	521
176	3300048905	Ga0496102_0130795	Ga0496102_0130795_284_1855	521
177	3300048907	Ga0496104_0019919	Ga0496104_0019919_325_1896	521
178	3300048908	Ga0496105_0040395	Ga0496105_0040395_289_1860	521
179	3300048908	Ga0496105_0045354	Ga0496105_0045354_1505_3157	521
180	3300048909	Ga0496106_0096246	Ga0496106_0096246_496_2067	521
181	3300048910	Ga0496107_0092881	Ga0496107_0092881_517_2088	521
182	3300048911	Ga0496108_0075537	Ga0496108_0075537_405_2033	521
183	3300048912	Ga0496109_0020815	Ga0496109_0020815_3070_4767	521
184	3300048912	Ga0496109_0066577	Ga0496109_0066577_1300_2928	521
185	3300048913	Ga0496110_0030411	Ga0496110_0030411_1375_3003	521
186	3300048914	Ga0496111_0035228	Ga0496111_0035228_137_1765	521
187	3300048916	Ga0496113_0088554	Ga0496113_0088554_547_2199	521
188	3300048917	Ga0496114_0105592	Ga0496114_0105592_559_2130	521
189	3300013306	Ga0163162_10045107	Ga0163162_100451073	522
190	3300014326	Ga0157380_10116183	Ga0157380_101161832	522
191	3300046472	Ga0495580_0022730	Ga0495580_0022730_806_2425	522
192	3300005347	Ga0070668_100128335	Ga0070668_1001283352	524
193	3300005354	Ga0070675_100114963	Ga0070675_1001149632	524
194	3300005356	Ga0070674_100013967	Ga0070674_1000139675	524
195	3300005543	Ga0070672_100036674	Ga0070672_1000366742	524
196	3300005719	Ga0068861_100112551	Ga0068861_1001125512	524
197	3300005841	Ga0068863_100215965	Ga0068863_1002159651	524
198	3300005842	Ga0068858_100061925	Ga0068858_1000619252	524
199	3300005843	Ga0068860_100054703	Ga0068860_1000547032	524
200	3300005844	Ga0068862_100065545	Ga0068862_1000655452	524
201	3300006038	Ga0075365_10099855	Ga0075365_100998552	524
202	3300006177	Ga0075362_10014422	Ga0075362_100144222	524
203	3300006178	Ga0075367_10030495	Ga0075367_100304952	524
204	3300006195	Ga0075366_10055958	Ga0075366_100559582	524
205	3300009094	Ga0111539_10104817	Ga0111539_101048172	524
206	3300009148	Ga0105243_10006688	Ga0105243_100066885	524
207	3300009553	Ga0105249_10049003	Ga0105249_100490032	524
208	3300025926	Ga0207659_10078935	Ga0207659_100789351	524
209	3300025937	Ga0207669_10043165	Ga0207669_100431652	524
210	3300025940	Ga0207691_10099137	Ga0207691_100991372	524
211	3300025972	Ga0207668_10115770	Ga0207668_101157701	524
212	3300026035	Ga0207703_10046940	Ga0207703_100469402	524
213	3300026089	Ga0207648_10020616	Ga0207648_100206165	524
214	3300026118	Ga0207675_100105567	Ga0207675_1001055672	524
215	3300027907	Ga0207428_10049557	Ga0207428_100495572	524
216	3300028381	Ga0268264_10016104	Ga0268264_100161043	524
217	3300036401	Ga0373937_0134069	Ga0373937_0134069_79_1791	524
218	3300050493	nmdc:mga0k408_59666_c1	nmdc:mga0k408_59666_c1_367_1959	524
219	3300050511	nmdc:mga08y16_85917_c1	nmdc:mga08y16_85917_c1_1457_3049	524
220	iso_pu_bacteria	2775506901	2776257684	524
221	iso_pu_bacteria	2775506901	2776259770	524
222	3300005334	Ga0068869_100069343	Ga0068869_1000693431	525
223	3300005338	Ga0068868_100003568	Ga0068868_1000035686	525
224	3300005455	Ga0070663_100019530	Ga0070663_1000195302	525
225	3300005539	Ga0068853_100018386	Ga0068853_1000183862	525
226	3300005548	Ga0070665_100001119	Ga0070665_10000111925	525
227	3300006042	Ga0075368_10012581	Ga0075368_100125813	525
228	3300006186	Ga0075369_10008195	Ga0075369_100081954	525
229	3300006195	Ga0075366_10001491	Ga0075366_1000149112	525
230	3300006353	Ga0075370_10000079	Ga0075370_1000007921	525
231	3300009094	Ga0111539_10139203	Ga0111539_101392032	525
232	3300009174	Ga0105241_10001795	Ga0105241_1000179512	525
233	3300009545	Ga0105237_10035073	Ga0105237_100350734	525
234	3300010375	Ga0105239_10023932	Ga0105239_100239325	525
235	3300013296	Ga0157374_10023104	Ga0157374_100231044	525
236	3300025911	Ga0207654_10001406	Ga0207654_1000140610	525
237	3300025914	Ga0207671_10017253	Ga0207671_100172536	525
238	3300025941	Ga0207711_10025187	Ga0207711_100251872	525
239	3300025942	Ga0207689_10072600	Ga0207689_100726004	525
240	3300025972	Ga0207668_10010667	Ga0207668_100106671	525
241	3300026023	Ga0207677_10003271	Ga0207677_100032718	525
242	3300026035	Ga0207703_10015022	Ga0207703_100150226	525
243	3300026041	Ga0207639_10030492	Ga0207639_100304924	525
244	3300026067	Ga0207678_10032197	Ga0207678_100321974	525
245	3300026088	Ga0207641_10033025	Ga0207641_100330254	525
246	3300026095	Ga0207676_10013215	Ga0207676_100132153	525
247	3300027866	Ga0209813_10002765	Ga0209813_100027653	525
248	3300028379	Ga0268266_10001365	Ga0268266_1000136520	525
249	3300028381	Ga0268264_10054508	Ga0268264_100545083	525
250	3300046473	Ga0495582_0008892	Ga0495582_0008892_3147_4742	525
251	3300050492	nmdc:mga0yw44_18931_c1	nmdc:mga0yw44_18931_c1_2123_3739	525
252	3300050493	nmdc:mga0k408_1581_c1	nmdc:mga0k408_1581_c1_1636_3231	525
253	3300050494	nmdc:mga06z11_450_c1	nmdc:mga06z11_450_c1_13681_15276	525
254	3300050495	nmdc:mga04h51_4127_c1	nmdc:mga04h51_4127_c1_517_2112	525
255	3300050496	nmdc:mga07m45_462_c1	nmdc:mga07m45_462_c1_5275_6870	525
256	3300050511	nmdc:mga08y16_28463_c1	nmdc:mga08y16_28463_c1_1192_2820	525
257	3300050516	nmdc:mga0sz30_2899_c1	nmdc:mga0sz30_2899_c1_2912_4507	525
258	iso_pu_bacteria	2935684952	2935693537	525
259	iso_pu_bacteria	2935694250	2935702273	525
260	iso_pu_bacteria	2935713505	2935721727	525
261	iso_pu_bacteria	2935722832	2935730943	525
262	iso_pu_bacteria	2935732158	2935740866	525
263	iso_pu_bacteria	2935741537	2935750130	525
264	iso_pu_bacteria	2935750917	2935759520	525
265	iso_pu_bacteria	2935760218	2935768976	525
266	iso_pu_bacteria	2940556831	2940565424	525
267	3300005435	Ga0070714_100114175	Ga0070714_1001141752	526
268	3300005439	Ga0070711_100029132	Ga0070711_1000291322	526
269	3300005441	Ga0070700_100054581	Ga0070700_1000545812	526
270	3300005983	Ga0081540_1002563	Ga0081540_10025637	526
271	3300025915	Ga0207693_10044274	Ga0207693_100442743	526
272	3300027907	Ga0207428_10020429	Ga0207428_100204293	526
273	3300035695	Ga0373927_0041262	Ga0373927_0041262_750_2378	526
274	3300037068	Ga0373925_0093443	Ga0373925_0093443_425_2053	526
275	3300046459	Ga0495629_0005910	Ga0495629_0005910_510_2138	526
276	3300046461	Ga0495641_0014801	Ga0495641_0014801_1533_3161	526
277	3300046475	Ga0495639_0016122	Ga0495639_0016122_433_2061	526
278	3300046476	Ga0495662_0036069	Ga0495662_0036069_452_2080	526
279	3300046499	Ga0495594_0028289	Ga0495594_0028289_425_2053	526
280	3300046531	Ga0495665_0004929	Ga0495665_0004929_4257_5885	526
281	3300046642	Ga0495634_0043115	Ga0495634_0043115_447_2075	526
282	3300046663	Ga0495635_0006026	Ga0495635_0006026_4632_6260	526
283	3300046683	Ga0495658_0010120	Ga0495658_0010120_2720_4348	526
284	3300047315	Ga0495581_0000593	Ga0495581_0000593_425_2053	526
285	3300047319	Ga0495674_0075696	Ga0495674_0075696_842_2470	526
286	3300047472	Ga0495686_0011012	Ga0495686_0011012_2953_4653	526
287	3300047673	Ga0495593_0014718	Ga0495593_0014718_417_2045	526
288	3300050510	nmdc:mga06r32_40742_c1	nmdc:mga06r32_40742_c1_642_2237	526
289	iso_pu_bacteria	2775506901	2776260167	526
290	iso_pu_bacteria	2894232714	2894234360	526
291	iso_pu_bacteria	2935608549	2935611267	526
292	iso_pu_bacteria	2935819856	2935820745	526
293	iso_pu_bacteria	2935847175	2935849237	526
294	iso_pu_bacteria	2935916978	2935920388	526
295	iso_pu_bacteria	8005542996	8005549658	526
296	3300005347	Ga0070668_100018702	Ga0070668_1000187022	527
297	3300025972	Ga0207668_10067794	Ga0207668_100677942	527
298	3300026118	Ga0207675_100035509	Ga0207675_1000355092	527
299	iso_pu_bacteria	2513237104	2513721429	527
300	iso_pu_bacteria	2513237137	2513863646	527
301	iso_pu_bacteria	2524023210	2524463824	527
302	iso_pu_bacteria	2524023210	2524467622	527
303	iso_pu_bacteria	2876808645	2876810382	527
304	iso_pu_bacteria	2879110137	2879110318	527
305	iso_pu_bacteria	2935638405	2935648152	527
306	iso_pu_bacteria	2935665750	2935675085	527
307	iso_pu_bacteria	2935810662	2935813239	527
308	iso_pu_bacteria	2935827899	2935837657	527
309	iso_pu_bacteria	2936037263	2936043791	527
310	iso_pu_bacteria	8006984368	8006991186	527
311	3300005937	Ga0081455_10002025	Ga0081455_100020257	528
312	3300031507	Ga0307509_10062948	Ga0307509_100629483	528
313	3300033180	Ga0307510_10044265	Ga0307510_100442653	528
314	3300035111	Ga0373923_0005813	Ga0373923_0005813_317_1912	528
315	3300035113	Ga0373936_0021287	Ga0373936_0021287_206_1801	528
316	3300035117	Ga0373953_0004562	Ga0373953_0004562_976_2571	528
317	3300035118	Ga0373954_0015753	Ga0373954_0015753_1739_3334	528
318	3300035410	Ga0373924_0003272	Ga0373924_0003272_2916_4511	528
319	3300035692	Ga0373935_0000418	Ga0373935_0000418_11715_13310	528
320	3300035695	Ga0373927_0004279	Ga0373927_0004279_1667_3259	528
321	3300035695	Ga0373927_0026385	Ga0373927_0026385_1329_2924	528
322	3300035724	Ga0373933_0002288	Ga0373933_0002288_3957_5552	528
323	3300035725	Ga0373947_0002133	Ga0373947_0002133_498_2093	528
324	3300037068	Ga0373925_0000064	Ga0373925_0000064_65216_66811	528
325	3300046454	Ga0495592_0000388	Ga0495592_0000388_20840_22435	528
326	3300046459	Ga0495629_0086359	Ga0495629_0086359_165_1760	528
327	3300046462	Ga0495651_0000485	Ga0495651_0000485_9334_10929	528
328	3300046463	Ga0495653_0000086	Ga0495653_0000086_9381_10976	528
329	3300046476	Ga0495662_0001011	Ga0495662_0001011_10553_12148	528
330	3300046477	Ga0495664_0000003	Ga0495664_0000003_235724_237319	528
331	3300046511	Ga0495608_0000011	Ga0495608_0000011_181728_183323	528
332	3300046514	Ga0495618_0000099	Ga0495618_0000099_25523_27118	528
333	3300046516	Ga0495628_0000001	Ga0495628_0000001_725125_726720	528
334	3300046529	Ga0495652_0000002	Ga0495652_0000002_939659_941254	528
335	3300046533	Ga0495640_0000002	Ga0495640_0000002_179988_181583	528
336	3300046536	Ga0495587_0000001	Ga0495587_0000001_252394_253989	528
337	3300046543	Ga0495645_0000009	Ga0495645_0000009_228695_230290	528
338	3300046559	Ga0495667_0000004	Ga0495667_0000004_152041_153636	528
339	3300046642	Ga0495634_0000478	Ga0495634_0000478_2021_3616	528
340	3300046663	Ga0495635_0000001	Ga0495635_0000001_238205_239800	528
341	3300046675	Ga0495657_0001469	Ga0495657_0001469_9342_10937	528
342	3300046678	Ga0495599_0000036	Ga0495599_0000036_35912_37507	528
343	3300046679	Ga0495623_0000043	Ga0495623_0000043_70876_72471	528
344	3300046680	Ga0495646_0000019	Ga0495646_0000019_52674_54269	528
345	3300046689	Ga0495613_0005820	Ga0495613_0005820_969_2564	528
346	3300046809	Ga0495600_0000017	Ga0495600_0000017_42758_44353	528
347	3300047317	Ga0495604_0000008	Ga0495604_0000008_266045_267640	528
348	3300047317	Ga0495604_0036558	Ga0495604_0036558_1511_3106	528
349	3300047319	Ga0495674_0000016	Ga0495674_0000016_73635_75230	528
350	3300047322	Ga0495680_0000974	Ga0495680_0000974_10284_11879	528
351	3300047444	Ga0495675_0000163	Ga0495675_0000163_35603_37198	528
352	3300047471	Ga0495684_0000002	Ga0495684_0000002_266103_267698	528
353	3300047673	Ga0495593_0002510	Ga0495593_0002510_6955_8550	528
354	3300048088	Ga0495602_0000066	Ga0495602_0000066_35905_37500	528
355	3300053077	Ga0495601_0000001	Ga0495601_0000001_305603_307198	528
356	3300053078	Ga0495612_0000003	Ga0495612_0000003_35907_37502	528
357	3300053084	Ga0495595_0000049	Ga0495595_0000049_10658_12253	528
358	3300053085	Ga0495619_0000004	Ga0495619_0000004_305634_307229	528
359	3300005347	Ga0070668_100009402	Ga0070668_1000094027	529
360	3300006177	Ga0075362_10003731	Ga0075362_100037312	529
361	3300006195	Ga0075366_10070515	Ga0075366_100705151	529
362	3300006353	Ga0075370_10039675	Ga0075370_100396752	529
363	3300025928	Ga0207700_10069571	Ga0207700_100695713	529
364	3300025972	Ga0207668_10097023	Ga0207668_100970232	529
365	3300028380	Ga0268265_10017749	Ga0268265_100177495	529
366	3300050489	nmdc:mga03683_8948_c1	nmdc:mga03683_8948_c1_306_1928	529
367	3300050493	nmdc:mga0k408_21578_c1	nmdc:mga0k408_21578_c1_1265_2887	529
368	3300050494	nmdc:mga06z11_2392_c1	nmdc:mga06z11_2392_c1_3422_5044	529
369	3300005545	Ga0070695_100001511	Ga0070695_1000015119	530
370	3300005548	Ga0070665_100004691	Ga0070665_1000046914	530
371	3300005844	Ga0068862_100016183	Ga0068862_1000161832	530
372	3300005937	Ga0081455_10002221	Ga0081455_1000222111	530
373	3300006038	Ga0075365_10031621	Ga0075365_100316212	530
374	3300006178	Ga0075367_10009758	Ga0075367_100097584	530
375	3300006186	Ga0075369_10004185	Ga0075369_100041852	530
376	3300006353	Ga0075370_10016033	Ga0075370_100160333	530
377	3300009101	Ga0105247_10009199	Ga0105247_100091993	530
378	3300013308	Ga0157375_10219389	Ga0157375_102193891	530
379	3300025900	Ga0207710_10010904	Ga0207710_100109043	530
380	3300026121	Ga0207683_10034179	Ga0207683_100341792	530
381	3300028379	Ga0268266_10004115	Ga0268266_100041153	530
382	3300028380	Ga0268265_10023995	Ga0268265_100239952	530
383	3300048904	Ga0496101_0017384	Ga0496101_0017384_3188_4783	530
384	3300048907	Ga0496104_0146645	Ga0496104_0146645_433_2028	530
385	3300048908	Ga0496105_0075620	Ga0496105_0075620_849_2444	530
386	3300048911	Ga0496108_0152831	Ga0496108_0152831_331_1980	530
387	3300048912	Ga0496109_0156395	Ga0496109_0156395_179_1774	530
388	3300048913	Ga0496110_0165062	Ga0496110_0165062_180_1775	530
389	3300048915	Ga0496112_0027103	Ga0496112_0027103_257_1852	530
390	3300048918	Ga0496115_0001579	Ga0496115_0001579_3767_5362	530
391	3300048929	Ga0496126_0018257	Ga0496126_0018257_1012_2634	530
392	3300050494	nmdc:mga06z11_6353_c1	nmdc:mga06z11_6353_c1_104_1702	530
393	3300050507	nmdc:mga05p37_270145_c1	nmdc:mga05p37_270145_c1_351_1946	530
394	3300050516	nmdc:mga0sz30_289_c1	nmdc:mga0sz30_289_c1_5950_7548	530
395	3300053096	Ga0500641_0003259	Ga0500641_0003259_1073_2677	530
396	3300005347	Ga0070668_100020931	Ga0070668_1000209313	531
397	3300005456	Ga0070678_100007547	Ga0070678_1000075473	531
398	3300005457	Ga0070662_100085831	Ga0070662_1000858312	531
399	3300009553	Ga0105249_10045765	Ga0105249_100457654	531
400	3300025935	Ga0207709_10026308	Ga0207709_100263083	531
401	3300025937	Ga0207669_10008078	Ga0207669_100080783	531
402	3300025961	Ga0207712_10004116	Ga0207712_100041163	531
403	3300025972	Ga0207668_10014277	Ga0207668_100142773	531
404	3300026075	Ga0207708_10067531	Ga0207708_100675312	531
405	3300026121	Ga0207683_10077354	Ga0207683_100773542	531
406	3300046684	Ga0495669_0042152	Ga0495669_0042152_374_1972	531
407	3300048908	Ga0496105_0011589	Ga0496105_0011589_4663_6267	531
408	3300048914	Ga0496111_0029692	Ga0496111_0029692_1623_3221	531
409	3300048915	Ga0496112_0039700	Ga0496112_0039700_2258_3862	531
410	3300048916	Ga0496113_0007298	Ga0496113_0007298_1562_3166	531
411	3300005937	Ga0081455_10139988	Ga0081455_101399881	532
412	3300006931	Ga0097620_100150853	Ga0097620_1001508533	533
413	3300025900	Ga0207710_10026498	Ga0207710_100264981	533
414	3300035692	Ga0373935_0034119	Ga0373935_0034119_495_2186	536
415	3300046529	Ga0495652_0020307	Ga0495652_0020307_74_1768	536
416	3300005618	Ga0068864_100127691	Ga0068864_1001276912	537
417	3300014325	Ga0163163_10225037	Ga0163163_102250371	537
418	3300026095	Ga0207676_10102509	Ga0207676_101025091	537
419	3300048907	Ga0496104_0014024	Ga0496104_0014024_2422_4104	537
420	iso_pu_bacteria	2534681796	2535517317	541
421	iso_pu_bacteria	2585427528	2585539134	541
422	iso_pu_bacteria	2585427593	2585837086	541
423	iso_pu_bacteria	2842110456	2842114410	541
424	iso_pu_bacteria	2933586486	2933590733	541
425	3300006944	Ga0099823_1011666	Ga0099823_10116666	543
426	3300027296	Ga0209389_1000147	Ga0209389_100014748	543
427	3300027361	Ga0209489_100875	Ga0209489_10087548	543
428	3300003354	JGI25160J50197_1000383	JGI25160J50197_100038317	545
429	3300005262	Ga0065165_1002227	Ga0065165_100222714	545
430	3300025302	Ga0207426_1000035	Ga0207426_1000035309	545

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

71

413

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7aj0-assembly1.cif.gz_F	crystal structure of psfucs1 sulfatase from pseudoalteromonas sp.	0.8498	45	525
6psm-assembly3.cif.gz_D	crystal structure of pss1_19b c77s in complex with kappa-neocarrabiose	0.801	45	541
7aj0-assembly1.cif.gz_F	crystal structure of psfucs1 sulfatase from pseudoalteromonas sp.	0.7839	45	525
1e33-assembly1.cif.gz_P-2	crystal structure of an arylsulfatase a mutant p426l	0.783	45	512
6psm-assembly3.cif.gz_D	crystal structure of pss1_19b c77s in complex with kappa-neocarrabiose	0.7809	45	541

ID	Description	Score	Start	End	Superfamily
af_Q32KJ6_30_387_3.40.720.10	Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A	0.8493	45	434	3.40.720.10
af_Q32KJ6_30_387_3.40.720.10	Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A	0.8471	45	434	3.40.720.10
af_Q8SZ72_26_377_3.40.720.10	Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A	0.8303	47	428	3.40.720.10
af_Q8SZ72_26_377_3.40.720.10	Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A	0.8281	47	428	3.40.720.10
1e1zP01	Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A	0.8207	45	428	3.40.720.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1R7Q8K6-F1-model_v4	Arylsulfatase (EC 3.1.6.1)	0.9695	44	286	GO:0004065
AF-A0A3N5TUK5-F1-model_v4	Arylsulfatase	0.9685	45	468
AF-A0A4Q5Y054-F1-model_v4	deleted	0.9673	44	496
AF-A0A2A2GHW2-F1-model_v4	Arylsulfatase	0.9668	43	542
AF-A0A1H5VT36-F1-model_v4	Arylsulfatase	0.9666	71	541

Feature Viewer

pLDDT	pTM	Quality
82.97	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442128

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00884

Sulfatase

Sulfatase

71

413

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map